Serine--tRNA ligase

Overview
NameSerine--tRNA ligase
Smed IDSMED30015195
Length (bp)1309
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine--tRNA ligase (SMED30015195) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine--tRNA ligase (SMED30015195) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine--tRNA ligase (SMED30015195) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine--tRNA ligase (SMED30015195) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Serine--tRNA ligase vs. Ensembl Human
Match: SARS2 (seryl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17697])

HSP 1 Score: 242.276 bits (617), Expect = 5.014e-74
Identity = 130/345 (37.68%), Postives = 203/345 (58.84%), Query Frame = 3
Query:  243 LPNLVSPTTPVGKEKDSIITKLVKTNE-NKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLESH-LYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            LPN   P  PVG E  + +  +V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +T   L++ GF  ++VPD++   + +  G   +   +QIYN+  +P    + FK  +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++L+  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   +GE++SASNCTD+Q+R ++I ++ E  +L FAHT+N T CAVPRLL ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  172 LPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DP----ARFK--DLN-------LAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQ 501          
BLAST of Serine--tRNA ligase vs. Ensembl Human
Match: SARS2 (seryl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17697])

HSP 1 Score: 242.276 bits (617), Expect = 5.014e-74
Identity = 130/345 (37.68%), Postives = 203/345 (58.84%), Query Frame = 3
Query:  243 LPNLVSPTTPVGKEKDSIITKLVKTNE-NKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLESH-LYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            LPN   P  PVG E  + +  +V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +T   L++ GF  ++VPD++   + +  G   +   +QIYN+  +P    + FK  +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++L+  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   +GE++SASNCTD+Q+R ++I ++ E  +L FAHT+N T CAVPRLL ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  172 LPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DP----ARFK--DLN-------LAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQ 501          
BLAST of Serine--tRNA ligase vs. Ensembl Human
Match: SARS2 (seryl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17697])

HSP 1 Score: 241.891 bits (616), Expect = 6.097e-74
Identity = 130/345 (37.68%), Postives = 203/345 (58.84%), Query Frame = 3
Query:  243 LPNLVSPTTPVGKEKDSIITKLVKTNE-NKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLESH-LYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            LPN   P  PVG E  + +  +V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +T   L++ GF  ++VPD++   + +  G   +   +QIYN+  +P    + FK  +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++L+  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   +GE++SASNCTD+Q+R ++I ++ E  +L FAHT+N T CAVPRLL ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  170 LPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DP----ARFK--DLN-------LAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQ 499          
BLAST of Serine--tRNA ligase vs. Ensembl Human
Match: SARS2 (seryl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17697])

HSP 1 Score: 241.891 bits (616), Expect = 6.097e-74
Identity = 130/345 (37.68%), Postives = 203/345 (58.84%), Query Frame = 3
Query:  243 LPNLVSPTTPVGKEKDSIITKLVKTNE-NKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLESH-LYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            LPN   P  PVG E  + +  +V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +T   L++ GF  ++VPD++   + +  G   +   +QIYN+  +P    + FK  +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++L+  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   +GE++SASNCTD+Q+R ++I ++ E  +L FAHT+N T CAVPRLL ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  170 LPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DP----ARFK--DLN-------LAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQ 499          
BLAST of Serine--tRNA ligase vs. Ensembl Human
Match: AC011455.3 (novel protein)

HSP 1 Score: 242.276 bits (617), Expect = 2.592e-73
Identity = 130/345 (37.68%), Postives = 203/345 (58.84%), Query Frame = 3
Query:  243 LPNLVSPTTPVGKEKDSIITKLVKTNE-NKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLESH-LYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            LPN   P  PVG E  + +  +V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +T   L++ GF  ++VPD++   + +  G   +   +QIYN+  +P    + FK  +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++L+  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   +GE++SASNCTD+Q+R ++I ++ E  +L FAHT+N T CAVPRLL ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  240 LPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DP----ARFK--DLN-------LAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQ 569          
BLAST of Serine--tRNA ligase vs. Ensembl Celegans
Match: sars-2 (Seryl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:U4PQY8])

HSP 1 Score: 213.001 bits (541), Expect = 3.655e-64
Identity = 122/350 (34.86%), Postives = 188/350 (53.71%), Query Frame = 3
Query:  213 YYEIFSMINNLPNLVSPTTPVGKEKDS-IITKLVKTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILET-HHTENGHVVVPEVLRKYMKDICKITRQHP 1250
            + E++     +PN+     P G E  + I+ +  +  E++     +++      L   D +     R+Y   G  A LE+AL+ Y  E +   GF+ I+VPDI++  + Q  G         +     +P + T   +++          L+GT+EM +A +L      +   PI+L ++SRC+R E+S    E+ LYRVH+F+KVEMF  ++  +S   LDY+V++Q      LG+  R L+M SEELG  A +K+DIE WMPG K+YGE+SSASNCTD+Q+R + I Y+  +    +AHT NGT  A  R L S+LET  + + G   +PE LRK +K      R  P
Sbjct:  106 WDELYDEAILIPNMTQDGVPRGSEDQAKIVAEWGEKREDECLTAEKLVQTWRSLLHPTDASG---QRSYVFLGALASLEKALLDYAHERVCALGFRPITVPDIVSGEVTQACG---------VMQRSDHPIQYTLAGEESHTK-------LSGTAEMGIAAFLRGRTFNQDQLPIRLVSLSRCFRTEISKSASEAKLYRVHEFSKVEMFVVSTPEQSAAELDYLVEVQKGTFQALGVHCRQLEMPSEELGASAARKFDIEAWMPGRKLYGEVSSASNCTDFQSRRLGIKYKTADGTTKYAHTCNGTALASTRALISVLETFQNDKKGLGELPEPLRKRVKQRGSPLRFQP 436          
BLAST of Serine--tRNA ligase vs. Ensembl Celegans
Match: sars-2 (Seryl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:U4PQY8])

HSP 1 Score: 186.422 bits (472), Expect = 1.532e-56
Identity = 91/200 (45.50%), Postives = 127/200 (63.50%), Query Frame = 3
Query:  660 LAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILET-HHTENGHVVVPEVLRKYMKDICKITRQHP 1250
            L+GT+EM +A +L      +   PI+L ++SRC+R E+S    E+ LYRVH+F+KVEMF  ++  +S   LDY+V++Q      LG+  R L+M SEELG  A +K+DIE WMPG K+YGE+SSASNCTD+Q+R + I Y+  +    +AHT NGT  A  R L S+LET  + + G   +PE LRK +K      R  P
Sbjct:   21 LSGTAEMGIAAFLRGRTFNQDQLPIRLVSLSRCFRTEISKSASEAKLYRVHEFSKVEMFVVSTPEQSAAELDYLVEVQKGTFQALGVHCRQLEMPSEELGASAARKFDIEAWMPGRKLYGEVSSASNCTDFQSRRLGIKYKTADGTTKYAHTCNGTALASTRALISVLETFQNDKKGLGELPEPLRKRVKQRGSPLRFQP 220          
BLAST of Serine--tRNA ligase vs. Ensembl Celegans
Match: sars-1 (Probable serine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q18678])

HSP 1 Score: 163.31 bits (412), Expect = 5.237e-45
Identity = 92/281 (32.74%), Postives = 154/281 (54.80%), Query Frame = 3
Query:  399 AESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMF--CATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFY---ENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            A  R Y+L G    LE+A+I+  L+ L   G+  +  P  + K ++Q+   ++  F +++Y V +   E+         +TS   + L  TSE  +A Y  N  +K+   PIK   VS C+R+EV   G ++  ++RVHQF K+E F  C+ + +ES  + D ++         L + ++++++ S EL N A KK+D+E W PG   Y E+ S SNC DYQ+R + + Y   +  + ++ F H LN T CA  R++ +ILE + TE G + VP  ++++M
Sbjct:  189 AGGRGYFLKGPLVFLEQAIIQLALQRLNVKGYVPLYTPFFMRKEVMQEVA-QLSQFDDELYKVSSKGSEIAG-------DTSVDEKYLIATSEQPIAAYHRNEWIKETELPIKYAGVSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVLCSPNDNESWTLFDEMIGNAESYYQELQIPYQVVNIVSGELNNAAAKKFDLEAWFPGSGAYRELVSCSNCLDYQSRRLKVRYGQTKKLSGEVPFVHMLNATMCATTRVICAILENNQTEEG-INVPTAIQQWM 460          
BLAST of Serine--tRNA ligase vs. Ensembl Celegans
Match: sars-1 (Probable serine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q18678])

HSP 1 Score: 163.31 bits (412), Expect = 5.237e-45
Identity = 92/281 (32.74%), Postives = 154/281 (54.80%), Query Frame = 3
Query:  399 AESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMF--CATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFY---ENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            A  R Y+L G    LE+A+I+  L+ L   G+  +  P  + K ++Q+   ++  F +++Y V +   E+         +TS   + L  TSE  +A Y  N  +K+   PIK   VS C+R+EV   G ++  ++RVHQF K+E F  C+ + +ES  + D ++         L + ++++++ S EL N A KK+D+E W PG   Y E+ S SNC DYQ+R + + Y   +  + ++ F H LN T CA  R++ +ILE + TE G + VP  ++++M
Sbjct:  189 AGGRGYFLKGPLVFLEQAIIQLALQRLNVKGYVPLYTPFFMRKEVMQEVA-QLSQFDDELYKVSSKGSEIAG-------DTSVDEKYLIATSEQPIAAYHRNEWIKETELPIKYAGVSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVLCSPNDNESWTLFDEMIGNAESYYQELQIPYQVVNIVSGELNNAAAKKFDLEAWFPGSGAYRELVSCSNCLDYQSRRLKVRYGQTKKLSGEVPFVHMLNATMCATTRVICAILENNQTEEG-INVPTAIQQWM 460          
BLAST of Serine--tRNA ligase vs. Ensembl Fly
Match: SerRS-m (gene:FBgn0021750 transcript:FBtr0083086)

