Protein kinase C

Overview
NameProtein kinase C
Smed IDSMED30015172
Length (bp)2416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase C (SMED30015172) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase C (SMED30015172) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase C (SMED30015172) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase C (SMED30015172) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015172

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015172SMESG000032747.1 SmedASXL_012301SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015172SMESG000032749.1 SMESG000032747.1 SmedASXL_012300SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30015172SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015172SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30015172SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30015172SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015172SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v6_4244_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015172SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 338/693 (48.77%), Postives = 462/693 (66.67%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDGDDYFD-PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +  +D  + P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++++        + Q  + ++D   S+  + +  +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK++NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + R ++AS  P        ++      +  +    Y ++W+   +         I +F+  KVLGKGSFGKVLLGE+K + G+ FAIKALKK++VL DDDV+CTMVE+RVL L   + FLT L  TFQ+  HLFF+ME+L GGDLM+HIQ  GRF + +A FY++EI+C LQFLHS  IIYRDLKLDN+L+  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG++    G+I+ H FF  I+W  LE +++ PP  PK+KSP D S FD +F  EK +L+ +DK L+ +M+Q  F GFSF NP +
Sbjct:    4 FLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKVLM--------SVQYFLEDVDCKQSMR-SEDEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCN-------INNFIFHKVLGKGSFGKVLLGELKGR-GEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVT----GNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKF 670          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 338/693 (48.77%), Postives = 462/693 (66.67%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDGDDYFD-PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +  +D  + P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++++        + Q  + ++D   S+  + +  +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK++NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + R ++AS  P        ++      +  +    Y ++W+   +         I +F+  KVLGKGSFGKVLLGE+K + G+ FAIKALKK++VL DDDV+CTMVE+RVL L   + FLT L  TFQ+  HLFF+ME+L GGDLM+HIQ  GRF + +A FY++EI+C LQFLHS  IIYRDLKLDN+L+  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG++    G+I+ H FF  I+W  LE +++ PP  PK+KSP D S FD +F  EK +L+ +DK L+ +M+Q  F GFSF NP +
