Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30015191
Length (bp)1728
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30015191) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30015191) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30015191) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30015191) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015191

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30015191SMESG000017729.1 dd_Smed_v4_11975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015191SMESG000017729.1 dd_Smed_v4_11975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015191SMESG000017729.1 dd_Smed_v4_11975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30015191SMESG000017729.1 dd_Smed_v4_11975_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: SIX6 (SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892])

HSP 1 Score: 316.235 bits (809), Expect = 1.793e-104
Identity = 167/242 (69.01%), Postives = 188/242 (77.69%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR---RIL-------LSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFD 970
              F+P Q+A VCETLEESGD+ERLGRFLWS+P      ++LN++E++LRARAIVAFH GN+RELYHILE H F K SHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R   ++L       L  E D  PE        +  L+   S A +S I I S   + D
Sbjct:    7 LNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLS---SKAATSAISITSSDSECD 245          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: SIX3 (SIX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:10889])

HSP 1 Score: 317.775 bits (813), Expect = 7.123e-104
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   80 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 269          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: SIX2 (SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888])

HSP 1 Score: 265.388 bits (677), Expect = 5.103e-84
Identity = 121/183 (66.12%), Postives = 151/183 (82.51%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 823
            F F  +Q+A VCE L++ G+IERLGRFLWS+P      + L+++E++L+A+A+VAFH GNFRELY ILE H F   +HAKLQ LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PR+IWDGE+ ++CFKE++RS+LREWY  +PYP+P +KRELA ATGLT TQV NWFKNRRQRDRAA +K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPA----CEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: SIX1 (SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887])

HSP 1 Score: 264.233 bits (674), Expect = 9.281e-84
Identity = 120/185 (64.86%), Postives = 149/185 (80.54%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            F F  +Q+A VCE L++ G++ERLGRFLWS+P        L+++E++L+A+A+VAFH GNFRELY ILE H F   +H KLQ LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LREWY  +PYP+P +KRELA ATGLT TQV NWFKNRRQRDRAA +K R
Sbjct:    7 FGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACD----HLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: SIX4 (SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890])

HSP 1 Score: 244.973 bits (624), Expect = 1.077e-73
Identity = 112/206 (54.37%), Postives = 147/206 (71.36%), Query Frame = 2
Query:  272 PFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRK 889
            P  F+PD +A VCE L++ G+++RL RFLWS+P + +L      +E+LL+ARA+VAFH G + ELY ILE H FE ++H  LQ LW +A Y EAE+ RGRPLG VDKYR+R+KFP+PRTIWDGE+  +CFKE++R+ L+E Y Q+ YP+PA+KR LA  TGL+ TQV NWFKNRRQRDR  +    +     E D NP   +E  K
Sbjct:   97 PLAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLL----RGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRNPSETQSK----SESDGNPSTEDESSK 294          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-32 (Homeobox protein ceh-32 [Source:UniProtKB/Swiss-Prot;Acc:Q23175])

HSP 1 Score: 238.81 bits (608), Expect = 2.138e-72
Identity = 121/187 (64.71%), Postives = 145/187 (77.54%), Query Frame = 2
Query:  290 DQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDE 850
            DQI K CE LE  GD++ L RF+ ++P      + +  +EA LRARA+V FH  +FRELY ILE + F    H KLQ +W EAHY+E EK RG+ L  VDKYRVRKK+PMPRTIWDGEQKTHCFKERTRSLLREWYL+DPYPNP KK+ELA+ATGLT  QVGNWFKNRRQRDRAAA+K+++ ++  E
Sbjct:   71 DQIVKTCEQLETDGDVDGLFRFMCTIPPQKT--QEVAGNEAFLRARALVCFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTIWDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRAAAAKNKQNIIGVE 255          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-33 (Homeobox protein ceh-33 [Source:UniProtKB/Swiss-Prot;Acc:Q94166])

HSP 1 Score: 209.92 bits (533), Expect = 1.237e-63
Identity = 100/210 (47.62%), Postives = 145/210 (69.05%), Query Frame = 2
Query:  278 QFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLN 907
            +++ +Q+A +CE L  S D  +L +F+W++         +  ++ +L+A+A +AFH+ NF+ELY I+E HHF    H  LQ  WL AHY EAEK+RGR LG V KYR+R+K+P+PRTIWDGE+ ++CF++++R LLR+WY ++ YP+P +KRELA  T LT TQV NWFKNRRQRDRA   + +  L   +D S  E+    RK ++KL+
Sbjct:   19 RYSEEQVACICEAL--SNDARKLSQFVWTVLERD----EMRNNQYILKAQAFLAFHSNNFKELYRIIESHHFASEHHLPLQEWWLNAHYHEAEKIRGRQLGAVGKYRIRRKYPLPRTIWDGEETSYCFRDKSRVLLRDWYCRNSYPSPREKRELAEKTHLTVTQVSNWFKNRRQRDRAGVPEPKDCL---KDISEEEDLKLIRKTASKLS 219          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-34 (Homeobox protein ceh-34 [Source:UniProtKB/Swiss-Prot;Acc:Q94165])

HSP 1 Score: 165.236 bits (417), Expect = 8.027e-47
Identity = 83/196 (42.35%), Postives = 123/196 (62.76%), Query Frame = 2
Query:  281 FAPDQIAKVCETL----EESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDD 856
            ++  +I  +CE+L     ++G  E+L  F++++P      +     E++L+A+A+V F T N++ LY +LE   F   +H  LQ LWL+AHY+EA K + R LG V KYR+RKK P P TIWDGE+  +CFK ++R++LR+ Y +  YP+   KR LA  T L+  QV NWFKN+RQR+RAA    R    S++ D
Sbjct:   17 YSEQEIVCICESLFNEGLQTGRTEQLANFIYNLP------QCYQVMESVLKAQALVYFTTQNWKMLYKLLECSKFSPHNHTVLQNLWLDAHYKEAAKTKDRELGAVCKYRIRKKNPFPNTIWDGEETNYCFKSKSRNVLRDAYKKCQYPSVEDKRRLAQQTELSIIQVSNWFKNKRQRERAAGQLDRSSARSNDSD 206          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-39 (Homeobox protein unc-39 [Source:UniProtKB/Swiss-Prot;Acc:O17894])

HSP 1 Score: 141.739 bits (356), Expect = 2.019e-37
Identity = 67/182 (36.81%), Postives = 113/182 (62.09%), Query Frame = 2
Query:  278 QFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEH---EALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQ-DPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRA 811
            +++ +Q+  +  +L ++ D +RL  F   +   S+   +  +H   EA++ A     +H+  F  L+H+L   HF++  +  LQ +W  A Y+E++  RG+ L PV+KYR+R+KFP P+TIWDGE+  + FK+ +R  L++++     YP   +KRE++ ATGL   Q+ NWFKNRRQRD++
Sbjct:   96 EYSMEQMEAISTSLFQARDGDRLVAFFKQL--ESLYGPNAVDHLRSEAIIVAYTYALYHSNEFETLFHLLSNRHFQQRHYNDLQDIWHHARYKESQLKRGKELNPVEKYRLRRKFPAPKTIWDGEEIVYSFKDSSRKFLKQFFRNVSEYPTQEQKREISRATGLKIVQISNWFKNRRQRDKS 275          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0088865)