HSP 1 Score: 260.381 bits (664), Expect = 1.852e-82
Identity = 143/377 (37.93%), Postives = 224/377 (59.42%), Query Frame = 3
Query:  135 QSLVVRNENVEINDLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENKFSKHAQI-----IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGL--ESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEND-DLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITR 1241
            +++VVR+    +  +  L+Q +  G+ +++  +   L  L + T P  ++      +L +    + +  +++     + + L   R++ +      ++YYL G  A LE+A+I+Y L+ + ++GF+LISVPDI+ K +++  G + +  + Q+Y + T                    ECL+GTSEMALA + +N +L +   P+K+ AVSRCYR E SGL  E  +YRVHQFNKVEMF   ++ +SE  L+   +I+  +   LGL FR+LDM   ELG PA++KYDIE WMPG +++GEISS SNCTDYQAR + I Y    D  +  AHT+NGT  A+PRLL ++LE++  E+G + +P VLR +M +   ITR
Sbjct:   46 RNVVVRHHKNNVPLIRSLIQELDAGDQHKLRQLQAELEQLPNATHPRLRDYGEEPRELAQYVHRQLTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKLDTG-------------------ECLSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAETSGLQEEKGIYRVHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLESYQKEDG-IEIPAVLRPFMDNQELITR 402          
BLAST of Serine--tRNA ligase vs. Ensembl Fly
Match: SerRS-m (gene:FBgn0021750 transcript:FBtr0334589)

HSP 1 Score: 260.381 bits (664), Expect = 1.852e-82
Identity = 143/377 (37.93%), Postives = 224/377 (59.42%), Query Frame = 3
Query:  135 QSLVVRNENVEINDLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENKFSKHAQI-----IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGL--ESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEND-DLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITR 1241
            +++VVR+    +  +  L+Q +  G+ +++  +   L  L + T P  ++      +L +    + +  +++     + + L   R++ +      ++YYL G  A LE+A+I+Y L+ + ++GF+LISVPDI+ K +++  G + +  + Q+Y + T                    ECL+GTSEMALA + +N +L +   P+K+ AVSRCYR E SGL  E  +YRVHQFNKVEMF   ++ +SE  L+   +I+  +   LGL FR+LDM   ELG PA++KYDIE WMPG +++GEISS SNCTDYQAR + I Y    D  +  AHT+NGT  A+PRLL ++LE++  E+G + +P VLR +M +   ITR
Sbjct:   46 RNVVVRHHKNNVPLIRSLIQELDAGDQHKLRQLQAELEQLPNATHPRLRDYGEEPRELAQYVHRQLTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKLDTG-------------------ECLSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAETSGLQEEKGIYRVHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLESYQKEDG-IEIPAVLRPFMDNQELITR 402          
BLAST of Serine--tRNA ligase vs. Ensembl Fly
Match: SerRS (gene:FBgn0031497 transcript:FBtr0335480)

HSP 1 Score: 164.081 bits (414), Expect = 5.156e-45
Identity = 98/279 (35.13%), Postives = 153/279 (54.84%), Query Frame = 3
Query:  405 SRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFY---ENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
             R Y+L G    LE+ALI++ L +L    +  +  P  + K ++Q+   ++  F  ++Y VV    E     K  E+      + L  TSE  +A Y  +  L + + PIK   +S C+R+EV   G ++  ++RVHQF KVE F  TS   ++S +M+D ++    +    LG+ +R++++ S  L + A KK D+E W  G   Y E+ S SNC DYQAR + + +   +  N  +D+ H LN T CA  R++ +ILETH TE G + VPE L+KYM
Sbjct:  192 GRGYFLTGAAVFLEQALIQHALHLLYARDYVPLYTPFFMRKEVMQEVA-QLSQFDEELYKVVGKGSE-----KAEEVGID--EKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRVVNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVDYVHMLNATMCAATRVICAILETHQTETG-IKVPEPLKKYM 461          
BLAST of Serine--tRNA ligase vs. Ensembl Fly
Match: SerRS (gene:FBgn0031497 transcript:FBtr0077667)

HSP 1 Score: 164.081 bits (414), Expect = 5.156e-45
Identity = 98/279 (35.13%), Postives = 153/279 (54.84%), Query Frame = 3
Query:  405 SRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFY---ENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
             R Y+L G    LE+ALI++ L +L    +  +  P  + K ++Q+   ++  F  ++Y VV    E     K  E+      + L  TSE  +A Y  +  L + + PIK   +S C+R+EV   G ++  ++RVHQF KVE F  TS   ++S +M+D ++    +    LG+ +R++++ S  L + A KK D+E W  G   Y E+ S SNC DYQAR + + +   +  N  +D+ H LN T CA  R++ +ILETH TE G + VPE L+KYM
Sbjct:  192 GRGYFLTGAAVFLEQALIQHALHLLYARDYVPLYTPFFMRKEVMQEVA-QLSQFDEELYKVVGKGSE-----KAEEVGID--EKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRVVNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVDYVHMLNATMCAATRVICAILETHQTETG-IKVPEPLKKYM 461          
BLAST of Serine--tRNA ligase vs. Ensembl Fly
Match: Slimp (gene:FBgn0051133 transcript:FBtr0084583)

HSP 1 Score: 61.6178 bits (148), Expect = 5.915e-10
Identity = 67/312 (21.47%), Postives = 133/312 (42.63%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLVKTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNG-FQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRR---EVSGLESHLYRVHQFNKVEMFCAT-SQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILE 1160
            +LPNL+    PVG E+  +    +  +ENK + H  +  ++L     N+         YYL    A+ +   ++      + +G F   + PD +   +++ +   +  +       +   + L     QN++NT+       G S  +    ++   +     P++     R Y R   ++ G    LY   Q N V++F AT + +E++  L++I+++ T     L + FRI    + +L      +  IEV+ P  + Y  +   SN  D+ ++ + +F        DF H + G      RL+ +++E
Sbjct:  146 HLPNLLHVQCPVGGEEKLLYRHGIPKSENKTTSH--LARQELVHFVDNN--------RYYLMEQAALFDVNAMQSLARYFVNHGHFIQTANPDFVRCVLLEANATPLSDYH------LVQEEHL-----QNKINTAY---LTGGASFESYLGAMTKLCVYPSVLPLRYVCCGRSYNRAEADLYGPIPSLYTATQTNAVQIFVATQTDNEADSQLEHILNLATDFYKALDIPFRISYATAADLTPAESIRAVIEVYAPSLQRYVCVGRISNYGDFVSKRI-LFSTRREKHYDFLHMVGGPVLYTSRLIAALVE 432          
BLAST of Serine--tRNA ligase vs. Ensembl Zebrafish
Match: sars2 (seryl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-040426-1616])

HSP 1 Score: 246.128 bits (627), Expect = 9.577e-76
Identity = 130/333 (39.04%), Postives = 199/333 (59.76%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLV-KTNENKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCATSQS---ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
             LPN   P+ P+G E  + + ++V +  E  F     + IG+ L  +R   ++  +  R+YYL G  A L+ AL  + +++L K GF  + VPDI+   + +  G +    K+Q+Y++  NP                P+  LAGT E+ +A Y  +  +  ++ P++    S CYR E  +G E+  LYRVH F K+EMF  ++     ES ++LD  V +Q +I + L L +R+LDM ++ELG PA++K+DIE WMPG   +GEISSASNCTDYQ+R ++I YE E+  L +AHT+N T CA+PR + +ILET+ T+ G V VPEVL++Y+
Sbjct:  169 RLPNRTHPSVPIGDESQARVVEVVGEKREFDFKPKGHLQIGESLDIIRQRRLSHVSGHRSYYLRGAGAQLQFALQNFAMDLLQKRGFIPMVVPDILKSVVFEGCGMQPHAQKSQVYSL--NPKR-------------SPDLNLAGTGEVGVAGYFMDHAVNFKDLPVRTVCSSTCYRAETDTGRETWGLYRVHHFTKIEMFGVSANETGEESSQLLDQFVTLQKEIFSSLQLHYRVLDMPTQELGPPAYRKFDIEAWMPGRGSFGEISSASNCTDYQSRRLDIRYEGEDGKLQYAHTVNATACAIPRTIIAILETYQTKKGTVQVPEVLQQYI 486          
BLAST of Serine--tRNA ligase vs. Ensembl Zebrafish
Match: sars1 (seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:445405])

HSP 1 Score: 181.415 bits (459), Expect = 3.467e-51
Identity = 114/361 (31.58%), Postives = 185/361 (51.25%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTN-----ENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN---DDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM----KDICKITRQHP 1250
            E F  +  + NL+ P+ P+  ++D+   K+ +T      + K+S    ++  D  +     + AG  SR Y+L G    LE+ALI Y L IL    + L+  P  + K ++Q+   ++  F  ++Y V+    E +        + +   + L  TSE  +A +L +  LK +  PI+   +S C+R+EV   G ++  ++RVHQF K+E F   S    +S +M D ++         LG+ +RI+++ S  L + A KK D+E W PG + + E+ S SNCTDYQAR + I Y       D  +F H LN T CA  R++ +ILE   TE G ++VPE L+ +M     +I K  +  P
Sbjct:  127 ERFEYLREIGNLLHPSVPISNDEDAD-NKVERTWGDCTVQKKYSHVDLVVMVDGYEGEKGAIVAG--SRGYFLKGPLVFLEQALINYALRILYSKNYNLLYTPFFMRKEVMQEVA-QLSQFDEELYKVIGKGSEKSD-------DNTVDEKYLIATSEQPIAAFLRDEWLKPEELPIRYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYASPHDGKSWEMFDEMIGTAESFYQTLGIPYRIVNIVSGALNHAASKKLDLEAWFPGSQAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKAEFVHMLNATMCATTRVICAILENFQTEEG-IIVPEPLKAFMPPGLTEIIKFVKPAP 475          
BLAST of Serine--tRNA ligase vs. Ensembl Xenopus
Match: ENSXETT00000014465.1 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100485850])