Sbjct:    4 FLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKVLM--------SVQYFLEDVDCKQSMR-SEDEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCN-------INNFIFHKVLGKGSFGKVLLGELKGR-GEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVT----GNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKF 670          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 338/693 (48.77%), Postives = 462/693 (66.67%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDGDDYFD-PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +  +D  + P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++++        + Q  + ++D   S+  + +  +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK++NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + R ++AS  P        ++      +  +    Y ++W+   +         I +F+  KVLGKGSFGKVLLGE+K + G+ FAIKALKK++VL DDDV+CTMVE+RVL L   + FLT L  TFQ+  HLFF+ME+L GGDLM+HIQ  GRF + +A FY++EI+C LQFLHS  IIYRDLKLDN+L+  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG++    G+I+ H FF  I+W  LE +++ PP  PK+KSP D S FD +F  EK +L+ +DK L+ +M+Q  F GFSF NP +
Sbjct:    4 FLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKVLM--------SVQYFLEDVDCKQSMR-SEDEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCN-------INNFIFHKVLGKGSFGKVLLGELKGR-GEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVT----GNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKF 670          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 338/693 (48.77%), Postives = 462/693 (66.67%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDGDDYFD-PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +  +D  + P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++++        + Q  + ++D   S+  + +  +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK++NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + R ++AS  P        ++      +  +    Y ++W+   +         I +F+  KVLGKGSFGKVLLGE+K + G+ FAIKALKK++VL DDDV+CTMVE+RVL L   + FLT L  TFQ+  HLFF+ME+L GGDLM+HIQ  GRF + +A FY++EI+C LQFLHS  IIYRDLKLDN+L+  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG++    G+I+ H FF  I+W  LE +++ PP  PK+KSP D S FD +F  EK +L+ +DK L+ +M+Q  F GFSF NP +
Sbjct:    4 FLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKVLM--------SVQYFLEDVDCKQSMR-SEDEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCN-------INNFIFHKVLGKGSFGKVLLGELKGR-GEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVT----GNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKF 670          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 338/693 (48.77%), Postives = 462/693 (66.67%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDGDDYFD-PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +  +D  + P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++++        + Q  + ++D   S+  + +  +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK++NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + R ++AS  P        ++      +  +    Y ++W+   +         I +F+  KVLGKGSFGKVLLGE+K + G+ FAIKALKK++VL DDDV+CTMVE+RVL L   + FLT L  TFQ+  HLFF+ME+L GGDLM+HIQ  GRF + +A FY++EI+C LQFLHS  IIYRDLKLDN+L+  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG++    G+I+ H FF  I+W  LE +++ PP  PK+KSP D S FD +F  EK +L+ +DK L+ +M+Q  F GFSF NP +
Sbjct:    4 FLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKVLM--------SVQYFLEDVDCKQSMR-SEDEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCN-------INNFIFHKVLGKGSFGKVLLGELKGR-GEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVT----GNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKF 670          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: tpa-1 (Protein kinase C-like 1 [Source:UniProtKB/Swiss-Prot;Acc:P34722])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 323/686 (47.08%), Postives = 457/686 (66.62%), Query Frame = 1