HSP 1 Score: 279.641 bits (714), Expect = 2.112e-87
Identity = 141/190 (74.21%), Postives = 157/190 (82.63%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            L V    F+  Q+  VC+TLE+SGDIERL RFLWS+P        +   EA+LRARA+VA+H GNFRELY I+E H F K+S+ KLQA+WLEAHY EAEKLRGR LGPVDKYRVRKKFP+P TIWDGEQKTHCFKERTRSLLREWYLQDPYPNP KKRELA ATGL PTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   30 LAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNR 219          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0329885)

HSP 1 Score: 279.641 bits (714), Expect = 2.998e-87
Identity = 141/190 (74.21%), Postives = 157/190 (82.63%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            L V    F+  Q+  VC+TLE+SGDIERL RFLWS+P        +   EA+LRARA+VA+H GNFRELY I+E H F K+S+ KLQA+WLEAHY EAEKLRGR LGPVDKYRVRKKFP+P TIWDGEQKTHCFKERTRSLLREWYLQDPYPNP KKRELA ATGL PTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   30 LAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNR 219          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: so (gene:FBgn0003460 transcript:FBtr0088970)

HSP 1 Score: 263.077 bits (671), Expect = 7.327e-82
Identity = 120/183 (65.57%), Postives = 150/183 (81.97%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 823
            F F  +Q+A VCE L+++G+IERLGRFLWS+P    L   LNE  ++L+A+A+VAFH G ++ELY +LE HHF   +HAKLQALWL+AHY EAEKLRGRPLG V KYRVR+KFP+PRTIWDGE+ ++CFKE++RS+LR+WY  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA  K
Sbjct:  101 FGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKL--QLNE--SVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHK 279          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078274)

HSP 1 Score: 220.705 bits (561), Expect = 6.244e-66
Identity = 100/179 (55.87%), Postives = 132/179 (73.74%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRA 811
             QF+ DQI  +CE L++ GDIE+L  FL S+P +         +E++LRARA+VA++ G F ELY++LE H F    H  LQ LW +AHY+EAEK+RGRPLG VDKYR+RKK+P+P+TIWDGE+  +CFKE++R+ L++ YL + YP P +K+ LA  TGLT TQV NWFKNRRQRDR 
Sbjct:  179 LQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFF----KTNESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRT 353          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078275)

HSP 1 Score: 220.705 bits (561), Expect = 6.244e-66
Identity = 100/179 (55.87%), Postives = 132/179 (73.74%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRA 811
             QF+ DQI  +CE L++ GDIE+L  FL S+P +         +E++LRARA+VA++ G F ELY++LE H F    H  LQ LW +AHY+EAEK+RGRPLG VDKYR+RKK+P+P+TIWDGE+  +CFKE++R+ L++ YL + YP P +K+ LA  TGLT TQV NWFKNRRQRDR 
Sbjct:  179 LQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFF----KTNESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRT 353          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: six3a (SIX homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-990415-127])

HSP 1 Score: 318.931 bits (816), Expect = 4.678e-105
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   42 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 231          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: six3a (SIX homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-990415-127])

HSP 1 Score: 318.931 bits (816), Expect = 4.678e-105
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   42 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 231          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: six6b (SIX homeobox 6b [Source:ZFIN;Acc:ZDB-GENE-050522-308])

HSP 1 Score: 311.227 bits (796), Expect = 8.651e-103
Identity = 153/185 (82.70%), Postives = 167/185 (90.27%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGDIERLGRFLWS+P      + LN +E++LRARAIVAFHTGNFRELYHILE H F K SH+KLQALWLE+HYQEAEKLRGRPLGPVDKYRVRKKFP+P+TIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEVLNRNESVLRARAIVAFHTGNFRELYHILENHKFTKESHSKLQALWLESHYQEAEKLRGRPLGPVDKYRVRKKFPLPKTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: six6a (SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1282])

HSP 1 Score: 311.227 bits (796), Expect = 9.533e-103
Identity = 152/185 (82.16%), Postives = 165/185 (89.19%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGD+ERLGRFLWS+P        L ++E++LRARA+VAFH GNFRELYHILE H F K SHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPSACDVLGKNESVLRARAVVAFHAGNFRELYHILENHKFTKDSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: six6a (SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1282])

HSP 1 Score: 311.227 bits (796), Expect = 9.533e-103
Identity = 152/185 (82.16%), Postives = 165/185 (89.19%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGD+ERLGRFLWS+P        L ++E++LRARA+VAFH GNFRELYHILE H F K SHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPSACDVLGKNESVLRARAVVAFHAGNFRELYHILENHKFTKDSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: tmem136 (transmembrane protein 136 [Source:Xenbase;Acc:XB-GENE-966251])

HSP 1 Score: 318.546 bits (815), Expect = 1.028e-104
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   42 FQLPSLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 231          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: six6 (SIX homeobox 6 [Source:NCBI gene;Acc:100101705])

HSP 1 Score: 313.538 bits (802), Expect = 2.005e-103
Identity = 155/185 (83.78%), Postives = 168/185 (90.81%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGDIERLGRFLWS+P      ++LN++E++LRARAIVAFHTGNFRELYHILE H F K SH KLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNFRELYHILENHKFTKDSHTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: six2 (SIX homeobox 2 [Source:NCBI gene;Acc:100101784])

HSP 1 Score: 264.233 bits (674), Expect = 9.779e-84
Identity = 120/183 (65.57%), Postives = 150/183 (81.97%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 823
            F F  +Q+A VCE L++ G+IERLGRFLWS+P      + L+++E++L+A+A+VAFH GNFRELY ILE H F   +H KLQ LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PR+IWDGE+ ++CFKE++RS+LREWY  +PYP+P +KRELA ATGLT TQV NWFKNRRQRDRAA +K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPA----CEHLHKNESVLKAKAVVAFHRGNFRELYKILEGHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: six1 (SIX homeobox 1 [Source:NCBI gene;Acc:100101702])

HSP 1 Score: 263.848 bits (673), Expect = 1.333e-83
Identity = 120/185 (64.86%), Postives = 149/185 (80.54%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            F F  +Q+A VCE L++ G++ERLGRFLWS+P        L+++E++L+A+A+VAFH GNFRELY ILE H F   +H KLQ LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LREWY  +PYP+P +KRELA ATGLT TQV NWFKNRRQRDRAA +K R
Sbjct:    7 FGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACD----HLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: SIX4 (SIX homeobox 4 [Source:NCBI gene;Acc:100498150])