HSP 1 Score: 263.462 bits (672), Expect = 2.339e-82
Identity = 140/336 (41.67%), Postives = 208/336 (61.90%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLVKTNEN---KFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNV--VTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCATSQS---ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
             LPN   P TPVG E  + + ++V        K   H +I G+DL  +R   ++  +  R+YYL G  ++L+ AL+ +T+  L+K GF  +SVPD++   + +  G + D   +Q+Y+V  + +PD          LN       LAGTSE+ +A +  +  +  Q+ P++    S CYR E  +G E+  LYRVH F KVEMF  T+     ES++MLD  + +Q +I + LGL F++L+M ++ELG PA++KYDIE WMPG   YGEISS SNCTDYQ+R +NI Y+ ++ +L  AHT+NGT CAVPRLL +ILE++  ++G V++PEVL+ YM
Sbjct:  160 RLPNRTHPNTPVGDESKARVLEVVGVKPEFDFKICGHLEI-GEDLDIIRQRRLSHVSGHRSYYLRGAGSLLQHALVNFTISKLVKKGFIPMSVPDMLRGAVFEGCGMQADAHASQVYSVDPLQHPD----------LN-------LAGTSEVGIAGFFMDHAVMLQDLPVRTVCCSTCYRAETDTGRETWGLYRVHHFTKVEMFGVTANESGIESQEMLDEFLGLQKEIFSELGLHFKVLEMPTQELGLPAYRKYDIEAWMPGRGKYGEISSTSNCTDYQSRRLNIMYQRQDGELRHAHTVNGTACAVPRLLIAILESNQRKDGAVLIPEVLQPYM 477          
BLAST of Serine--tRNA ligase vs. Ensembl Xenopus
Match: ENSXETT00000030188.1 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100485850])

HSP 1 Score: 263.077 bits (671), Expect = 3.317e-82
Identity = 140/334 (41.92%), Postives = 206/334 (61.68%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLVKTNEN---KFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCAT---SQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
             LPN   P TPVG E  + + ++V        K   H +I G+DL  +R   ++  +  R+YYL G  ++L+ AL+ +T+  L+K GF  +SVPD++   + +  G + D   +Q+Y+V    D L             P+  LAGTSE+ +A +  +  +  Q+ P++    S CYR E  +G E+  LYRVH F KVEMF  T   S  ES++MLD  + +Q +I + LGL F++L+M ++ELG PA++KYDIE WMPG   YGEISS SNCTDYQ+R +NI Y+ ++ +L  AHT+NGT CAVPRLL +ILE++  ++G V++PEVL+ YM
Sbjct:  155 RLPNRTHPNTPVGDESKARVLEVVGVKPEFDFKICGHLEI-GEDLDIIRQRRLSHVSGHRSYYLRGAGSLLQHALVNFTISKLVKKGFIPMSVPDMLRGAVFEGCGMQADAHASQVYSV----DPLQH-----------PDLNLAGTSEVGIAGFFMDHAVMLQDLPVRTVCCSTCYRAETDTGRETWGLYRVHHFTKVEMFGVTANESGIESQEMLDEFLGLQKEIFSELGLHFKVLEMPTQELGLPAYRKYDIEAWMPGRGKYGEISSTSNCTDYQSRRLNIMYQRQDGELRHAHTVNGTACAVPRLLIAILESNQRKDGAVLIPEVLQPYM 472          
BLAST of Serine--tRNA ligase vs. Ensembl Xenopus
Match: ENSXETT00000014474.1 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100485850])

HSP 1 Score: 262.692 bits (670), Expect = 4.649e-82
Identity = 141/336 (41.96%), Postives = 208/336 (61.90%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLVKTNEN---KFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNV--VTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCAT---SQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
             LPN   P TPVG E  + + ++V        K   H +I G+DL  +R   ++  +  R+YYL G  ++L+ AL+ +T+  L+K GF  +SVPD++   + +  G + D   +Q+Y+V  + +PD          LN       LAGTSE+ +A +  +  +  Q+ P++    S CYR E  +G E+  LYRVH F KVEMF  T   S  ES++MLD  + +Q +I + LGL F++L+M ++ELG PA++KYDIE WMPG   YGEISS SNCTDYQ+R +NI Y+ ++ +L  AHT+NGT CAVPRLL +ILE++  ++G V++PEVL+ YM
Sbjct:  163 RLPNRTHPNTPVGDESKARVLEVVGVKPEFDFKICGHLEI-GEDLDIIRQRRLSHVSGHRSYYLRGAGSLLQHALVNFTISKLVKKGFIPMSVPDMLRGAVFEGCGMQADAHASQVYSVDPLQHPD----------LN-------LAGTSEVGIAGFFMDHAVMLQDLPVRTVCCSTCYRAETDTGRETWGLYRVHHFTKVEMFGVTANESGIESQEMLDEFLGLQKEIFSELGLHFKVLEMPTQELGLPAYRKYDIEAWMPGRGKYGEISSTSNCTDYQSRRLNIMYQRQDGELRHAHTVNGTACAVPRLLIAILESNQRKDGAVLIPEVLQPYM 480          
BLAST of Serine--tRNA ligase vs. Ensembl Xenopus
Match: ENSXETT00000030112.1 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100485850])

HSP 1 Score: 255.758 bits (652), Expect = 1.194e-79
Identity = 137/331 (41.39%), Postives = 203/331 (61.33%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLVKTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCAT---SQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
             LPN   P TPVG E  + + ++V            ++   LC+ R++ V+     R+YYL G  ++L+ AL+ +T+  L+K GF  +SVPD++   + +  G + D   +Q+Y+V    D L             P+  LAGTSE+ +A +  +  +  Q+ P++    S CYR E  +G E+  LYRVH F KVEMF  T   S  ES++MLD  + +Q +I + LGL F++L+M ++ELG PA++KYDIE WMPG   YGEISS SNCTDYQ+R +NI Y+ ++ +L  AHT+NGT CAVPRLL +ILE++  ++G V++PEVL+ YM
Sbjct:  154 RLPNRTHPNTPVGDESKARVLEVVGVKP--------VLYFPLCR-RLSHVSG---HRSYYLRGAGSLLQHALVNFTISKLVKKGFIPMSVPDMLRGAVFEGCGMQADAHASQVYSV----DPLQH-----------PDLNLAGTSEVGIAGFFMDHAVMLQDLPVRTVCCSTCYRAETDTGRETWGLYRVHHFTKVEMFGVTANESGIESQEMLDEFLGLQKEIFSELGLHFKVLEMPTQELGLPAYRKYDIEAWMPGRGKYGEISSTSNCTDYQSRRLNIMYQRQDGELRHAHTVNGTACAVPRLLIAILESNQRKDGAVLIPEVLQPYM 457          
BLAST of Serine--tRNA ligase vs. Ensembl Xenopus
Match: ENSXETT00000030183.1 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:100485850])

HSP 1 Score: 249.595 bits (636), Expect = 4.271e-77
Identity = 128/294 (43.54%), Postives = 189/294 (64.29%), Query Frame = 3
Query:  351 IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCAT---SQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            IG+DL  +R   ++  +  R+YYL G  ++L+ AL+ +T+  L+K GF  +SVPD++   + +  G + D   +Q+Y+V    D L             P+  LAGTSE+ +A +  +  +  Q+ P++    S CYR E  +G E+  LYRVH F KVEMF  T   S  ES++MLD  + +Q +I + LGL F++L+M ++ELG PA++KYDIE WMPG   YGEISS SNCTDYQ+R +NI Y+ ++ +L  AHT+NGT CAVPRLL +ILE++  ++G V++PEVL+ YM
Sbjct:  189 IGEDLDIIRQRRLSHVSGHRSYYLRGAGSLLQHALVNFTISKLVKKGFIPMSVPDMLRGAVFEGCGMQADAHASQVYSV----DPLQH-----------PDLNLAGTSEVGIAGFFMDHAVMLQDLPVRTVCCSTCYRAETDTGRETWGLYRVHHFTKVEMFGVTANESGIESQEMLDEFLGLQKEIFSELGLHFKVLEMPTQELGLPAYRKYDIEAWMPGRGKYGEISSTSNCTDYQSRRLNIMYQRQDGELRHAHTVNGTACAVPRLLIAILESNQRKDGAVLIPEVLQPYM 467          
BLAST of Serine--tRNA ligase vs. Ensembl Mouse
Match: Sars2 (seryl-aminoacyl-tRNA synthetase 2 [Source:MGI Symbol;Acc:MGI:1919234])

HSP 1 Score: 249.98 bits (637), Expect = 3.617e-77
Identity = 132/353 (37.39%), Postives = 204/353 (57.79%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNEN-KFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            +++     LPN   P TPVG E  + + ++V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +TL  L+  GF  ++VPD++   + +  G   +   +QIYN+  +P          +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++LD  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   YGE++SASNCTD+Q+R + I +E E  +L FAHT+N T CAVPR+L ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  162 QLYQQALRLPNQTHPDTPVGDESQARVVRVVGEKPAFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLSKLVSRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DPSRF------EDLN-------LAGTAEVGLAGYFMDHSVAFRDLPVRMVCASTCYRAETDTGKEPWGLYRVHHFTKVEMFGVTGPGLEQSSQLLDEFLSLQVEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRYGEVTSASNCTDFQSRRLYIMFETETGELQFAHTVNATACAVPRVLIALLESNQQKDGSVLVPAALQPYLGTDRITAPTHVPLQ 499          
BLAST of Serine--tRNA ligase vs. Ensembl Mouse
Match: Sars (seryl-aminoacyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:102809])

HSP 1 Score: 174.481 bits (441), Expect = 1.282e-48
Identity = 110/345 (31.88%), Postives = 179/345 (51.88%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDS--IITKLVK--TNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN---DDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            E F  +  + NL+ P+ P+  ++D+   + ++    T   K+S    ++  D  +     V AG  SR Y+L G    LE+ALI+Y L  L   G+  I  P  + K ++Q+   ++  F  ++Y V+    E +        + S   + L  TSE  +A    +  L+ ++ PIK   +S C+R+EV   G ++  ++RVHQF K+E F  +S   ++S +M D ++    +    LG+ + I+++ S  L + A KK D+E W PG   + E+ S SNCTDYQAR + I Y       D ++F H LN T CA  R + +ILE +  E G + VPE LR++M
Sbjct:  127 ERFENLREIGNLLHPSVPISNDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAG--SRGYFLKGPLVFLEQALIQYALRTLGSRGYTPIYTPFFMRKEVMQEVA-QLSQFDEELYKVIGKGSEKSD-------DNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFDEMIATAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQAEKG-IAVPEKLREFM 460          
BLAST of Serine--tRNA ligase vs. Ensembl Mouse
Match: Sars (seryl-aminoacyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:102809])