Query:  193 VNIKDA-KYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEM-NRYEQLWDTVQETERM--------------MPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE--CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLT-LTDKQLLSTMNQDIFKGFSFTNPAYN 2193
            VN+K+  + N E +LV   Q+KK +Y +      D     GRI+Q V+M     V+ +A + +E +   C  +   +  +WI+ +P+GR++     +  A +    VE  ++   N         GI RRRGA++H ++H I+GH+F+A FFRQP +CS CS+F+WGLNKQGYQCQLC  AVHKKCH K++ +CPGSA  ++ET  L+ERF +++PH+FK YN+ SPTFCDHCG +LYGL KQGL+C+ CN  CH KCER +  LCGVNQK L+E+  E+++  ++   TAS  P +   + + +      +  N++ N ++    +V+E +                + ++ +  F LLKVLGKGSFGKV+L E+K K  + +A+K LKK+++LEDDD +CT +ERRVL L  +  FL +L  +FQ+  +LFF+MEYL GGDLM HIQQ  +F   + RFY+ EI+ ALQFLH++ IIYRDLKLDN+L+  DG+IK+ADFGM K     +   A+TFCGTPDYI+PEI++G  YNEAVD+WSFGVL+YEML+GQSPF GE ED+L  SI  + P++P+++++EA +CL  LF RNP  RLGM  CP G IR H FF  +DW++ E +Q+PPP  P +KS +D S FD DFT EK  LT + DK LL++++ + F  FS+TNP ++
Sbjct:   35 VNVKEKIEVNGESRLV---QKKKTLYPEWEK-CWDTAVAEGRILQIVLMFNQTPVV-EATMRLEDIISKCKSD--AITHIWINTKPNGRILAQTRHLKNAPDDDHPVEDIMTSRSNSG------PGIQRRRGAIKHARVHEIRGHQFVATFFRQPHFCSLCSDFMWGLNKQGYQCQLCSAAVHKKCHEKVIMQCPGSAKNTKETMALKERFKVDIPHRFKTYNFKSPTFCDHCGSMLYGLFKQGLRCEVCNVACHHKCERLMSNLCGVNQKQLSEMYHEIKRGTHA---TASCPPNIANLHLNGETSKNNGSLPNKLKNLFKSHQYSVEEQKETDEYMDNIWGGGDGPVKKFALPHFNLLKVLGKGSFGKVMLVELKGK-NEFYAMKCLKKDVILEDDDTECTYIERRVLILASQCPFLCQLFCSFQTNEYLFFVMEYLNGGDLMHHIQQIKKFDEARTRFYACEIVVALQFLHTNNIIYRDLKLDNVLLDCDGHIKLADFGMAKTEMNRENGMASTFCGTPDYISPEIIKGQLYNEAVDFWSFGVLMYEMLVGQSPFHGEGEDELFDSILNERPYFPKTISKEAAKCLSALFDRNPNTRLGMPECPDGPIRQHCFFRGVDWKRFENRQVPPPFKPNIKSNSDASNFDDDFTNEKAALTPVHDKNLLASIDPEAFLNFSYTNPHFS 703          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: tpa-1 (Protein kinase C-like 1 [Source:UniProtKB/Swiss-Prot;Acc:P34722])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 292/561 (52.05%), Postives = 400/561 (71.30%), Query Frame = 1
Query:  565 GIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEM-NRYEQLWDTVQETERM--------------MPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE--CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLT-LTDKQLLSTMNQDIFKGFSFTNPAYN 2193
            GI RRRGA++H ++H I+GH+F+A FFRQP +CS CS+F+WGLNKQGYQCQLC  AVHKKCH K++ +CPGSA  ++ET  L+ERF +++PH+FK YN+ SPTFCDHCG +LYGL KQGL+C+ CN  CH KCER +  LCGVNQK L+E+  E+++  ++   TAS  P +   + + +      +  N++ N ++    +V+E +                + ++ +  F LLKVLGKGSFGKV+L E+K K  + +A+K LKK+++LEDDD +CT +ERRVL L  +  FL +L  +FQ+  +LFF+MEYL GGDLM HIQQ  +F   + RFY+ EI+ ALQFLH++ IIYRDLKLDN+L+  DG+IK+ADFGM K     +   A+TFCGTPDYI+PEI++G  YNEAVD+WSFGVL+YEML+GQSPF GE ED+L  SI  + P++P+++++EA +CL  LF RNP  RLGM  CP G IR H FF  +DW++ E +Q+PPP  P +KS +D S FD DFT EK  LT + DK LL++++ + F  FS+TNP ++
Sbjct:   10 GIQRRRGAIKHARVHEIRGHQFVATFFRQPHFCSLCSDFMWGLNKQGYQCQLCSAAVHKKCHEKVIMQCPGSAKNTKETMALKERFKVDIPHRFKTYNFKSPTFCDHCGSMLYGLFKQGLRCEVCNVACHHKCERLMSNLCGVNQKQLSEMYHEIKRGTHA---TASCPPNIANLHLNGETSKNNGSLPNKLKNLFKSHQYSVEEQKETDEYMDNIWGGGDGPVKKFALPHFNLLKVLGKGSFGKVMLVELKGK-NEFYAMKCLKKDVILEDDDTECTYIERRVLILASQCPFLCQLFCSFQTNEYLFFVMEYLNGGDLMHHIQQIKKFDEARTRFYACEIVVALQFLHTNNIIYRDLKLDNVLLDCDGHIKLADFGMAKTEMNRENGMASTFCGTPDYISPEIIKGQLYNEAVDFWSFGVLMYEMLVGQSPFHGEGEDELFDSILNERPYFPKTISKEAAKCLSALFDRNPNTRLGMPECPDGPIRQHCFFRGVDWKRFENRQVPPPFKPNIKSNSDASNFDDDFTNEKAALTPVHDKNLLASIDPEAFLNFSYTNPHFS 566          