HSP 1 Score: 232.261 bits (591), Expect = 2.282e-66
Identity = 106/207 (51.21%), Postives = 143/207 (69.08%), Query Frame = 2
Query:  269 WPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRK 889
            +   F+P+ +A VCE L++ GD++RL RFL S+P + +L      +E++L+ARA+V FH G + EL+ +LE H+F  S+HA LQ LW +A Y EAEK RGRPLG VDKYR+R+KFP+PRTIWDGE+  +CFKE++R+ L+E Y  + YP+PA KR LA  TGL+ TQV NWFKNRRQRDR  +    +     E D N    +E  K
Sbjct:  146 YTLAFSPEHVACVCEALQQGGDLDRLSRFLCSLPHSELLRG----NESILKARALVTFHQGRYSELFLLLESHNFHPSNHAALQELWYKARYIEAEKARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKHNRYPSPAAKRNLAKVTGLSLTQVSNWFKNRRQRDRNPSEAQSK----SESDGNHSTEDESSK 344          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Six3 (sine oculis-related homeobox 3 [Source:MGI Symbol;Acc:MGI:102764])

HSP 1 Score: 318.161 bits (814), Expect = 3.987e-104
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   81 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 270          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Six3 (sine oculis-related homeobox 3 [Source:MGI Symbol;Acc:MGI:102764])

HSP 1 Score: 318.161 bits (814), Expect = 3.987e-104
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   81 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 270          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Six3 (sine oculis-related homeobox 3 [Source:MGI Symbol;Acc:MGI:102764])

HSP 1 Score: 317.39 bits (812), Expect = 1.192e-103
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   81 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 270          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Six6 (sine oculis-related homeobox 6 [Source:MGI Symbol;Acc:MGI:1341840])

HSP 1 Score: 312.383 bits (799), Expect = 3.943e-103
Identity = 153/185 (82.70%), Postives = 168/185 (90.81%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGD+ERLGRFLWS+P      ++LN++E++LRARAIVAFH GN+RELYHILE H F K SHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Six2 (sine oculis-related homeobox 2 [Source:MGI Symbol;Acc:MGI:102778])

HSP 1 Score: 265.774 bits (678), Expect = 2.515e-84
Identity = 121/183 (66.12%), Postives = 151/183 (82.51%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 823
            F F  +Q+A VCE L++ G+IERLGRFLWS+P      + L+++E++L+A+A+VAFH GNFRELY ILE H F   +HAKLQ LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PR+IWDGE+ ++CFKE++RS+LREWY  +PYP+P +KRELA ATGLT TQV NWFKNRRQRDRAA +K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPA----CEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O95475|SIX6_HUMAN (Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=SIX6 PE=1 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 8.610e-104
Identity = 167/242 (69.01%), Postives = 188/242 (77.69%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR---RIL-------LSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFD 970
              F+P Q+A VCETLEESGD+ERLGRFLWS+P      ++LN++E++LRARAIVAFH GN+RELYHILE H F K SHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R   ++L       L  E D  PE        +  L+   S A +S I I S   + D
Sbjct:    7 LNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLS---SKAATSAISITSSDSECD 245          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O93307|SIX6_CHICK (Homeobox protein SIX6 OS=Gallus gallus OX=9031 GN=SIX6 PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 2.228e-103
Identity = 154/185 (83.24%), Postives = 168/185 (90.81%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGDIERLGRFLWS+P      ++LN++E++LRARAIVAFHTGN+RELYHILE H F K SH KLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNYRELYHILENHKFTKESHGKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 191          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O42406|SIX3_CHICK (Homeobox protein SIX3 OS=Gallus gallus OX=9031 GN=SIX3 PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 2.337e-103
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   62 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 251          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q62233|SIX3_MOUSE (Homeobox protein SIX3 OS=Mus musculus OX=10090 GN=Six3 PE=1 SV=2)

HSP 1 Score: 318.161 bits (814), Expect = 2.789e-103
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   81 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 270          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O95343|SIX3_HUMAN (Homeobox protein SIX3 OS=Homo sapiens OX=9606 GN=SIX3 PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 3.421e-103
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   80 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 269          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: V3Z5W5 (Homeobox domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_179424 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.329e-109
Identity = 152/185 (82.16%), Postives = 169/185 (91.35%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F P Q+AKVCETLEESGDIERLGRFLWS+P N    ++LN HE++LR+R++V+FHTGNFR+LYHILE H F K SHAKLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKK+P+PRTIWDGEQKTHCFKERTR+LLREWYLQDPYPNP KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LHFTPQQVAKVCETLEESGDIERLGRFLWSLPVNPSAMEALNRHESILRSRSLVSFHTGNFRDLYHILENHKFTKESHAKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKYPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAATKNR 191          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A2C9JWI7 (Homeobox domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106070787 PE=4 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 7.172e-109
Identity = 153/185 (82.70%), Postives = 170/185 (91.89%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F P Q+AKVCETLEESGDIERLGRFLWS+P N    ++LN+HE+++RARA+V+FHTGNFR+LYHILE H F K SHAKLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKK+P+PRTIWDGEQKTHCFKERTR+LLREWYLQDPYPNP KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   72 LHFTPHQVAKVCETLEESGDIERLGRFLWSLPVNPSACEALNKHESVIRARALVSFHTGNFRDLYHILEHHKFTKESHAKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKYPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAATKNR 256          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A210Q479 (Homeobox protein SIX6 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09515 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.267e-108
Identity = 153/185 (82.70%), Postives = 169/185 (91.35%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F P Q+A+VCETLEESGDIERLGRFLWS+P N     +LN+HE++LRAR++V+FHTGNFR+LYHILE H F K SHAKLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLREWYLQDPYPNP KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LHFTPQQVAQVCETLEESGDIERLGRFLWSLPVNPSACDALNKHESVLRARSLVSFHTGNFRDLYHILENHKFTKESHAKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAATKNR 191          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A3S0ZP20 (Homeobox domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_012837 PE=4 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 2.479e-108
Identity = 164/239 (68.62%), Postives = 191/239 (79.92%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK---------HRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPED 964
              F P Q+AKVCETLE+SGDIERLGRFLWS+P N    ++LN+HE+++RARA+V+FHTGNFR+LYHILE H F K SHAKLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKK+P+PRTIWDGEQKTHCFKERTR+LLREWYLQDPYPNP KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K         H+    S  DD+   + +++R+H   L+ D   +     D+DSE  D
Sbjct:   93 LHFTPHQVAKVCETLEDSGDIERLGRFLWSLPVNPSACEALNKHESVIRARALVSFHTGNFRDLYHILEHHKFTKESHAKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKYPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAATKNRLQQQHQGHKLSASSPRDDTMSPSSSDRREHDNDLDEDDCIS-----DLDSEISD 326          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1B4Z3F6 (Six3 homeodomain protein (Fragment) OS=Branchiostoma japonicum OX=373177 GN=six3 PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.877e-107
Identity = 154/186 (82.80%), Postives = 166/186 (89.25%), Query Frame = 2
Query:  257 GLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAA 814
            GL +    F P+Q+A VCETLEESGDIERLGRFLWS+P       +LN++EA+LRARA+VAFHTGNFR+LYHILE H F K SHAKLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP KKRELA ATGLTPTQVGNWFKNRRQRDRAA
Sbjct:    2 GLGLPTLNFTPEQVASVCETLEESGDIERLGRFLWSLPVAPGAADALNKNEAVLRARAVVAFHTGNFRDLYHILENHRFTKESHAKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPQKKRELAQATGLTPTQVGNWFKNRRQRDRAA 187          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: six3a (SIX homeobox 3 [Source:NCBI gene;Acc:103025522])