HSP 1 Score: 162.155 bits (409), Expect = 5.746e-44
Identity = 109/369 (29.54%), Postives = 178/369 (48.24%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDS--IITKLVK--TNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN---------------------------DDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            E F  +  + NL+ P+ P+  ++D+   + ++    T   K+S    ++  D  +     V AG  SR Y+L G    LE+ALI+Y L  L   G+  I  P  + K ++Q+   ++  F  ++Y V+    E +        + S   + L  TSE  +A    +  L+ ++ PIK   +S C+R+EV   G ++  ++RVHQF K+E F  +S   ++S +M D ++    +    LG+ + I+++ S  L + A KK D+E W PG   + E+ S SNCTDYQAR + I Y                                 ++F H LN T CA  R + +ILE +  E G + VPE LR++M
Sbjct:  127 ERFENLREIGNLLHPSVPISNDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAG--SRGYFLKGPLVFLEQALIQYALRTLGSRGYTPIYTPFFMRKEVMQEVA-QLSQFDEELYKVIGKGSEKSD-------DNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFDEMIATAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKKKNNLRFSTQNKLKAMSSLFSPKKVEFVHMLNATMCATTRTICAILENYQAEKG-IAVPEKLREFM 484          
BLAST of Serine--tRNA ligase vs. Ensembl Mouse
Match: Sars (seryl-aminoacyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:102809])