HSP 2 Score: 51.9878 bits (123), Expect = 1.348e-6
Identity = 28/83 (33.73%), Postives = 39/83 (46.99%), Query Frame = 1
Query:  775 GSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLA 1023
            G  ++ R   I   R +    H+F    +  P FC  C   ++GL KQG +CQ C+   HKKC  KV   C  + K   E +A
Sbjct:    8 GPGIQRRRGAIKHARVHEIRGHQFVATFFRQPHFCSLCSDFMWGLNKQGYQCQLCSAAVHKKCHEKVIMQCPGSAKNTKETMA 90          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: tpa-1 (Protein kinase C-like 1 [Source:UniProtKB/Swiss-Prot;Acc:P34722])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 292/561 (52.05%), Postives = 400/561 (71.30%), Query Frame = 1
Query:  565 GIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEM-NRYEQLWDTVQETERM--------------MPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE--CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLT-LTDKQLLSTMNQDIFKGFSFTNPAYN 2193
            GI RRRGA++H ++H I+GH+F+A FFRQP +CS CS+F+WGLNKQGYQCQLC  AVHKKCH K++ +CPGSA  ++ET  L+ERF +++PH+FK YN+ SPTFCDHCG +LYGL KQGL+C+ CN  CH KCER +  LCGVNQK L+E+  E+++  ++   TAS  P +   + + +      +  N++ N ++    +V+E +                + ++ +  F LLKVLGKGSFGKV+L E+K K  + +A+K LKK+++LEDDD +CT +ERRVL L  +  FL +L  +FQ+  +LFF+MEYL GGDLM HIQQ  +F   + RFY+ EI+ ALQFLH++ IIYRDLKLDN+L+  DG+IK+ADFGM K     +   A+TFCGTPDYI+PEI++G  YNEAVD+WSFGVL+YEML+GQSPF GE ED+L  SI  + P++P+++++EA +CL  LF RNP  RLGM  CP G IR H FF  +DW++ E +Q+PPP  P +KS +D S FD DFT EK  LT + DK LL++++ + F  FS+TNP ++
Sbjct:   10 GIQRRRGAIKHARVHEIRGHQFVATFFRQPHFCSLCSDFMWGLNKQGYQCQLCSAAVHKKCHEKVIMQCPGSAKNTKETMALKERFKVDIPHRFKTYNFKSPTFCDHCGSMLYGLFKQGLRCEVCNVACHHKCERLMSNLCGVNQKQLSEMYHEIKRGTHA---TASCPPNIANLHLNGETSKNNGSLPNKLKNLFKSHQYSVEEQKETDEYMDNIWGGGDGPVKKFALPHFNLLKVLGKGSFGKVMLVELKGK-NEFYAMKCLKKDVILEDDDTECTYIERRVLILASQCPFLCQLFCSFQTNEYLFFVMEYLNGGDLMHHIQQIKKFDEARTRFYACEIVVALQFLHTNNIIYRDLKLDNVLLDCDGHIKLADFGMAKTEMNRENGMASTFCGTPDYISPEIIKGQLYNEAVDFWSFGVLMYEMLVGQSPFHGEGEDELFDSILNERPYFPKTISKEAAKCLSALFDRNPNTRLGMPECPDGPIRQHCFFRGVDWKRFENRQVPPPFKPNIKSNSDASNFDDDFTNEKAALTPVHDKNLLASIDPEAFLNFSYTNPHFS 566          

HSP 2 Score: 51.9878 bits (123), Expect = 1.348e-6
Identity = 28/83 (33.73%), Postives = 39/83 (46.99%), Query Frame = 1
Query:  775 GSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLA 1023
            G  ++ R   I   R +    H+F    +  P FC  C   ++GL KQG +CQ C+   HKKC  KV   C  + K   E +A
Sbjct:    8 GPGIQRRRGAIKHARVHEIRGHQFVATFFRQPHFCSLCSDFMWGLNKQGYQCQLCSAAVHKKCHEKVIMQCPGSAKNTKETMA 90          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 535.413 bits (1378), Expect = 1.166e-180
Identity = 285/650 (43.85%), Postives = 409/650 (62.92%), Query Frame = 1