HSP 1 Score: 316.235 bits (809), Expect = 5.116e-104
Identity = 152/190 (80.00%), Postives = 171/190 (90.00%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+ +Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   42 FQLPTLNFSAEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 231          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: six6b (homeobox protein SIX6 [Source:NCBI gene;Acc:103035477])

HSP 1 Score: 312.768 bits (800), Expect = 1.607e-103
Identity = 158/203 (77.83%), Postives = 174/203 (85.71%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEK 883
              F+P Q+A VCETLEESGDIERLGRFLWS+P      + LN +E++LRARAIVAFHTGNFRELYHILE H F K SH+KLQALWLE+HYQEAEKLRGRPLGPVDKYRVRKKFP+P+TIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R   L  +  SN   P E+
Sbjct:    7 LNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEVLNRNESVLRARAIVAFHTGNFRELYHILENHKFTKESHSKLQALWLESHYQEAEKLRGRPLGPVDKYRVRKKFPLPKTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR---LQQQVLSNGSVPGEE 206          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: six7 (homeobox protein SIX6-like [Source:NCBI gene;Acc:103038426])

HSP 1 Score: 309.301 bits (791), Expect = 7.480e-102
Identity = 139/185 (75.14%), Postives = 163/185 (88.11%), Query Frame = 2
Query:  281 FAPDQIAKVCETLEESGDIERLGRFLWSMPTN--SILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            F PDQ+A+VCE LEE+GD+ERLGRFLWS+P        ++LN HE+++RARA+VAFH GNF  LY IL+ H F + SHAKLQ LWL+AHY+EAE+LRGRPLGPV+KYR+RKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP++KR LA ATGLTPTQVGNWFKNRRQRDRAA++K+R
Sbjct:    7 FTPDQVARVCENLEETGDMERLGRFLWSLPAAVPGAAGEALNRHESVMRARALVAFHGGNFEALYQILQNHRFTRESHAKLQDLWLDAHYREAERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQRDRAASAKNR 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: six3b (homeobox protein SIX6-like [Source:NCBI gene;Acc:103035166])

HSP 1 Score: 299.671 bits (766), Expect = 1.183e-97
Identity = 155/240 (64.58%), Postives = 183/240 (76.25%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNS-ILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR-------RILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFD 970
              F  +Q+A VCETLEE+GD+ERLGRFLWS+P       ++L++HEA+ RARA+VA+HTG+FRELY ILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R       +  L    +SNP  P      ++  +  +    ++ + +     DFD
Sbjct:   49 LSFTAEQVAGVCETLEETGDVERLGRFLWSLPVAPPGACEALDKHEAIQRARAVVAYHTGSFRELYRILESHRFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHHGLSQGGLRGLSESNPGPPEAASPSASVSSSAERADGATVLSVTDSDSDFD 288          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: six1b (homeobox protein six1b [Source:NCBI gene;Acc:103034839])

HSP 1 Score: 267.314 bits (682), Expect = 3.668e-85
Identity = 128/220 (58.18%), Postives = 163/220 (74.09%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSS 934
            F F  +Q+A VCE L++ G++ERLGRFLWS+P        L+++E++L+A+A+VAFH GNFRELY ILE H F   +H KLQ LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LREWY  +PYP+P +KRELA ATGLT TQV NWFKNRRQRDRAA +K R      E+  N  +   K+   + L+G +S   SS
Sbjct:    7 FGFTQEQVACVCEVLQQGGNLERLGRFLWSLPA----CDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER------ENSENNNSGANKQSQLSPLDGGKSLMSSS 216          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002854.1 (pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 gene:ENSPMAG00000002608.1 transcript:ENSPMAT00000002854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 308.145 bits (788), Expect = 1.252e-102
Identity = 151/185 (81.62%), Postives = 166/185 (89.73%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGDIERLGRFLWS+P     W++LN  EA+LRARA+VAFH  N+R+LY ILE H F K+SHAKLQA+WLEAHY EAE+LRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   39 LSFSPQQVASVCETLEESGDIERLGRFLWSLPVAPGAWEALNRQEAVLRARAVVAFHASNYRDLYAILEGHKFSKASHAKLQAMWLEAHYLEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 223          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 217.624 bits (553), Expect = 1.027e-68
Identity = 100/154 (64.94%), Postives = 123/154 (79.87%), Query Frame = 2
Query:  335 IERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRR 796
            +ERLGRFLWS+P    + +S    E++L A+A+VAFH GNFRELY +LE   F   +H KLQ LWL+AHY EAE+LRGRPLG V KYRVR+KFP+PRTIWDGE+ ++CFKER+R +LR+WY  +PYP+P +KRELA ATGLT TQV NWFKNRR
Sbjct:    1 MERLGRFLWSLPACEQIQRS----ESILMAKAVVAFHQGNFRELYAVLESQPFSARNHPKLQQLWLKAHYTEAERLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKERSRGVLRDWYAHNPYPSPREKRELAQATGLTTTQVSNWFKNRR 150          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011157.1 (pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 gene:ENSPMAG00000010130.1 transcript:ENSPMAT00000011157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 2.278e-37
Identity = 58/63 (92.06%), Postives = 62/63 (98.41%), Query Frame = 2
Query:  608 KFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRR 796
            KFP+P+TIWDGEQKTHCFKERTR+LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRR
Sbjct:    1 KFPLPKTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR 63          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: Six4 (pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 gene:ENSPMAG00000010180.1 transcript:ENSPMAT00000011207.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Six4)

HSP 1 Score: 86.2705 bits (212), Expect = 2.793e-21
Identity = 37/63 (58.73%), Postives = 48/63 (76.19%), Query Frame = 2
Query:  608 KFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRR 796
            KFP+PRTIWDGE+  +CFKE++R+ L++ Y +  YP P +KR LA  TGL+  QV NWFKNRR
Sbjct:    1 KFPLPRTIWDGEETVYCFKEKSRNFLKDCYRRTRYPAPDEKRRLAKLTGLSVVQVSNWFKNRR 63          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001924.1 (pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:ENSPMAG00000001748.1 transcript:ENSPMAT00000001924.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 3.902e-21
Identity = 42/80 (52.50%), Postives = 56/80 (70.00%), Query Frame = 2
Query:  293 QIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWL 532
            Q+A VCE L++ GD+ RL RFLW++P  +    + +  EA+LRARA VAFH+G++RELY +LE H FE   HA L AL L
Sbjct:    1 QVACVCEALQQGGDVARLARFLWALPGPA----AASRDEAVLRARAHVAFHSGSYRELYDVLEGHAFEARHHAALLALSL 76          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 50.8322 bits (120), Expect = 2.011e-7
Identity = 31/82 (37.80%), Postives = 45/82 (54.88%), Query Frame = 2
Query:  671 TRSLLREW---YLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLN 907
            T S+L +W   ++ +PYP   +KREL + TGLT  Q+ NWF N R          RR + S ++D+N    N +RK S+  N
Sbjct:  205 TVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINAR----------RRKIFSGQNDAN----NFRRKFSSSTN 272          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO33059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST96])