HSP 1 Score: 112.849 bits (281), Expect = 2.368e-27
Identity = 66/211 (31.28%), Postives = 110/211 (52.13%), Query Frame = 3
Query:  426 GHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTD 1043
            G    LE+ALI+Y L  L   G+  I  P  + K ++Q+   ++  F  ++Y V+    E +        + S   + L  TSE  +A    +  L+ ++ PIK   +S C+R+EV   G ++  ++RVHQF K+E F  +S   ++S +M D ++    +    LG+ + I+++ S  L + A KK D+E W PG   + E+ S SNCTD
Sbjct:  150 GPLVFLEQALIQYALRTLGSRGYTPIYTPFFMRKEVMQEVA-QLSQFDEELYKVIGKGSEKSD-------DNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFDEMIATAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTD 352          
BLAST of Serine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q9JJL8|SYSM_MOUSE (Serine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Sars2 PE=1 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 2.530e-76
Identity = 132/353 (37.39%), Postives = 204/353 (57.79%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNEN-KFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            +++     LPN   P TPVG E  + + ++V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +TL  L+  GF  ++VPD++   + +  G   +   +QIYN+  +P          +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++LD  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   YGE++SASNCTD+Q+R + I +E E  +L FAHT+N T CAVPR+L ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  162 QLYQQALRLPNQTHPDTPVGDESQARVVRVVGEKPAFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLSKLVSRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DPSRF------EDLN-------LAGTAEVGLAGYFMDHSVAFRDLPVRMVCASTCYRAETDTGKEPWGLYRVHHFTKVEMFGVTGPGLEQSSQLLDEFLSLQVEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRYGEVTSASNCTDFQSRRLYIMFETETGELQFAHTVNATACAVPRVLIALLESNQQKDGSVLVPAALQPYLGTDRITAPTHVPLQ 499          
BLAST of Serine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q9N0F3|SYSM_BOVIN (Serine--tRNA ligase, mitochondrial OS=Bos taurus OX=9913 GN=SARS2 PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.115e-73
Identity = 136/350 (38.86%), Postives = 207/350 (59.14%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLVKTNENKFS----KHAQIIGK-DLC-QLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
             LPN   P  PVG E  + +  +V  ++  FS     H +I  K D+  Q R++ V+     R+YYL G  A+L+  L+ +TL  L+  GF  ++VPD++   + +  G   +   +QIYN+  +P          +LN       LAGT+E+ LA Y  +  +  ++ PI++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++L+  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   +GE++SASNCTD+Q+R ++I ++ E  +L FAHT+N TGCAVPRLL ++LE++  ++G V+VP  L+ Y+      T  H PL+
Sbjct:  169 RLPNQTHPDVPVGDESQARVLHVVG-DKPAFSFQPRGHLEIAEKLDIIRQKRLSHVSG---HRSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNI--DPSRF------EDLN-------LAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDTGKEPWGLYRVHHFTKVEMFGVTGPGLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKDGSVLVPPALQPYLGTDRITTPTHVPLQ 499          
BLAST of Serine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q9NP81|SYSM_HUMAN (Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.928e-73
Identity = 130/345 (37.68%), Postives = 203/345 (58.84%), Query Frame = 3
Query:  243 LPNLVSPTTPVGKEKDSIITKLVKTNE-NKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLESH-LYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
            LPN   P  PVG E  + +  +V       F     + IG+ L  +R   ++  +  R+YYL G  A+L+  L+ +T   L++ GF  ++VPD++   + +  G   +   +QIYN+  +P    + FK  +LN       LAGT+E+ LA Y  +  +  ++ P+++   S CYR E  +G E   LYRVH F KVEMF  T     +S ++L+  + +Q +I+  LGL FR+LDM ++ELG PA++K+DIE WMPG   +GE++SASNCTD+Q+R ++I ++ E  +L FAHT+N T CAVPRLL ++LE++  ++G V+VP  L+ Y+         H PL+
Sbjct:  170 LPNQTHPDVPVGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNI--DP----ARFK--DLN-------LAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQ 499          
BLAST of Serine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q8RWT8|SYSM_ARATH (Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA7 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.800e-68
Identity = 129/363 (35.54%), Postives = 192/363 (52.89%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENKFS----KHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGLESH---LYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDD-------------LDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQH 1247
            E+  +  ++PN+  P  PVG E  S I + V +   +FS     H Q+ GKDL  +  +     + S+ +YL     +LE AL+ +TL  +MK G+  ++ P+I+  +IV+K GF+      Q+Y++                     ++CL GT+E+ +     +S+L +   P+K  A S C+R E     +    LYRVHQF+K EMF      +SE     ++ I+  +   LGL F+ LDMA+ +LG PA++K+DIE WMPG   +GEISSASNCTDYQ+R + I Y                     F HTLN T CAVPR++  +LE +  E+G VV+PE LR +M  I  I  +H
Sbjct:  171 ELQHVAQSIPNMTHPDVPVGGEDSSAIRQEVGS-PREFSFPIKDHLQL-GKDLDLIDFDSAAEVSGSKFFYLKNEAVLLEMALLNWTLSQVMKKGYTPLTTPEIVRSSIVEKCGFQPRGDNTQVYSI------------------DGTDQCLIGTAEIPVGGIHMDSILLESALPLKYIAFSHCFRTEAGAAGAATKGLYRVHQFSKAEMFVICQPEDSESFHQELIQIEEDLFTSLGLHFKTLDMATADLGAPAYRKFDIEAWMPGLGRFGEISSASNCTDYQSRRLGIRYRPSEPPQTGPKKGKANLPATKFVHTLNATACAVPRMMVCLLENYQQEDGSVVIPEPLRPFMGGIELIKPKH 513          
BLAST of Serine--tRNA ligase vs. UniProt/SwissProt
Match: sp|B8E0R9|SYS_DICTD (Serine--tRNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) OX=515635 GN=serS PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.274e-62
Identity = 125/360 (34.72%), Postives = 192/360 (53.33%), Query Frame = 3
Query:  165 EINDLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGK-EKDSI-ITKLVKTNENKFSKHAQIIGKDLCQLR-INDVNAGAE---SRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGLESH---LYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            +I +L +   NV      E+FS +  LPN +SP  P GK EKD++ I K  +     F+    +   DL  L  + D   G++   S  YYL     +LE AL R  ++ L+  GF+L   PD+    I+   GF+    + QIY V     E T +              L  T+E+ L  Y  + +L + + P+K    S C+R E      +   LYRVHQF+K E+F      +SE+M +YI+ ++ KI   L + +R+LD+ S +LG PA +K+DIE WMPG   +GE++S SNCTDYQAR +NI +     ++++ H LNGT  A+ R L +I E +  E+G +++P+ L+ Y+
Sbjct:   82 KIEELAKEYDNVEK----ELFSRLWQLPNFLSPKAPRGKDEKDNVEIKKWGEIKTFNFTPKDHL---DLALLNDLVDFERGSKVTGSNFYYLKNEAVLLEFALFRLVIDTLLPEGFKLFITPDLARMEIIDGIGFQPRGPEAQIYRV-----EDTDL-------------GLIATAEITLGGYHKDEILDELDLPLKYLGFSHCFRTEAGAYGRYNRGLYRVHQFSKAEIFIICRPEDSEEMHEYILGLEEKIFQKLEIPYRVLDICSGDLGAPAARKFDIEAWMPGRGEFGEVTSCSNCTDYQARRLNIRFRRVTGEVEYVHMLNGTAIAISRALIAIFENYQQEDGSILIPKALQPYI 416          
BLAST of Serine--tRNA ligase vs. TrEMBL
Match: K7IPG9 (AA_TRNA_LIGASE_II domain-containing protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 9.654e-88
Identity = 160/379 (42.22%), Postives = 235/379 (62.01%), Query Frame = 3
Query:  135 QSLVVRNENVEINDLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENKFS----KHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNP---DELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGL--ESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQ 1244
            ++++ R  +  I+ + EL Q++H+    E    ++ +PNL  P      + +  I + V+ ++ K+S    + +Q+  K L  LR + +     SR+Y L G  A LE+ALI YTL+ L+K+ F+L+SVPDI+   ++++ G   D  +  +Y  V  P   D+L+                L+GT+EMALA  LSN+VL +   P+KL AVSRCYR EVS L  E  +YRVHQF KVEMF  + Q+ES +++D +V IQ K+   LGL +++LDM   ELG+PA++K DIE WMPG K +GE+SS SNCTDYQAR +NI Y+++N+ +  +HTLNGT CAVPR+L +I ETH  E+G++ VPE L  YM     I +Q
Sbjct:   70 KNILKRKNSGNIDKVLELHQSLHSQE--EFIKELSKIPNLTDPNVLEYADNEPCILR-VQGDQPKYSFEPHEFSQLAAK-LRLLRTDRLGPVTGSRSYILLGDLAELEQALITYTLKELLKHNFKLVSVPDILPSQVIERCGLISDGERKLVY--VVEPYYGDDLS----------------LSGTAEMALAYKLSNTVLHENELPLKLAAVSRCYRAEVSNLLEERGIYRVHQFTKVEMFICSKQNESVQIMDEVVAIQEKLFGQLGLHYKVLDMPPNELGSPAYRKIDIEAWMPGRKQFGELSSCSNCTDYQARRLNIKYQDKNEQIMHSHTLNGTACAVPRMLIAICETHQLEDGNIAVPEQLVPYMNGKTVIKKQ 426          
BLAST of Serine--tRNA ligase vs. TrEMBL
Match: A0A232FNS9 (AA_TRNA_LIGASE_II domain-containing protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_004325 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 7.584e-86
Identity = 161/373 (43.16%), Postives = 228/373 (61.13%), Query Frame = 3
Query:  150 RNENVEINDLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITK----LVKTNENKFSKH--AQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGL--ESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQ 1244
            R  +  I+ + EL Q++H+ +  E    ++ +PNL  P      +    I +    L K N   F  H  +Q+  K L  LR + +     SR+Y L G  A LE+ALI YTL+ L+K+ F+LISVPDI+   ++++ G   D  +  +Y V          +  ++L+       L+GT+EMALA  LSN+VL +   P+KL AVSRCYR EVS L  E  +YRVHQF KVEMF  + Q+ES +++D +V IQ K+   LGL +++LDM   ELG+PA++K DIE WMPG K +GE+SS SNCTDYQAR +NI Y+++N+ +  +HTLNGT CAVPR+L +I ETH  E+G++ VPE L  YM     I +Q
Sbjct:   63 RKNSGNIDKVLELHQSLHSQD--EFTKELSKIPNLTDPNVLEYADDVPCILRVQGDLPKYN---FEPHEFSQLAAK-LRLLRTDRLGPVTGSRSYILLGDLAELEQALINYTLKELLKHNFKLISVPDILPSQVIERCGLISDGERRLVYQV--------EPYYGDDLS-------LSGTAEMALAYKLSNTVLHENELPLKLTAVSRCYRAEVSNLLEERGIYRVHQFTKVEMFICSKQNESVQIMDEVVAIQEKLFGQLGLHYKVLDMPPNELGSPAYRKIDIEAWMPGRKQFGELSSCSNCTDYQARRLNIKYQDKNEQIMHSHTLNGTACAVPRMLIAICETHQLEDGNIAVPEQLVPYMNGKTVIKKQ 414          
BLAST of Serine--tRNA ligase vs. TrEMBL
Match: V4AA45 (AA_TRNA_LIGASE_II domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_217090 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 5.640e-85
Identity = 149/356 (41.85%), Postives = 221/356 (62.08%), Query Frame = 3
Query:  213 YYEIFSMINNLPNLVSPTTPVGKEKDSIITKLV--KTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGL--ESHLYRVHQFNKVEMFCATSQ---SESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKIT---RQHP 1250
            + ++    +++PN   P +P+G+E++S + + V   T  N   +    IG+ L  LR ++VN     R YY       LE ALI++TL  L ++GF +ISVPD+I   +++  GFK    +NQ+Y +  N       F Q+         CLAGT+EM+LA ++S+  L  +N P KL AVSRC+RRE S    E  +YRVHQF K+EMF  T     +ESE++L + +DI+  + + LGL FRIL+M++E LG PA++KYD+E WMPG   +GEISSASNCTDYQ+R + I Y + N +   AHT+NGT CA+PR++ +ILE   T++ +V +PEVL+ YM +  ++T    +HP
Sbjct:  113 WKDLIKEASDIPNTHHPDSPIGEEENSRLVETVGEPTRFNFKPRTVVRIGEKLDILRTDNVNFSTGIRTYYFKDELVDLEMALIKFTLNTLKQHGFHVISVPDLIYAPVIEACGFKTTG-ENQVYKLNDN-------FYQDV--------CLAGTAEMSLAGFMSDEKLTTENLPTKLTAVSRCFRREASDAKEEQGIYRVHQFTKIEMFGVTENDKGTESEELLQHFLDIEKSLFSQLGLHFRILEMSTECLGAPAYRKYDMETWMPGKHFWGEISSASNCTDYQSRRLGIKYTDINGNYRHAHTVNGTACAIPRMIMAILEQFQTKDWNVNIPEVLQPYMNNKTQLTGPQNKHP 452          
BLAST of Serine--tRNA ligase vs. TrEMBL
Match: A0A482W639 (Serine--tRNA ligase, mitochondrial OS=Asbolus verrucosus OX=1661398 GN=BDFB_001276 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.113e-84
Identity = 155/376 (41.22%), Postives = 219/376 (58.24%), Query Frame = 3
Query:  168 INDLCELLQNVHNGNYY------EIFSMINNLPNLVSPTTPVGKEKDSIITKL-VKTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGL--ESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQH--PPLKV 1262
            ++DL   LQN+H  +        E++S +  +PN   P          I+ ++  K + +   K  Q I K L  LR + +   + +++YYL G  A LE ALIRY +  L+K+ F LISVPDI++++I++  G      + Q+Y +              +  +  P+ CL+GTSEMALA +L+N  L  Q  P+KL AVSRCYR E S L  E  +YRVH+F+KVEMF A+   ESE++L+ I  IQ      LGL F++LDM   ELG  A++KYDIE W+ G +IYGEISS SNC DYQ+R +NI +E + D   F HTLNGT CA+PRLL +++E     NG + +PEVL  +M     I +Q   P LK+
Sbjct:   65 VHDLKNKLQNIHPSDKLYESIRSELYSEMLKIPNKTHPAVAGYGNNPKIVKEIGQKKHHDVPPKEFQEIAKRLKLLRTDQLGNLSGNKSYYLLGEMAELEHALIRYVVSSLIKHKFDLISVPDILHRDIIEGCGMNTQGSRTQVYTL--------------DPQSHGPDLCLSGTSEMALAGFLANKTLTSQELPLKLAAVSRCYRAETSNLLEERGIYRVHEFSKVEMFVASLPEESEQILEEIRQIQEDCFQSLGLHFQVLDMPPHELGAQAYRKYDIEAWLTGRQIYGEISSCSNCLDYQSRRLNIKFETK-DGCGFVHTLNGTACAIPRLLIALMEEGQNRNGTITLPEVLHPFMGGKGVIAKQKSIPELKL 425          
BLAST of Serine--tRNA ligase vs. TrEMBL
Match: G4V5K7 (Seryl-tRNA synthetase OS=Schistosoma mansoni OX=6183 GN=Smp_057230 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 2.191e-84
Identity = 147/401 (36.66%), Postives = 224/401 (55.86%), Query Frame = 3
Query:  135 QSLVVRNENVEINDLCELLQNV----HNGNYYEIFSMINNLPNLVSPTTPVGKEKDS------------------IITKLVKTNENKFSKH---AQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVL------------KKQNFPIKLCAVSRCYRREVSGLESHLYRVHQFNKVEMFCATSQS--ESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMK 1220
            ++L  R  N+ ++ + +L +N     H   + E+ S++  LPN   P TP+G    +                  +I     +++   + H   + I       LR+     GA  + YY +G  A LE ALI YT++ L   GF+ +SVPDI+ + +++  GF     ++QIY +     +LT               CL+GTSEMALA + +                  Q+  + LCAVSRC+R+E    E  LYRVHQF KVEMF  T+ S   S+ M + I+ +Q  + A LGL FR+L+M SEELG+ A++K DIE WMPGD+IYGEISS+S C DYQ++ +NI ++  ++  +FA+TLNGT CA+PR++K+++ETH T++ H+++P+VL  YMK
Sbjct:   61 ENLTARKSNLNLDHMLDLYRNYTKTKHTETHDELMSLVCQLPNFTHPLTPIGDSSKARHIYIHGSKREERWKLLDVINITSGSHQPVINHHNTDSSITINSEGYLRVKYTTLGAGHKTYYFSGPLAQLESALIAYTMDRLRGTGFEFVSVPDILPEPVIRACGFPTQGIRSQIYKITPPVSKLTY--------------CLSGTSEMALAGFCAGRSFNCTSSKNDEPDESNQSSALGLCAVSRCFRKEAPNQEPTLYRVHQFTKVEMFAITTPSLPVSDAMFNQIIKLQICLFADLGLHFRVLEMPSEELGDSAYRKVDIEAWMPGDQIYGEISSSSICLDYQSKRLNIRWQTSSNQNEFAYTLNGTACAIPRIMKALIETHQTQDKHIIIPDVLIPYMK 447          
BLAST of Serine--tRNA ligase vs. Ensembl Cavefish
Match: sars2 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103029444])

HSP 1 Score: 249.98 bits (637), Expect = 3.758e-77
Identity = 135/347 (38.90%), Postives = 202/347 (58.21%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLV-KTNENKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCAT---SQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLK 1259
             LPN   P TP+G E  + + ++V +  E  F     + +G+ L  +R   ++  +  R+YYL G  A L+ AL  + L++L K GF  + VPD++   + +  G +     +Q+Y++  +P                P+  LAGT E+ +A Y  +  +  ++ P++    S CYR E  +G E+  LYRVH FNKVEMF      +  ES ++LD  V +Q +I + L L +R+LDM +EELG PA++KYDIE WMPG   +GEISSASNCTD+Q+R +NI YE  +  L +AHT+N T CA+PR + +ILETH T+ G V VPEVL++Y+        ++ PLK
Sbjct:  170 RLPNRTHPDTPIGDESQARVVEMVGQKAEFDFKPKGHLELGEQLDIIRQRRLSHVSGHRSYYLRGAGARLQTALQNFALDLLQKRGFIPMVVPDMLKGVVFEGCGMQPHAHHSQVYSL--DPAHF-------------PDLNLAGTGEVGIAGYFMDHAVNIKDMPVRTVCSSTCYRAETDTGRETWGLYRVHHFNKVEMFGVVENETGEESSQLLDEFVSLQKEIFSSLQLHYRVLDMPTEELGPPAYRKYDIEAWMPGRSSFGEISSASNCTDFQSRRLNILYEGNDGSLKYAHTVNATACAIPRTIIAILETHQTKEGVVRVPEVLQRYLGTDLIEKPKYTPLK 501          
BLAST of Serine--tRNA ligase vs. Ensembl Cavefish
Match: sars1 (seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:103045372])