Query:  310 GRIIQFVVMKR----PNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSD--SLNLARNIPEFGGI---ARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRET--KILQE----RFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRY-----CIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYG--SIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            G+ I F V       P+  +A+  +  + L      + G    +W+DL PHG+L V++           M   ++ D  S N  R   E        +RRGA+R +KIH + GH+F+A F RQPT+C+ C EF+WG+ KQGYQCQ+C   VHK+CH  ++ KCPG+  ++ E   K +QE    RFNIN+PH+F +++Y  PTFCDHCG +LYGLI QGL+C  C  N HK+C+R V   CG+N K +A  LA++    +     +   P++  + +++         +  + +  +  D+   + R   +       I DF  +KVLGKGSFGKV+L E K    +++AIK LKK+++++DDDV+CTM E+R+L+L  +H FLT LHS+FQ++  LFF+MEY+ GGDLMF IQ+  +F   +ARFY++E+ CALQFLH + +IYRDLKLDNIL+  +G+ ++ADFGMCKE  ++   T TFCGTPDYIAPEI++ + Y  +VDWW+ GVL+YEM+ GQ PF  ++EDDL  +I  D   YP  L++EA+  L+   ++N   RLG      G  +IR H FF EIDW+ LE +Q+ PP  PK+KS  D + FDSDFT E+P LT +D  ++  +NQD F+GFSF NP +
Sbjct:   75 GKAIGFSVFHSCVMPPDDFVANTRIAFDQL------KIGSANDIWVDLEPHGQLHVVV----------EMHGTNVEDVHSHNKTRVFKERTNAFNDRQRRGAMR-RKIHEVTGHKFMALFLRQPTFCAHCKEFIWGIGKQGYQCQICTVVVHKRCHEDVVWKCPGNKADAVEELGKEIQETGAGRFNINMPHRFSVHSYKRPTFCDHCGSMLYGLINQGLQCSTCKLNVHKRCQRNVANNCGINAKQMAAELAQLGLTGDKMSIRSKKKPSIMTDTSTDISGSSNSENSGYLQQISED-DSGTTSSRSASKVPGGTLSIHDFTFMKVLGKGSFGKVMLAERKGT-DEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAEGHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAGQPPFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAINQDEFRGFSFINPHF 705          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 535.413 bits (1378), Expect = 6.171e-180
Identity = 285/650 (43.85%), Postives = 409/650 (62.92%), Query Frame = 1
Query:  310 GRIIQFVVMKR----PNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSD--SLNLARNIPEFGGI---ARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRET--KILQE----RFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRY-----CIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYG--SIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            G+ I F V       P+  +A+  +  + L      + G    +W+DL PHG+L V++           M   ++ D  S N  R   E        +RRGA+R +KIH + GH+F+A F RQPT+C+ C EF+WG+ KQGYQCQ+C   VHK+CH  ++ KCPG+  ++ E   K +QE    RFNIN+PH+F +++Y  PTFCDHCG +LYGLI QGL+C  C  N HK+C+R V   CG+N K +A  LA++    +     +   P++  + +++         +  + +  +  D+   + R   +       I DF  +KVLGKGSFGKV+L E K    +++AIK LKK+++++DDDV+CTM E+R+L+L  +H FLT LHS+FQ++  LFF+MEY+ GGDLMF IQ+  +F   +ARFY++E+ CALQFLH + +IYRDLKLDNIL+  +G+ ++ADFGMCKE  ++   T TFCGTPDYIAPEI++ + Y  +VDWW+ GVL+YEM+ GQ PF  ++EDDL  +I  D   YP  L++EA+  L+   ++N   RLG      G  +IR H FF EIDW+ LE +Q+ PP  PK+KS  D + FDSDFT E+P LT +D  ++  +NQD F+GFSF NP +
Sbjct:  131 GKAIGFSVFHSCVMPPDDFVANTRIAFDQL------KIGSANDIWVDLEPHGQLHVVV----------EMHGTNVEDVHSHNKTRVFKERTNAFNDRQRRGAMR-RKIHEVTGHKFMALFLRQPTFCAHCKEFIWGIGKQGYQCQICTVVVHKRCHEDVVWKCPGNKADAVEELGKEIQETGAGRFNINMPHRFSVHSYKRPTFCDHCGSMLYGLINQGLQCSTCKLNVHKRCQRNVANNCGINAKQMAAELAQLGLTGDKMSIRSKKKPSIMTDTSTDISGSSNSENSGYLQQISED-DSGTTSSRSASKVPGGTLSIHDFTFMKVLGKGSFGKVMLAERKGT-DEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAEGHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAGQPPFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAINQDEFRGFSFINPHF 761          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkcdelta (gene:FBgn0259680 transcript:FBtr0299936)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 293/554 (52.89%), Postives = 385/554 (69.49%), Query Frame = 1
Query:  568 IARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETER------MMPR---YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCK-ECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAYNMN 2199