HSP 1 Score: 304.294 bits (778), Expect = 2.406e-101
Identity = 150/185 (81.08%), Postives = 166/185 (89.73%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+  QIA+VCETLEESGD+ERL RFLWS+P      ++L +HE++LRARAIVAFH GNFR+LYHILE H F + SHAKLQA+WLEAHYQEAE+LRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    8 LSFSAHQIAQVCETLEESGDVERLARFLWSLPVAPGTLEALGKHESVLRARAIVAFHMGNFRDLYHILETHRFTRESHAKLQAMWLEAHYQEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 192          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO34334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN4])

HSP 1 Score: 262.692 bits (670), Expect = 2.731e-85
Identity = 119/185 (64.32%), Postives = 154/185 (83.24%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            F F P+Q+A VCE L++SGDIERLGRFLWS+P      +++ ++E++L+A+AIV+FH  NF+ELY ILE ++F  ++H KLQ+LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R++LREWY  +PYP+P +KRELA  TGLT TQV NWFKNRRQRDRAA +K R
Sbjct:    5 FSFTPEQVACVCEVLQQSGDIERLGRFLWSLPEC----ETIQKNESVLKAKAIVSFHQQNFQELYRILENNNFSPNAHPKLQSLWLKAHYMEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNILREWYSHNPYPSPREKRELAEGTGLTTTQVSNWFKNRRQRDRAAEAKIR 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO42933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S005])

HSP 1 Score: 231.106 bits (588), Expect = 3.941e-73
Identity = 108/183 (59.02%), Postives = 137/183 (74.86%), Query Frame = 2
Query:  281 FAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            F+ +QI  VCE L+ SG+IERL RFLWS+P +S   + ++  E +L A+A+VAFH  NF+ELY ILE   F++S H KLQ LW  AHY EAE++RGRPLG V KYRVR+KFP+PRTIWDGE+ T+CFKE++RS+L + Y+  PYP P +K ELA  T LT TQV NWFKN+RQR RAA  + R
Sbjct:    3 FSMEQIISVCECLQNSGNIERLARFLWSLPKDS---EEIHACETILVAKAVVAFHQNNFKELYSILESRKFQRSEHEKLQCLWRTAHYIEAERVRGRPLGAVGKYRVRRKFPLPRTIWDGEETTYCFKEKSRSILNKAYVDSPYPTPREKHELAKMTDLTVTQVSNWFKNKRQRVRAAEIRKR 182          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO31034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ27])

HSP 1 Score: 227.639 bits (579), Expect = 6.374e-72
Identity = 105/179 (58.66%), Postives = 136/179 (75.98%), Query Frame = 2
Query:  290 DQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKH 826
            DQ+A VC+ L ++GDIERL RFLWS+P + +L    N  E++L+ARAIV+FH G +RE+Y+ILE + F+ SSH  LQ LW +AHY EAEKLRGR LG VDKYR+R+KFP+PRTIWDGE+  +CFKE+ R+ L++ Y Q+ YP P +KR +A  T LT  QV NWFKNRRQRDR  ++K 
Sbjct:    1 DQVACVCDALRQAGDIERLSRFLWSLPPDDLL----NGSESVLKARAIVSFHRGRYREVYNILETNEFDPSSHELLQCLWYKAHYSEAEKLRGRSLGAVDKYRIRRKFPLPRTIWDGEETVYCFKEKARAALKDCYEQNKYPTPQEKRLIAKQTNLTLKQVSNWFKNRRQRDRIPSNKR 175          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO33407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS98])

HSP 1 Score: 182.185 bits (461), Expect = 9.395e-55
Identity = 87/169 (51.48%), Postives = 119/169 (70.41%), Query Frame = 2
Query:  290 DQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRR 796
            DQ+A +C+ L + GDI+RL +FL S+P   +     N+ E+LL+ARA+VAFH G ++E+Y+ILE + F+ SSH  LQ LW +AHY E EKLRGR L  VDK+R+RKK P+P TI DGE+  + FKE+ R++L+E Y    YP   +KR +A+ T LT  QV NWF+NRR
Sbjct:    1 DQVACICDALFQEGDIKRLSQFLLSIPQEDLQ----NKSESLLKARAMVAFHRGCYQEVYNILENNKFDTSSHEFLQCLWYKAHYSEGEKLRGRSLSAVDKFRIRKKSPLPNTISDGEKTIYFFKEKVRTVLKECYEHKKYPTLKEKRVIATQTNLTLRQVRNWFRNRR 165          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: six3 (SIX homeobox 3 [Source:NCBI gene;Acc:100144381])

HSP 1 Score: 319.316 bits (817), Expect = 8.470e-105
Identity = 153/190 (80.53%), Postives = 172/190 (90.53%), Query Frame = 2
Query:  260 LQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
             Q+    F+P+Q+A VCETLEE+GDIERLGRFLWS+P      +++N+HE++LRARA+VAFHTGNFR+LYHILE H F K SH KLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   71 FQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 260          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: six6a (SIX homeobox 6 [Source:NCBI gene;Acc:101154821])

HSP 1 Score: 312.383 bits (799), Expect = 3.173e-103
Identity = 153/185 (82.70%), Postives = 167/185 (90.27%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
              F+P Q+A VCETLEESGD+ERLGRFLWS+P      + LN++E++LRARA+VAFHTGNFRELYHILE H F K SH KLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:    7 LNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEVLNKNESVLRARAVVAFHTGNFRELYHILENHKFTKESHTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR 191          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: six7 (homeobox protein SIX6-like [Source:NCBI gene;Acc:101175353])

HSP 1 Score: 311.612 bits (797), Expect = 9.581e-103
Identity = 152/234 (64.96%), Postives = 181/234 (77.35%), Query Frame = 2
Query:  281 FAPDQIAKVCETLEESGDIERLGRFLWSMPTN--SILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRR----ILLSDEDDSNPENPNEKRKHSTKLNGD-QSPAYSSWIDIDSEPE 961
            F PDQ+A+VCE LEE+GDIERLGRFLWS+P        ++LN HE+++RARA+VAFH GNF  LY IL+ H F + SHAKLQ LWL+AHY+EAE+LRGRPLGPV+KYR+RKKFP+PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP++KR LA ATGLTPTQVGNWFKNRRQRDRAA++K+R      LL  E  ++     E++ HS +L    Q P      D  +E E
Sbjct:    7 FTPDQVARVCENLEETGDIERLGRFLWSLPAAVPGSAGEALNRHESVMRARALVAFHVGNFEALYQILQSHRFTRESHAKLQDLWLDAHYREAERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQRDRAASAKNRLQQDPSLLPSEGSTD--GFQERQHHSQRLPASPQHPGSPEASDCSTENE 238          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: six3 (sine oculis homeobox homolog 3 [Source:NCBI gene;Acc:100049355])