HSP 1 Score: 182.956 bits (463), Expect = 5.928e-52
Identity = 115/361 (31.86%), Postives = 189/361 (52.35%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLVKT-----NENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN---DDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM----KDICKITRQHP 1250
            E F     + NL+ P+ P+  ++D+   K+ +T      + K+S    ++  D  +     + AG  SR Y+L G    LE+ALI Y L IL +  + ++  P  + K ++Q+   ++  F  ++Y V+    E +        + S   + L  TSE  +A +L +  LK ++ PI+   +S C+R+EV   G ++  ++RVHQF K+E F  +S   ++S +M D ++    +    LG+ +RI+++ S  L + A KK D+E W PG + + E+ S SNCTDYQAR + I Y       D  +F H LN T CA  R++ +ILE   T+ G VV+PE LR +M     +I K  +  P
Sbjct:  127 ERFEYQREIGNLLHPSVPISNDEDAD-NKVERTWGDCTAQKKYSHVDLVVMVDGYEGEKGAIVAG--SRGYFLKGPLVFLEQALINYALRILYRKNYNVLYTPFFMRKEVMQEVA-QLSQFDEELYKVIGKGSEKSD-------DNSVDEKYLIATSEQPIAAFLRDEWLKPEDLPIRYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFDEMIGTAEEFYQTLGIPYRIVNIVSGALNHAASKKLDLEAWFPGSQAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKAEFVHMLNATMCATTRVICAILENFQTDEG-VVIPEPLRDFMPPGLTEIIKFVKPAP 475          
BLAST of Serine--tRNA ligase vs. Ensembl Cavefish
Match: sars1 (seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:103045372])

HSP 1 Score: 183.341 bits (464), Expect = 6.111e-52
Identity = 115/361 (31.86%), Postives = 189/361 (52.35%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLVKT-----NENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN---DDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM----KDICKITRQHP 1250
            E F     + NL+ P+ P+  ++D+   K+ +T      + K+S    ++  D  +     + AG  SR Y+L G    LE+ALI Y L IL +  + ++  P  + K ++Q+   ++  F  ++Y V+    E +        + S   + L  TSE  +A +L +  LK ++ PI+   +S C+R+EV   G ++  ++RVHQF K+E F  +S   ++S +M D ++    +    LG+ +RI+++ S  L + A KK D+E W PG + + E+ S SNCTDYQAR + I Y       D  +F H LN T CA  R++ +ILE   T+ G VV+PE LR +M     +I K  +  P
Sbjct:  127 ERFEYQREIGNLLHPSVPISNDEDAD-NKVERTWGDCTAQKKYSHVDLVVMVDGYEGEKGAIVAG--SRGYFLKGPLVFLEQALINYALRILYRKNYNVLYTPFFMRKEVMQEVA-QLSQFDEELYKVIGKGSEKSD-------DNSVDEKYLIATSEQPIAAFLRDEWLKPEDLPIRYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFDEMIGTAEEFYQTLGIPYRIVNIVSGALNHAASKKLDLEAWFPGSQAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKAEFVHMLNATMCATTRVICAILENFQTDEG-VVIPEPLRDFMPPGLTEIIKFVKPAP 475          
BLAST of Serine--tRNA ligase vs. Ensembl Sea Lamprey
Match: sars2 (seryl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-040426-1616])

HSP 1 Score: 239.965 bits (611), Expect = 4.030e-74
Identity = 136/334 (40.72%), Postives = 202/334 (60.48%), Query Frame = 3
Query:  240 NLPNLVSPTTPVGKEKDSIITKLV-KTNENKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMF---CATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMK 1220
             LPN   P+ PVG E  + + + V +  E  F     + IG+ L  +R   ++  +  R+YYL G  A LE AL  + L+ L + GF  +SVPD++   + +  G       +Q+Y++  +P       K  +LN       LAGTSE+ +A Y  +  ++ ++ P+++   S CYR E  +G E+  LYRVH F KVEMF    A S +ES  +LD  + IQ +I + LGL +++LDM +EELG PA++KYDIE WMPG + +GEISS SNCTDYQ+R ++I Y + + +L +AHT+NGT CAVPRLL +ILET+  ++G V VP VL+  ++
Sbjct:  180 QLPNRTHPSVPVGDESQARVLETVGQKPEFDFKPRVHLDIGEKLDIIRQKHLSHVSGHRSYYLRGAGAELEHALAHFALKKLKRRGFVALSVPDMLKGVVFEGCGMCPSAKTSQLYSL--DP------AKFKDLN-------LAGTSEVGIAGYFMDHAVELKDLPLRIVCCSTCYRAETETGKETWGLYRVHHFTKVEMFGVTAAESGNESNDLLDEFLSIQKEIYSDLGLHYKVLDMPTEELGLPAYRKYDIEAWMPGREKFGEISSTSNCTDYQSRRLHIKYFDSSRNLKYAHTVNGTACAVPRLLIAILETYQMKDGRVRVPPVLQPLLE 498          
BLAST of Serine--tRNA ligase vs. Ensembl Sea Lamprey
Match: sars1 (seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:445405])

HSP 1 Score: 176.792 bits (447), Expect = 1.154e-50
Identity = 112/341 (32.84%), Postives = 180/341 (52.79%), Query Frame = 3
Query:  234 INNLPNLVSPTTPVGKEKDSIITKLVKTNEN-----KFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN---DDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            +  + N++ P+ PV  ++D+   K+ +T  +     ++S    ++  D  +     + +G  SRAY+L G    LE+ALI+  L+ L   G+  +  P  + K ++Q+   ++  F  ++Y VV    E          ++S   + L  TSE  +A +  +  LK +  PI+   +S C+R+EV   G ++  ++RVHQF K+E F  TS   ++S +M D +V         LG+ +RI+++ S  L + A KK D+E W PG   + E+ S SNCTDYQAR + + Y       D  +F H LN T CA  R + +ILET+ TE G VVVPE LR +M
Sbjct:   91 LREVGNILHPSVPVSNDEDAD-NKVERTWGDVTVRKRYSHVDLVVMVDGYEGEKAAIVSG--SRAYFLKGPLVFLEQALIQLALQRLYSQGYTPLYPPFFMRKEVMQEVA-QLSQFDEELYKVVGKGSEHAD-------DSSVDEKYLIATSEQPIAAFHRDEWLKPEQLPIRYAGLSSCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYTSPHDNKSWEMFDEMVKTAEGFYQELGIPYRIVNIVSGALNHAAAKKLDLEAWFPGSAAFRELVSCSNCTDYQARRLRVRYGQTKKMMDKAEFVHMLNATMCATTRTICAILETYQTETG-VVVPEALRPFM 419          
BLAST of Serine--tRNA ligase vs. Ensembl Yeast
Match: DIA4 (Probable mitochondrial seryl-tRNA synthetase; mutant displays increased invasive and pseudohyphal growth [Source:SGD;Acc:S000001053])

HSP 1 Score: 199.519 bits (506), Expect = 1.308e-59
Identity = 124/342 (36.26%), Postives = 182/342 (53.22%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEK-DSIITKLVKTNENKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPI--KLCAVSRCYRREVSGL---ESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN-DDLDFAHTLNGTGCAVPRLLKSILET-HHTENGHVVVPEVLRKYM 1217
            +I     +LPN + PT P+   + +  I  L     ++   H  I + K++  L+      G     YYL    A LE+AL+ Y L+   +NGF     P I  K ++   GF              NP ++ +  +   L  +  N  L  T+E+ LA   +N VL+  +     KL  VSRCYR E          LYRVH+F KVE+FC +    S K+L+ I   Q  ++  LG+  ++L+M S +LGNPAFKKYDIE WMPG   +GEISSASNCTD+Q+R +N  Y ++N   L++ HTLNGT  A+PR++ +++E  +    G + VPE LR++M
Sbjct:  117 KILETCKSLPNTLDPTVPLDAPQIEQWINPLKTHKTSEAQAHVDIMLKKNMLDLQTASNVTGMS--WYYLLNDGARLEQALVAYALKKANENGFSSCVPPSITKKELIDACGF--------------NPRDMNNERQIYALQDT--NLGLVATAEIPLAGLGANKVLELNSGECSKKLVGVSRCYRAEAGARGKDTKGLYRVHEFTKVELFCWSKPETSAKVLEEIKQFQISVVEELGIPAKVLNMPSNDLGNPAFKKYDIEAWMPGRGKFGEISSASNCTDFQSRRLNTKYRDDNTGKLEYVHTLNGTAMAIPRVIVALVENFYDPSTGKISVPECLREFM 440          
BLAST of Serine--tRNA ligase vs. Ensembl Yeast
Match: SES1 (Cytosolic seryl-tRNA synthetase; class II aminoacyl-tRNA synthetase that aminoacylates tRNA(Ser), displays tRNA-dependent amino acid recognition which enhances discrimination of the serine substrate, interacts with peroxin Pex21p [Source:SGD;Acc:S000002430])