            I  RRGA++HQK H I GH F+AKFFRQPT+C+FC+ FLWG  KQGYQC +C   VHKKCH K+L KC GS   S  T +L+ERF I++PH+FK + +MSPTFCDHCG L+ G   QGLKC+EC+ NCHKKCER    LCGVNQKL+ E L  V++     R++ S  P++   N + +I+     A+ E +     +   Q++ R      ++PR   Y ++DF  L VLGKGSFGKVLL E++      +AIK LKK++VLEDDDVD T++ER+VLALG +H +L  L  TFQ+ SHLFF+MEYL GGDLMFHIQ++GRF+ ++ARFY +EII  L+FLH   IIYRDLKLDN+L+  +G+++IADFGMCK +   +  A +FCGTPDY+APEI++G  YN+ VDWWSFGVLLYEMLIGQSPF G DED+L  SIC + P +P  ++ EA   L+ L  ++   R+G    P G I  H FF  IDW  LE +QI PP  P++K P D  YFD  FT E+ +LT  DK++L++M+Q  F GF++TNP   ++
Sbjct:  127 ITNRRGAIKHQKTHDINGHRFVAKFFRQPTFCAFCNLFLWGFGKQGYQCIICQTVVHKKCHDKLLGKCSGSVFTSASTILLRERFKIDMPHRFKPHTFMSPTFCDHCGSLMGGFFIQGLKCEECDVNCHKKCERLTANLCGVNQKLIVEALNHVKRGAREARDSPSTPPSL---NPAYKIE-----ASEEHDETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTT-YYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQKQFHGFTYTNPHITLD 671          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkcdelta (gene:FBgn0259680 transcript:FBtr0299937)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 293/554 (52.89%), Postives = 385/554 (69.49%), Query Frame = 1
Query:  568 IARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETER------MMPR---YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCK-ECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAYNMN 2199
            I  RRGA++HQK H I GH F+AKFFRQPT+C+FC+ FLWG  KQGYQC +C   VHKKCH K+L KC GS   S  T +L+ERF I++PH+FK + +MSPTFCDHCG L+ G   QGLKC+EC+ NCHKKCER    LCGVNQKL+ E L  V++     R++ S  P++   N + +I+     A+ E +     +   Q++ R      ++PR   Y ++DF  L VLGKGSFGKVLL E++      +AIK LKK++VLEDDDVD T++ER+VLALG +H +L  L  TFQ+ SHLFF+MEYL GGDLMFHIQ++GRF+ ++ARFY +EII  L+FLH   IIYRDLKLDN+L+  +G+++IADFGMCK +   +  A +FCGTPDY+APEI++G  YN+ VDWWSFGVLLYEMLIGQSPF G DED+L  SIC + P +P  ++ EA   L+ L  ++   R+G    P G I  H FF  IDW  LE +QI PP  P++K P D  YFD  FT E+ +LT  DK++L++M+Q  F GF++TNP   ++
Sbjct:  127 ITNRRGAIKHQKTHDINGHRFVAKFFRQPTFCAFCNLFLWGFGKQGYQCIICQTVVHKKCHDKLLGKCSGSVFTSASTILLRERFKIDMPHRFKPHTFMSPTFCDHCGSLMGGFFIQGLKCEECDVNCHKKCERLTANLCGVNQKLIVEALNHVKRGAREARDSPSTPPSL---NPAYKIE-----ASEEHDETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTT-YYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQKQFHGFTYTNPHITLD 671          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc98E (gene:FBgn0003093 transcript:FBtr0339149)

HSP 1 Score: 522.316 bits (1344), Expect = 4.955e-175
Identity = 292/740 (39.46%), Postives = 433/740 (58.51%), Query Frame = 1
Query:  115 GFIRIKICDIE----KDF----------IDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQ--ERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAE--VRQDQNSRRETASISPTVTVNN----------------------------TSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYC-IEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            G ++IK+C+       DF          +  +   DPY  +++ ++ ++      + +    PV+ +     V    N    +       P+  +A+  +  E L +     +  +  LW++L P G++ V++  +   T++    E  +  ++ + +   E  G   RR     +++H + GH+F+A F RQPT+CS C EF+WG+ KQGYQCQ+C   VHKKCH+ +++KCPG   E  + +++   +RFN+N+PH+F +++Y   TFCDHCG LLYGLIKQGL+C+ C  N HK+C++ V   CG+N K +AE+L+   +  D+   R +  ++     +N                            TS       +N+++ M+        V  T    P  C + DF  +KVLGKGSFGKV+L E K    +++AIK LKK+ +++DDDVDCTM E+R+LAL   H FLT LHS FQ+   LFF+MEY+ GGDLMF IQ+  RF   +A FY++E+  ALQFLH+H +IYRDLKLDNIL+  +G+ K+ADFGMCKE   + M  TTFCGTPDYIAPEI++   Y  +VDWW+ GVL+YEM+ GQ PF  ++ED+L  SI +D   YP  L+REA+  L+   ++NP  RLG  T     IR H FFA++DW++LE + I PP  PK+K+P D + FD++FT E P LT    +++  +NQD F GFSF NP +