HSP 1 Score: 298.901 bits (764), Expect = 1.445e-97
Identity = 147/183 (80.33%), Postives = 165/183 (90.16%), Query Frame = 2
Query:  281 FAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 829
            F+  QIA VCETLEE+GDIERL RFLWS+P N+    S++EHE++ RARA+VAFHTG +RELY ILE H F ++SH+KLQA+WLEAHY+EAEKLRGRPLGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP KKRELA ATGLTPTQVGNWFKNRRQRDRAAA+K+R
Sbjct:   50 FSATQIASVCETLEETGDIERLARFLWSLPVNTDGRDSISEHESVQRARAVVAFHTGCYRELYRILETHRFTRASHSKLQAMWLEAHYREAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPGKKRELAHATGLTPTQVGNWFKNRRQRDRAAAAKNR 232          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: six1b (SIX homeobox 1 [Source:NCBI gene;Acc:101175523])

HSP 1 Score: 267.314 bits (682), Expect = 3.493e-85
Identity = 132/234 (56.41%), Postives = 169/234 (72.22%), Query Frame = 2
Query:  275 FQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFDED 976
            F F  +Q+A VCE L++ G++ERLGRFLWS+P        L+++E++L+A+A+VAFH GNFRELY ILE H F   +H KLQ LWL+AHY EAEKLRGRPLG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LREWY  +PYP+P +KRELA ATGLT TQV NWFKNRRQRDRAA +K R      E+  N      K+   + L+G +S   SS  D  S P+  D++
Sbjct:    7 FGFTQEQVACVCEVLQQGGNLERLGRFLWSLPA----CDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER------ENSENNNAGGNKQNQLSPLDGGKS-LMSSSEDEFSPPQSPDQN 229          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 804.668 bits (2077), Expect = 0.000e+0
Identity = 485/489 (99.18%), Postives = 486/489 (99.39%), Query Frame = 2
Query:  143 MSLXXXXXXXXXXXXSHNLQSIXXXXXXXXXXXXXXXXGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFDEDFNEKSDKAHHSELIKTKVENPKEVDNQCESQSDTLTNDSTCRNDSKIPFSLNFLMSKEATDTKXXXXXXXXXXXXXXXIRNPATIPFPGFIPQSPVTCFSKLSNHNPSDMKLNKPHFNVSDILTRMNPRECXXXXXXXXXXXXPFINMLNMLQSVSSFKXXXXXXXXXXXXXXXXXXXETCFPRFPXXXXXXXXXXXXXDKYRSVPTSKRD 1609
            MSLNIPNMPPIINNISHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFDEDFNEKSDK HHSELIKTKVENPKEVDNQCE+QSDTLTNDSTCRNDSKIPFSLNFLMSKE TDTKLNQLNQSFLQNLDQLIRNPATIPFPGFIPQSPVTCFSK SNHNPSDMKLNKPHFNVSDILTRMNPRECSSNIRSNTFSSSPFINMLNMLQSVSSFKSFSPLVGLPLPFPLPSSTPETCFPRFPSNISSSLNSTINSDKYRSVPTSKRD
Sbjct:    1 MSLNIPNMPPIINNISHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFDEDFNEKSDKTHHSELIKTKVENPKEVDNQCENQSDTLTNDSTCRNDSKIPFSLNFLMSKETTDTKLNQLNQSFLQNLDQLIRNPATIPFPGFIPQSPVTCFSKFSNHNPSDMKLNKPHFNVSDILTRMNPRECSSNIRSNTFSSSPFINMLNMLQSVSSFKSFSPLVGLPLPFPLPSSTPETCFPRFPSNISSSLNSTINSDKYRSVPTSKRD 489          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 470/474 (99.16%), Postives = 471/474 (99.37%), Query Frame = 2
Query:  188 SHNLQSIXXXXXXXXXXXXXXXXGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFDEDFNEKSDKAHHSELIKTKVENPKEVDNQCESQSDTLTNDSTCRNDSKIPFSLNFLMSKEATDTKXXXXXXXXXXXXXXXIRNPATIPFPGFIPQSPVTCFSKLSNHNPSDMKLNKPHFNVSDILTRMNPRECXXXXXXXXXXXXPFINMLNMLQSVSSFKXXXXXXXXXXXXXXXXXXXETCFPRFPXXXXXXXXXXXXXDKYRSVPTSKRD 1609
            SHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFDEDFNEKSDK HHSELIKTKVENPKEVDNQCE+QSDTLTNDSTCRNDSKIPFSLNFLMSKE TDTKLNQLNQSFLQNLDQLIRNPATIPFPGFIPQSPVTCFSK SNHNPSDMKLNKPHFNVSDILTRMNPRECSSNIRSNTFSSSPFINMLNMLQSVSSFKSFSPLVGLPLPFPLPSSTPETCFPRFPSNISSSLNSTINSDKYRSVPTSKRD
Sbjct:    9 SHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKHSTKLNGDQSPAYSSWIDIDSEPEDFDEDFNEKSDKTHHSELIKTKVENPKEVDNQCENQSDTLTNDSTCRNDSKIPFSLNFLMSKETTDTKLNQLNQSFLQNLDQLIRNPATIPFPGFIPQSPVTCFSKFSNHNPSDMKLNKPHFNVSDILTRMNPRECSSNIRSNTFSSSPFINMLNMLQSVSSFKSFSPLVGLPLPFPLPSSTPETCFPRFPSNISSSLNSTINSDKYRSVPTSKRD 482          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000009894.1 (SMESG000009894.1)

HSP 1 Score: 301.212 bits (770), Expect = 1.562e-97
Identity = 148/192 (77.08%), Postives = 172/192 (89.58%), Query Frame = 2
Query:  281 FAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDD 856
            F+ +QI KVCETLEE+GDI+RL RFLWS+P+ S LW SL+  E++ RARA+VAFH GNFRELY+++EK+ F K+SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LASATGLTPTQVGNWFKNRRQRDRAAA+K+ R +   ED+
Sbjct:   20 FSVEQITKVCETLEEAGDIDRLSRFLWSLPSFSSLWDSLSRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSEDE 211          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000020326.1 (SMESG000020326.1)