HSP 1 Score: 153.295 bits (386), Expect = 3.573e-42
Identity = 95/281 (33.81%), Postives = 141/281 (50.18%), Query Frame = 3
Query:  408 RAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKK--QNFPIKLCAVSRCYRREVSGLESH------LYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNI---FYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            R Y+   +   L +ALI Y L+ L   G+  +  P ++NK ++ K+  ++  F  ++Y V+   DE                + L  TSE  ++ Y S    +K  +  PI     S C+RRE     SH      ++RVH F K+E F  T   +S +  + ++    +    L L +RI+ + S EL N A KKYD+E W P  K Y E+ S SNCTDYQ+R + I     +  + +  + H LN T  A  R L  ILE + TE+G +VVPEVLRKY+
Sbjct:  176 RGYFFRNYGVFLNQALINYGLQFLAAKGYIPLQAPVMMNKELMSKTA-QLSEFDEELYKVIDGEDE----------------KYLIATSEQPISAYHSGEWFEKPQEQLPIHYVGYSSCFRREAG---SHGKDAWGVFRVHAFEKIEQFVITEPEKSWEEFEKMISYSEEFYKSLKLPYRIVGIVSGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVHCLNSTLAATQRALCCILENYQTEDG-LVVPEVLRKYI 435          
BLAST of Serine--tRNA ligase vs. Ensembl Nematostella
Match: EDO47000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN37])

HSP 1 Score: 152.14 bits (383), Expect = 4.672e-41
Identity = 94/290 (32.41%), Postives = 147/290 (50.69%), Query Frame = 3
Query:  384 DVNAG---AESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVV-TNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMF--CATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEND---DLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            D++ G   A SR Y+L G    LE ALI++   +L   GF  +S P  + K ++Q+   ++  F  ++Y VV    DE                + L  TSE  +A +     + K + P K    S C+R+E    G ++  ++RVHQF K+E F  C+   + S ++ D ++    +    LG+ +RI+ + S  L N A KK D+E W P    + E+ S SNCTDYQAR + + +          ++ H LN T CAV R++ +ILE + TE G VV+P+ L  Y+
Sbjct:  181 DIDRGSVVAGSRGYFLKGPLVFLEHALIQHATRMLYGKGFIPLSTPFFMRKEVMQEVA-QLSQFDEELYKVVGKGADE-----------AGYEEKYLIATSEQPIAAFHRGEWMDKNDLPKKYAGFSTCFRQEAGAHGRDTRGIFRVHQFEKIEQFVICSPHDNISWEIFDEMIGNAEEFHKSLGIPYRIVSIVSGALNNAAAKKLDLEAWFPASGAFRELVSCSNCTDYQARRLQVRFGQTKKMGVSTEYVHMLNATMCAVSRVICAILENNQTEEG-VVMPQALHPYL 457          
BLAST of Serine--tRNA ligase vs. Ensembl Medaka
Match: sars2 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101156184])

HSP 1 Score: 248.825 bits (634), Expect = 6.904e-78
Identity = 131/341 (38.42%), Postives = 197/341 (57.77%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLV-KTNENKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSC-PNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCATSQ---SESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            E +S    LPN   P  PVG E  + + +LV +  E  F     + +G+ L  +R   ++  +  R+YYL G  A L+ AL  + L+ L + GF  + VPD++   + +  G + +  ++Q+Y+                L+ +C P+  LAGT E+ +A +  +  +  ++ P++    S CYR E  +G E+  LYRVH FNKVEMF  T+     ES ++L   V +Q +I + L L FR+LDM ++ELG PA +K+D+E WMPG   YGEISS SNCTDYQ+R +NI YE E+  L +AHT+N T CA+PR + +ILETH T+ G V +P  L+ Y+
Sbjct:   63 EHYSRALRLPNSTHPDVPVGDESQARVMELVGQKPEFDFQPRGHVELGETLGLIRQRHLSHVSGHRSYYLRGAGARLQTALQNFALDTLQRRGFIPMVVPDMLKGAVFEGCGMQPNAHRSQVYS----------------LDPTCFPDLNLAGTGEVGVAGFFMDHAVNWKDLPVRTVCSSTCYRAETDTGRETWGLYRVHHFNKVEMFGVTADETGQESAELLQEFVSLQKEIFSALELHFRVLDMPTQELGPPAHRKFDVEAWMPGRNAYGEISSGSNCTDYQSRRLNILYEAEDGSLQYAHTVNATACAIPRTIIAILETHQTKEGTVRIPRALQPYL 387          
BLAST of Serine--tRNA ligase vs. Ensembl Medaka
Match: sars2 (seryl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101156184])

HSP 1 Score: 248.054 bits (632), Expect = 1.757e-76
Identity = 131/341 (38.42%), Postives = 197/341 (57.77%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLV-KTNENKFSKHAQI-IGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSC-PNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREV-SGLES-HLYRVHQFNKVEMFCATSQ---SESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            E +S    LPN   P  PVG E  + + +LV +  E  F     + +G+ L  +R   ++  +  R+YYL G  A L+ AL  + L+ L + GF  + VPD++   + +  G + +  ++Q+Y+                L+ +C P+  LAGT E+ +A +  +  +  ++ P++    S CYR E  +G E+  LYRVH FNKVEMF  T+     ES ++L   V +Q +I + L L FR+LDM ++ELG PA +K+D+E WMPG   YGEISS SNCTDYQ+R +NI YE E+  L +AHT+N T CA+PR + +ILETH T+ G V +P  L+ Y+
Sbjct:  165 EHYSRALRLPNSTHPDVPVGDESQARVMELVGQKPEFDFQPRGHVELGETLGLIRQRHLSHVSGHRSYYLRGAGARLQTALQNFALDTLQRRGFIPMVVPDMLKGAVFEGCGMQPNAHRSQVYS----------------LDPTCFPDLNLAGTGEVGVAGFFMDHAVNWKDLPVRTVCSSTCYRAETDTGRETWGLYRVHHFNKVEMFGVTADETGQESAELLQEFVSLQKEIFSALELHFRVLDMPTQELGPPAHRKFDVEAWMPGRNAYGEISSGSNCTDYQSRRLNILYEAEDGSLQYAHTVNATACAIPRTIIAILETHQTKEGTVRIPRALQPYL 489          
BLAST of Serine--tRNA ligase vs. Ensembl Medaka
Match: sars1 (seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:101169940])

HSP 1 Score: 184.111 bits (466), Expect = 2.417e-52
Identity = 117/361 (32.41%), Postives = 185/361 (51.25%), Query Frame = 3
Query:  219 EIFSMINNLPNLVSPTTPVGKEKDSIITKLVKT-----NENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENEN---DDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM----KDICKITRQHP 1250
            E F  +  + NL+ P+ P+  ++D+   K+ +T      + K+S    ++  D        V AG  SR Y+L G    LE+ALI Y L IL    + ++  P  + K ++Q+   ++  F  ++Y V+    E +        ++S   + L  TSE  +A +L    LK ++ PI+    S C+R+EV   G ++  ++RVHQF K+E F   S    +S +M D ++    +    LG+ +RI+++ S  L + A KK D+E W PG   + E+ S SNCTDYQAR + I Y       D  +F H LN T CA  R++ +ILE + TE G +VVPE LR +M     +I K  +  P
Sbjct:  127 ERFEYLREIGNLLHPSVPISNDEDAD-NKVERTWGDCSAQKKYSHVDLVVMIDGYDGERGAVVAG--SRGYFLKGPLVFLEQALINYALRILHSKKYTMLYTPFFMRKEVMQEVA-QLSQFDEELYKVIGKGSERSD-------DSSLDEKYLIATSEQPIAAFLREEWLKPEDLPIRYAGFSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYASPHDGKSWEMFDEMIGTAEEFYQTLGIPYRIVNIVSGALNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKTEFVHMLNATMCATTRVMCAILENYQTEEG-IVVPEKLRDFMPPGLTEIIKFVKPAP 475          
BLAST of Serine--tRNA ligase vs. Planmine SMEST
Match: SMESG000015237.1 (SMESG000015237.1)

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 412/413 (99.76%), Postives = 412/413 (99.76%), Query Frame = 3
Query:   30 MIRNITRCLHNATFKEKYXXXXXXXXXXXXXXXXXQSLVVRNENVEINDLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGLESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLKVNW 1268
            MIRNITRCLHNATFKEKYNNLIINNLKKIKIDDIKQSLVVRNENVEI DLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGLESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLKVNW
Sbjct:    1 MIRNITRCLHNATFKEKYNNLIINNLKKIKIDDIKQSLVVRNENVEIKDLCELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENKFSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSGLESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDICKITRQHPPLKVNW 413          
BLAST of Serine--tRNA ligase vs. Planmine SMEST
Match: SMESG000016105.1 (SMESG000016105.1)