Sbjct:    4 GKLQIKVCEASGLRPTDFQKRHNLTFGKLADEQLIDPYVSIDVDESHFDRATTRPKTFD---PVWNEQFVHDVTNVSNINLTVFHDAALPPDDFVANCIISFEDLMQ----SETAVQDLWVNLEPQGKIHVIIE-LKNRTDKAK-AEAVVEHTVAVNKEFKERAGF-NRRRGAMRRRVHQVNGHKFMATFLRQPTFCSHCREFIWGIGKQGYQCQVCTLVVHKKCHLSVVSKCPGMRDEPAKVEMVPAGQRFNVNLPHRFVVHSYKRFTFCDHCGSLLYGLIKQGLQCETCGMNVHKRCQKNVANTCGINTKQMAEILSSLGISPDKQQPRRSKYLNQQGGEDNYGASLGADGDGAPGQSFRSCALSVDSLATSTTTMTSGYNSSSCMSLAVTGSGGVGATGETRPGKCSLLDFNFIKVLGKGSFGKVMLAEKKGT-DEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRLG-CTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNEVVRCINQDEFAGFSFVNPKF 731          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc98E (gene:FBgn0003093 transcript:FBtr0339150)

HSP 1 Score: 519.62 bits (1337), Expect = 6.923e-174
Identity = 293/741 (39.54%), Postives = 430/741 (58.03%), Query Frame = 1
Query:  115 GFIRIKICDIE----KDF----------IDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESR---ETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAE--VRQDQNSRRETASISPTVTVNN----------------------------TSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYC-IEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            G ++IK+C+       DF          +  +   DPY  +++ ++ ++      + +    PV+ +     V    N    +       P+  +A+  +  E L +     +  +  LW++L P G++ V++  +   T++    E  +  ++ + +   E  G   RR     +++H + GH+F+A F RQPT+CS C EF+WG+ KQGYQCQ+C   VHKKCH+ +++KCPG   E     E     +RFN+N+PH+F +++Y   TFCDHCG LLYGLIKQGL+C+ C  N HK+C++ V   CG+N K +AE+L+   +  D+   R +  ++     +N                            TS       +N+++ M+        V  T    P  C + DF  +KVLGKGSFGKV+L E K    +++AIK LKK+ +++DDDVDCTM E+R+LAL   H FLT LHS FQ+   LFF+MEY+ GGDLMF IQ+  RF   +A FY++E+  ALQFLH+H +IYRDLKLDNIL+  +G+ K+ADFGMCKE   + M  TTFCGTPDYIAPEI++   Y  +VDWW+ GVL+YEM+ GQ PF  ++ED+L  SI +D   YP  L+REA+  L+   ++NP  RLG  T     IR H FFA++DW++LE + I PP  PK+K+P D + FD++FT E P LT    +++  +NQD F GFSF NP +
Sbjct:    4 GKLQIKVCEASGLRPTDFQKRHNLTFGKLADEQLIDPYVSIDVDESHFDRATTRPKTFD---PVWNEQFVHDVTNVSNINLTVFHDAALPPDDFVANCIISFEDLMQ----SETAVQDLWVNLEPQGKIHVIIE-LKNRTDKAK-AEAVVEHTVAVNKEFKERAGF-NRRRGAMRRRVHQVNGHKFMATFLRQPTFCSHCREFIWGIGKQGYQCQVCTLVVHKKCHLSVVSKCPGMRDEQPAKVEMVPAGQRFNVNLPHRFVVHSYKRFTFCDHCGSLLYGLIKQGLQCETCGMNVHKRCQKNVANTCGINTKQMAEILSSLGISPDKQQPRRSKYLNQQGGEDNYGASLGADGDGAPGQSFRSCALSVDSLATSTTTMTSGYNSSSCMSLAVTGSGGVGATGETRPGKCSLLDFNFIKVLGKGSFGKVMLAEKKGT-DEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRLG-CTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNEVVRCINQDEFAGFSFVNPKF 732          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc98E (gene:FBgn0003093 transcript:FBtr0085359)

HSP 1 Score: 519.62 bits (1337), Expect = 6.923e-174
Identity = 293/741 (39.54%), Postives = 430/741 (58.03%), Query Frame = 1