HSP 1 Score: 273.863 bits (699), Expect = 3.178e-88
Identity = 123/181 (67.96%), Postives = 145/181 (80.11%), Query Frame = 2
Query:  281 FAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 823
            F+  QI +VCE LEESGDI+RL RFLW + +   +W SL  HE++LRAR+IVAFH+GN+ ELY ILE H F   SH KLQ+ W +AHY EAEKLRGR LGPVDKYRVRK+ P+P TIWDG+Q+THCF+ERTR LL++ Y +DPYPNP KKRELA  TGLT TQVGNWFKNRRQRDRAA  +
Sbjct:   23 FSLSQICQVCENLEESGDIKRLARFLWCLSSCQSIWNSLLHHESILRARSIVAFHSGNYAELYFILENHRFSSQSHMKLQSFWFDAHYSEAEKLRGRALGPVDKYRVRKRHPLPSTIWDGQQRTHCFQERTRCLLKDCYSKDPYPNPNKKRELAIRTGLTATQVGNWFKNRRQRDRAALGR 203          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000005975.1 (SMESG000005975.1)

HSP 1 Score: 259.996 bits (663), Expect = 6.395e-80
Identity = 115/181 (63.54%), Postives = 146/181 (80.66%), Query Frame = 2
Query:  281 FAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 823
            F  +Q+A VCE L++ G I+RL RFLWS+P    L K    +E++L+A+A+VAFH GNF+ELY ILE H+F   +H KLQ LWL+AHY E+EK+RGRPLG V KYRVRKKFP+PRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA ATGLT TQV NWFKNRRQRDRA+ +K
Sbjct:  103 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQK----NESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 279          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIX61.793e-10469.01SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892][more]
SIX37.123e-10480.53SIX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:10889][more]
SIX25.103e-8466.12SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888][more]
SIX19.281e-8464.86SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887][more]
SIX41.077e-7354.37SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ceh-322.138e-7264.71Homeobox protein ceh-32 [Source:UniProtKB/Swiss-P... [more]
ceh-331.237e-6347.62Homeobox protein ceh-33 [Source:UniProtKB/Swiss-P... [more]
ceh-348.027e-4742.35Homeobox protein ceh-34 [Source:UniProtKB/Swiss-P... [more]
unc-392.019e-3736.81Homeobox protein unc-39 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Optix2.112e-8774.21gene:FBgn0025360 transcript:FBtr0088865[more]
Optix2.998e-8774.21gene:FBgn0025360 transcript:FBtr0329885[more]
so7.327e-8265.57gene:FBgn0003460 transcript:FBtr0088970[more]
Six46.244e-6655.87gene:FBgn0027364 transcript:FBtr0078274[more]
Six46.244e-6655.87gene:FBgn0027364 transcript:FBtr0078275[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six3a4.678e-10580.53SIX homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-990415-1... [more]
six3a4.678e-10580.53SIX homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-990415-1... [more]
six6b8.651e-10382.70SIX homeobox 6b [Source:ZFIN;Acc:ZDB-GENE-050522-3... [more]
six6a9.533e-10382.16SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
six6a9.533e-10382.16SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem1361.028e-10480.53transmembrane protein 136 [Source:Xenbase;Acc:XB-G... [more]
six62.005e-10383.78SIX homeobox 6 [Source:NCBI gene;Acc:100101705][more]
six29.779e-8465.57SIX homeobox 2 [Source:NCBI gene;Acc:100101784][more]
six11.333e-8364.86SIX homeobox 1 [Source:NCBI gene;Acc:100101702][more]
SIX42.282e-6651.21SIX homeobox 4 [Source:NCBI gene;Acc:100498150][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Six33.987e-10480.53sine oculis-related homeobox 3 [Source:MGI Symbol;... [more]
Six33.987e-10480.53sine oculis-related homeobox 3 [Source:MGI Symbol;... [more]
Six31.192e-10380.53sine oculis-related homeobox 3 [Source:MGI Symbol;... [more]
Six63.943e-10382.70sine oculis-related homeobox 6 [Source:MGI Symbol;... [more]
Six22.515e-8466.12sine oculis-related homeobox 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95475|SIX6_HUMAN8.610e-10469.01Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=S... [more]
sp|O93307|SIX6_CHICK2.228e-10383.24Homeobox protein SIX6 OS=Gallus gallus OX=9031 GN=... [more]
sp|O42406|SIX3_CHICK2.337e-10380.53Homeobox protein SIX3 OS=Gallus gallus OX=9031 GN=... [more]
sp|Q62233|SIX3_MOUSE2.789e-10380.53Homeobox protein SIX3 OS=Mus musculus OX=10090 GN=... [more]
sp|O95343|SIX3_HUMAN3.421e-10380.53Homeobox protein SIX3 OS=Homo sapiens OX=9606 GN=S... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3Z5W54.329e-10982.16Homeobox domain-containing protein OS=Lottia gigan... [more]
A0A2C9JWI77.172e-10982.70Homeobox domain-containing protein OS=Biomphalaria... [more]
A0A210Q4791.267e-10882.70Homeobox protein SIX6 OS=Mizuhopecten yessoensis O... [more]
A0A3S0ZP202.479e-10868.62Homeobox domain-containing protein OS=Elysia chlor... [more]
A0A1B4Z3F61.877e-10782.80Six3 homeodomain protein (Fragment) OS=Branchiosto... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six3a5.116e-10480.00SIX homeobox 3 [Source:NCBI gene;Acc:103025522][more]
six6b1.607e-10377.83homeobox protein SIX6 [Source:NCBI gene;Acc:103035... [more]
six77.480e-10275.14homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
six3b1.183e-9764.58homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
six1b3.668e-8558.18homeobox protein six1b [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002854.11.252e-10281.62pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 g... [more]
six1a1.027e-6864.94SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
ENSPMAT00000011157.12.278e-3792.06pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 ge... [more]
Six42.793e-2158.73pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 g... [more]
ENSPMAT00000001924.13.902e-2152.50pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOS82.011e-737.80Homeodomain-containing protein and putative transc... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330592.406e-10181.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343342.731e-8564.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429333.941e-7359.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310346.374e-7258.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334079.395e-5551.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six38.470e-10580.53SIX homeobox 3 [Source:NCBI gene;Acc:100144381][more]
six6a3.173e-10382.70SIX homeobox 6 [Source:NCBI gene;Acc:101154821][more]
six79.581e-10364.96homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
six31.445e-9780.33sine oculis homeobox homolog 3 [Source:NCBI gene;A... [more]
six1b3.493e-8556.41SIX homeobox 1 [Source:NCBI gene;Acc:101175523][more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017729.10.000e+099.18SMESG000017729.1[more]
SMESG000017729.10.000e+099.16SMESG000017729.1[more]
SMESG000009894.11.562e-9777.08SMESG000009894.1[more]
SMESG000020326.13.178e-8867.96SMESG000020326.1[more]
SMESG000005975.16.395e-8063.54SMESG000005975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015191 ID=SMED30015191|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1728bp
CTTCGCTTGGGATTCTCATGTTCGATTGGCAGTTGAAAGAATCCTGTGTG
TAATATACTCCCTTCTAGTTACGCATACCGACACAGTAGCATTCAGTTAT
ATATGAGTGGTGCTGATAAATCTATTCATAATATTATTAAAAATGTCTTT
GAATATCCCAAATATGCCGCCTATAATTAACAATATTAGTCATAACTTAC
AATCAATTTCCAACAGTCAAAATTCAACTCTGAATCCGAGTTCATTGTCA
AATCCAGGCCTCCAGGTATGGCCATTTCAGTTTGCTCCAGATCAAATTGC
TAAAGTCTGTGAAACTTTGGAAGAATCAGGGGACATCGAGCGATTAGGTA
GATTCCTTTGGTCAATGCCAACCAACAGTATATTGTGGAAGTCATTGAAT
GAACACGAAGCTTTGTTGAGAGCCAGAGCAATTGTAGCTTTCCACACAGG
GAATTTCCGAGAGCTTTATCATATATTAGAGAAACATCACTTTGAAAAGT
CCTCACACGCCAAACTTCAAGCACTGTGGCTAGAAGCTCATTATCAAGAA
GCTGAAAAACTTCGAGGTCGACCTTTAGGTCCAGTCGATAAATATCGAGT
AAGAAAGAAGTTTCCAATGCCAAGAACGATTTGGGATGGTGAACAAAAAA
CTCACTGTTTTAAAGAACGAACAAGAAGTCTTTTAAGAGAGTGGTATTTA
CAAGACCCATATCCTAATCCAGCAAAGAAAAGAGAATTGGCTTCTGCAAC
CGGCCTAACACCAACTCAAGTGGGTAATTGGTTTAAAAATCGACGCCAAA
GAGATCGAGCAGCCGCAAGTAAACATCGAAGAATTCTTTTATCAGATGAA
GATGATTCCAATCCAGAAAATCCAAATGAAAAACGCAAACATTCTACAAA
ACTCAACGGAGATCAATCTCCGGCGTATTCAAGTTGGATAGACATCGACA
GTGAGCCAGAAGACTTTGATGAAGATTTCAATGAGAAATCTGATAAAGCG
CATCATTCAGAATTGATTAAAACAAAAGTAGAAAATCCAAAAGAAGTTGA
TAACCAATGTGAAAGTCAATCAGACACACTTACTAATGATTCGACTTGTC
GAAACGATAGTAAAATTCCTTTTTCCTTAAATTTCTTAATGTCAAAAGAA
GCAACCGACACAAAATTAAATCAGTTAAATCAATCATTTCTTCAAAACCT
TGACCAGTTGATTCGAAATCCAGCCACAATACCGTTCCCAGGTTTCATTC
CCCAATCTCCAGTGACGTGTTTCTCAAAACTCAGCAATCATAATCCGAGT
GACATGAAATTAAACAAACCCCATTTCAACGTTTCTGACATATTGACAAG
AATGAACCCCAGAGAATGCTCCAGTAATATTAGGTCAAATACTTTCTCAT
CGTCCCCATTTATTAACATGCTAAATATGCTTCAATCAGTTTCTTCTTTT
AAATCATTTTCTCCATTAGTCGGCTTACCTCTTCCCTTTCCTCTTCCATC
TTCAACACCCGAAACATGTTTCCCTCGATTTCCATCAAATATTTCATCGT
CTTTAAACTCTACTATCAACAGTGACAAATATCGATCGGTTCCAACTTCA
AAGAGAGACTAACTCTGTTAATATTCTTTTATTATAATTTTTTCTTTCTT
TTTATCCCCATTAATCTCTACAAATATATAAATAAATTTAATTTATATAT
ACATATGCATATAAAAAATGATTTGTTT
back to top