HSP 1 Score: 160.614 bits (405), Expect = 4.317e-44
Identity = 110/339 (32.45%), Postives = 174/339 (51.33%), Query Frame = 3
Query:  234 INNLPNLVSPTTPVGKEKD--SIITKLVKTNENKFSKHAQIIGK-DLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEILMKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQNELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVS--GLESH-LYRVHQFNKVEMFCATS--QSESEKMLDYIVDIQTKIIAPLGLEFRILDMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFY---ENENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYM 1217
            +N + N++     V   +D   +I     T ++K   H  ++   D    ++    AG  SR YY+ G  A+LE+AL+ +    +    F+LIS P  +NK  +  S  ++  F  ++Y VV    E   + +  E       + L  TSE  +A    +  + K   PIK   +S C+R+EV   G ++  ++RVHQF K+E FC TS   +ESE M   +++        LG+ ++++ + S EL N A  KYD+E W PG   + E+ S SNCTDYQAR++   Y   +  N + +F H LN T CA  R + +ILE + T+ G + VP VL+ +M
Sbjct:  129 LNKIGNILHKDVVVSDNEDNNGLIRVFGDTTKSKRYSHVDLVEMIDGADFKMGGKVAG--SRCYYMTGPCALLEQALVTFGNLYMSDKDFKLISPPVFMNKESMH-SVAQLSQFDTELYKVVGKRSEDPLVDEGEE------EKYLIATSEQPIAALNGDRWIPKSELPIKYVGISECFRQEVGSHGRDTRGIFRVHQFKKIEQFCITSPYDNESENMFAEMINNAECFYQALGIPYQVVSIVSGELNNAAAIKYDLEGWFPGSGSFRELVSCSNCTDYQARSVLSRYGETKQMNQNTEFVHMLNCTLCATTRTVCAILENYQTDEG-IAVPAVLQPFM 457          
The following BLAST results are available for this feature:
BLAST of Serine--tRNA ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SARS25.014e-7437.68seryl-tRNA synthetase 2, mitochondrial [Source:HGN... [more]
SARS25.014e-7437.68seryl-tRNA synthetase 2, mitochondrial [Source:HGN... [more]
SARS26.097e-7437.68seryl-tRNA synthetase 2, mitochondrial [Source:HGN... [more]
SARS26.097e-7437.68seryl-tRNA synthetase 2, mitochondrial [Source:HGN... [more]
AC011455.32.592e-7337.68novel protein[more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sars-23.655e-6434.86Seryl Amino-acyl tRNA Synthetase [Source:UniProtK... [more]
sars-21.532e-5645.50Seryl Amino-acyl tRNA Synthetase [Source:UniProtK... [more]
sars-15.237e-4532.74Probable serine--tRNA ligase, cytoplasmic [Source... [more]
sars-15.237e-4532.74Probable serine--tRNA ligase, cytoplasmic [Source... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SerRS-m1.852e-8237.93gene:FBgn0021750 transcript:FBtr0083086[more]
SerRS-m1.852e-8237.93gene:FBgn0021750 transcript:FBtr0334589[more]
SerRS5.156e-4535.13gene:FBgn0031497 transcript:FBtr0335480[more]
SerRS5.156e-4535.13gene:FBgn0031497 transcript:FBtr0077667[more]
Slimp5.915e-1021.47gene:FBgn0051133 transcript:FBtr0084583[more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sars29.577e-7639.04seryl-tRNA synthetase 2, mitochondrial [Source:ZFI... [more]
sars13.467e-5131.58seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:4454... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000014465.12.339e-8241.67seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
ENSXETT00000030188.13.317e-8241.92seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
ENSXETT00000014474.14.649e-8241.96seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
ENSXETT00000030112.11.194e-7941.39seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
ENSXETT00000030183.14.271e-7743.54seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sars23.617e-7737.39seryl-aminoacyl-tRNA synthetase 2 [Source:MGI Symb... [more]
Sars1.282e-4831.88seryl-aminoacyl-tRNA synthetase [Source:MGI Symbol... [more]
Sars5.746e-4429.54seryl-aminoacyl-tRNA synthetase [Source:MGI Symbol... [more]
Sars2.368e-2731.28seryl-aminoacyl-tRNA synthetase [Source:MGI Symbol... [more]
back to top
BLAST of Serine--tRNA ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JJL8|SYSM_MOUSE2.530e-7637.39Serine--tRNA ligase, mitochondrial OS=Mus musculus... [more]
sp|Q9N0F3|SYSM_BOVIN1.115e-7338.86Serine--tRNA ligase, mitochondrial OS=Bos taurus O... [more]
sp|Q9NP81|SYSM_HUMAN2.928e-7337.68Serine--tRNA ligase, mitochondrial OS=Homo sapiens... [more]
sp|Q8RWT8|SYSM_ARATH1.800e-6835.54Serine--tRNA ligase, chloroplastic/mitochondrial O... [more]
sp|B8E0R9|SYS_DICTD3.274e-6234.72Serine--tRNA ligase OS=Dictyoglomus turgidum (stra... [more]
back to top
BLAST of Serine--tRNA ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7IPG99.654e-8842.22AA_TRNA_LIGASE_II domain-containing protein OS=Nas... [more]
A0A232FNS97.584e-8643.16AA_TRNA_LIGASE_II domain-containing protein OS=Tri... [more]
V4AA455.640e-8541.85AA_TRNA_LIGASE_II domain-containing protein OS=Lot... [more]
A0A482W6391.113e-8441.22Serine--tRNA ligase, mitochondrial OS=Asbolus verr... [more]
G4V5K72.191e-8436.66Seryl-tRNA synthetase OS=Schistosoma mansoni OX=61... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sars23.758e-7738.90seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
sars15.928e-5231.86seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:1030... [more]
sars16.111e-5231.86seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sars24.030e-7440.72seryl-tRNA synthetase 2, mitochondrial [Source:ZFI... [more]
sars11.154e-5032.84seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:4454... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DIA41.308e-5936.26Probable mitochondrial seryl-tRNA synthetase; muta... [more]
SES13.573e-4233.81Cytosolic seryl-tRNA synthetase; class II aminoacy... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO470004.672e-4132.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine--tRNA ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sars26.904e-7838.42seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
sars21.757e-7638.42seryl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
sars12.417e-5232.41seryl-tRNA synthetase 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Serine--tRNA ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000015237.10.000e+099.76SMESG000015237.1[more]
SMESG000016105.14.317e-4432.45SMESG000016105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015195 ID=SMED30015195|Name=Serine--tRNA ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=1309bp
CTTAATATTTAGAGAATTTTAGATTTTATATGATTAGAAATATAACACGG
TGTTTGCATAATGCCACTTTTAAAGAAAAGTATAATAATCTAATTATTAA
TAATCTGAAGAAAATTAAAATTGATGATATAAAGCAAAGTTTAGTTGTTC
GTAATGAAAATGTTGAAATTAATGACTTGTGCGAATTGTTGCAAAACGTT
CATAATGGAAATTATTATGAAATATTTAGTATGATAAATAATTTACCTAA
TTTAGTATCACCAACAACACCAGTTGGAAAAGAAAAAGATTCCATAATTA
CGAAATTAGTAAAAACCAATGAAAATAAGTTTTCCAAACATGCACAAATT
ATTGGTAAAGACCTTTGTCAATTAAGAATTAACGATGTGAATGCTGGTGC
TGAAAGTCGTGCCTATTATTTAAATGGTCATTTTGCTATGCTTGAAAGAG
CTCTTATTCGTTATACATTGGAAATATTAATGAAAAATGGTTTTCAATTA
ATATCTGTTCCTGATATAATTAATAAAAATATTGTTCAAAAATCAGGTTT
CAAAATTGATCCATTTAAAAATCAAATTTACAACGTTGTTACAAATCCCG
ATGAATTAACAAGTATATTTAAACAGAATGAATTAAACACATCCTGTCCG
AACGAATGTCTTGCTGGGACATCTGAAATGGCATTAGCAACCTATCTTAG
CAATTCAGTTTTGAAGAAACAAAATTTTCCGATAAAATTATGCGCTGTTA
GTCGTTGTTACAGACGAGAAGTGTCTGGTTTAGAGAGCCATCTTTATCGA
GTCCATCAGTTTAATAAAGTGGAAATGTTTTGTGCTACAAGCCAATCGGA
AAGCGAGAAAATGCTTGATTACATTGTCGATATTCAAACTAAAATTATTG
CTCCTCTTGGTTTGGAATTTAGAATTCTTGATATGGCATCGGAGGAATTA
GGCAATCCGGCTTTTAAGAAGTATGACATCGAAGTTTGGATGCCTGGCGA
TAAAATCTATGGCGAAATTTCCAGCGCGTCTAACTGTACAGACTACCAAG
CGAGGACTATGAATATTTTCTATGAAAATGAAAATGATGATCTTGATTTT
GCTCACACATTAAATGGCACAGGTTGCGCAGTTCCACGCCTCTTGAAATC
GATACTAGAAACTCACCATACGGAAAACGGTCATGTTGTTGTTCCAGAGG
TGCTTAGAAAGTATATGAAAGATATTTGTAAAATAACGAGACAACATCCG
CCACTTAAGGTGAATTGGATTAAAAAATTATAAATAATAATATTTATCGA
TATTTTTCA
back to top

protein sequence of SMED30015195-orf-1

>SMED30015195-orf-1 ID=SMED30015195-orf-1|Name=SMED30015195-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MIRNITRCLHNATFKEKYNNLIINNLKKIKIDDIKQSLVVRNENVEINDL
CELLQNVHNGNYYEIFSMINNLPNLVSPTTPVGKEKDSIITKLVKTNENK
FSKHAQIIGKDLCQLRINDVNAGAESRAYYLNGHFAMLERALIRYTLEIL
MKNGFQLISVPDIINKNIVQKSGFKIDPFKNQIYNVVTNPDELTSIFKQN
ELNTSCPNECLAGTSEMALATYLSNSVLKKQNFPIKLCAVSRCYRREVSG
LESHLYRVHQFNKVEMFCATSQSESEKMLDYIVDIQTKIIAPLGLEFRIL
DMASEELGNPAFKKYDIEVWMPGDKIYGEISSASNCTDYQARTMNIFYEN
ENDDLDFAHTLNGTGCAVPRLLKSILETHHTENGHVVVPEVLRKYMKDIC
KITRQHPPLKVNWIKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016260selenocysteine biosynthetic process
GO:0006434seryl-tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
GO:0006412translation
GO:0097056selenocysteinyl-tRNA(Sec) biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR015155PFU
IPR002317Ser-tRNA-ligase_type_1
IPR002314aa-tRNA-synt_IIb
IPR006195aa-tRNA-synth_II
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0004828serine-tRNA ligase activity
GO:0004812aminoacyl-tRNA ligase activity
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002317Serine-tRNA ligase, type1PRINTSPR00981TRNASYNTHSERcoord: 313..329
score: 54.9
coord: 331..347
score: 55.99
coord: 256..269
score: 59.52
coord: 296..309
score: 25.13
IPR002317Serine-tRNA ligase, type1PIRSFPIRSF001529Ser-tRNA_ligasecoord: 4..405
e-value: 1.3E-86
score: 288.5
IPR002317Serine-tRNA ligase, type1PANTHERPTHR11778SERYL-TRNA SYNTHETASEcoord: 16..404
IPR002314Aminoacyl-tRNA synthetase, class II (G/ P/ S/T)PFAMPF00587tRNA-synt_2bcoord: 210..378
e-value: 6.7E-22
score: 78.3
NoneNo IPR availableGENE3DG3DSA:3.30.930.10coord: 74..411
e-value: 2.4E-107
score: 360.8
NoneNo IPR availablePANTHERPTHR11778:SF0SERINE--TRNA LIGASE, MITOCHONDRIALcoord: 16..404
NoneNo IPR availableSUPERFAMILYSSF55681Class II aaRS and biotin synthetasescoord: 124..399
IPR006195Aminoacyl-tRNA synthetase, class IIPROSITEPS50862AA_TRNA_LIGASE_IIcoord: 138..389
score: 19.747