protein sequence of SMED30015191-orf-1

>SMED30015191-orf-1 ID=SMED30015191-orf-1|Name=SMED30015191-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MSLNIPNMPPIINNISHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPD
QIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAF
HTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDK
YRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELA
SATGLTPTQVGNWFKNRRQRDRAAASKHRRILLSDEDDSNPENPNEKRKH
STKLNGDQSPAYSSWIDIDSEPEDFDEDFNEKSDKAHHSELIKTKVENPK
EVDNQCESQSDTLTNDSTCRNDSKIPFSLNFLMSKEATDTKLNQLNQSFL
QNLDQLIRNPATIPFPGFIPQSPVTCFSKLSNHNPSDMKLNKPHFNVSDI
LTRMNPRECSSNIRSNTFSSSPFINMLNMLQSVSSFKSFSPLVGLPLPFP
LPSSTPETCFPRFPSNISSSLNSTINSDKYRSVPTSKRD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002028dorsal-ventral muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR031701SIX1_SD
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0000980RNA polymerase II distal enhancer sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001205transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding
GO:0001222transcription corepressor binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003705transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
GO:0003713transcription coactivator activity
GO:0005102signaling receptor binding
GO:0005515protein binding
GO:0042826histone deacetylase binding
Vocabulary: biological process
TermDefinition
GO:0000060protein import into nucleus, translocation
GO:0043010camera-type eye development
GO:0045665negative regulation of neuron differentiation
GO:0045892negative regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048512circadian behavior
GO:0060235lens induction in camera-type eye
GO:0061074regulation of neural retina development
GO:0070306lens fiber cell differentiation
GO:0097402neuroblast migration
GO:1901987regulation of cell cycle phase transition
GO:1902692regulation of neuroblast proliferation
GO:1902742apoptotic process involved in development
GO:1990086lens fiber cell apoptotic process
GO:2000177regulation of neural precursor cell proliferation
GO:0001654eye development
GO:0002070epithelial cell maturation
GO:0002088lens development in camera-type eye
GO:0003404optic vesicle morphogenesis
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0006606protein import into nucleus
GO:0007275multicellular organism development
GO:0007420brain development
GO:0009946proximal/distal axis specification
GO:0014016neuroblast differentiation
GO:0021536diencephalon development
GO:0021537telencephalon development
GO:0021797forebrain anterior/posterior pattern specification
GO:0021798forebrain dorsal/ventral pattern formation
GO:0021846cell proliferation in forebrain
GO:0021978telencephalon regionalization
GO:0021983pituitary gland development
GO:0030178negative regulation of Wnt signaling pathway
GO:0042127regulation of cell proliferation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 167..228
e-value: 7.2E-15
score: 65.4
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 171..222
e-value: 5.3E-12
score: 45.4
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 164..224
score: 14.592
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 168..222
e-value: 6.22145E-15
score: 66.8832
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 165..231
e-value: 5.7E-17
score: 63.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 215..254
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 210..262
NoneNo IPR availablePANTHERPTHR10390:SF33PROTEIN OPTIXcoord: 18..353
NoneNo IPR availablePANTHERPTHR10390HOMEOBOX PROTEIN SIXcoord: 18..353
IPR031701Homeobox protein SIX1, N-terminal SD domainPFAMPF16878SIX1_SDcoord: 47..161
e-value: 2.3E-46
score: 156.9
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 164..228