Query:  115 GFIRIKICDIE----KDF----------IDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESR---ETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAE--VRQDQNSRRETASISPTVTVNN----------------------------TSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYC-IEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            G ++IK+C+       DF          +  +   DPY  +++ ++ ++      + +    PV+ +     V    N    +       P+  +A+  +  E L +     +  +  LW++L P G++ V++  +   T++    E  +  ++ + +   E  G   RR     +++H + GH+F+A F RQPT+CS C EF+WG+ KQGYQCQ+C   VHKKCH+ +++KCPG   E     E     +RFN+N+PH+F +++Y   TFCDHCG LLYGLIKQGL+C+ C  N HK+C++ V   CG+N K +AE+L+   +  D+   R +  ++     +N                            TS       +N+++ M+        V  T    P  C + DF  +KVLGKGSFGKV+L E K    +++AIK LKK+ +++DDDVDCTM E+R+LAL   H FLT LHS FQ+   LFF+MEY+ GGDLMF IQ+  RF   +A FY++E+  ALQFLH+H +IYRDLKLDNIL+  +G+ K+ADFGMCKE   + M  TTFCGTPDYIAPEI++   Y  +VDWW+ GVL+YEM+ GQ PF  ++ED+L  SI +D   YP  L+REA+  L+   ++NP  RLG  T     IR H FFA++DW++LE + I PP  PK+K+P D + FD++FT E P LT    +++  +NQD F GFSF NP +
Sbjct:    4 GKLQIKVCEASGLRPTDFQKRHNLTFGKLADEQLIDPYVSIDVDESHFDRATTRPKTFD---PVWNEQFVHDVTNVSNINLTVFHDAALPPDDFVANCIISFEDLMQ----SETAVQDLWVNLEPQGKIHVIIE-LKNRTDKAK-AEAVVEHTVAVNKEFKERAGF-NRRRGAMRRRVHQVNGHKFMATFLRQPTFCSHCREFIWGIGKQGYQCQVCTLVVHKKCHLSVVSKCPGMRDEQPAKVEMVPAGQRFNVNLPHRFVVHSYKRFTFCDHCGSLLYGLIKQGLQCETCGMNVHKRCQKNVANTCGINTKQMAEILSSLGISPDKQQPRRSKYLNQQGGEDNYGASLGADGDGAPGQSFRSCALSVDSLATSTTTMTSGYNSSSCMSLAVTGSGGVGATGETRPGKCSLLDFNFIKVLGKGSFGKVMLAEKKGT-DEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRLG-CTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNEVVRCINQDEFAGFSFVNPKF 732          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcdb (protein kinase C, delta b [Source:ZFIN;Acc:ZDB-GENE-111129-1])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 348/674 (51.63%), Postives = 458/674 (67.95%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTV----QETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            P+  + +K++     GK +   QRK  +Y      T DAH   GR+IQ V+MK     L++A V +  + E C  +KG G    W+DL+P G++M   + V    E     +LD   S+  A++      I RRRGA++  K+H I+ HEF A FF+QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK  NYMSPTFCDHCG LL+G++KQGLKC++C  N H KC+ KV  LCG+NQKLLAE L +V    +++R   ++S         + +     + + E ++Y + WD        T     R  + DFV  KVLGKGSFGKV+L E+K K GQ FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT L+ TFQS  HLFF+MEYL GGDLMFHIQ  GRF + +A FY++EIIC LQ+LHS  I+YRDLKLDN+++  DG+IKIADFGMCKE    E +ATTFCGTPDYIAPEI+ G  Y+ +VDWWSFGVLLYEMLIGQSPF+G+DED+L  SI  D PHYPR +T+EA   L++LF R+P  RLG+     G+IRGH+FF  I+W  LE +++ PP  PK+KS +DCS FD +F  EKP+L+ +DK L+ +M+Q  F GFSF NP
Sbjct:   24 PFCAIKMKESLSTERGKTL--VQRKPTMYPAWKS-TFDAHIYEGRVIQVVLMKTAEEALSEATVGVSVIAERC--KKGNGHAEFWVDLQPSGKVM---MSVQFFVED---TDLDSKASMT-AKDDDGILTINRRRGAIKQAKVHFIKNHEFTATFFKQPTFCSVCREFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTMFQKERFKIDMPHRFKTNNYMSPTFCDHCGSLLWGMVKQGLKCEDCGMNVHHKCQTKVANLCGINQKLLAEALNQVSLKSSTKRPDPTLSEIGIYQAIDKNVPA---DPSAEGSQYGKFWDITPAVPASTIVSTVRVSLNDFVFQKVLGKGSFGKVMLAELKGK-GQYFAIKALKKDVVLMDDDVECTMVEKRVLALAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLYRATFYAAEIICGLQYLHSKGIVYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLIGQSPFQGDDEDELFDSIRMDVPHYPRWITKEAKDLLEKLFERDPTRRLGV----VGNIRGHAFFKTINWPALEKREVSPPFKPKVKSSSDCSNFDREFLSEKPRLSQSDKNLIDSMDQTAFAGFSFINP 677          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: BX005175.1 (protein kinase C, delta b [Source:NCBI gene;Acc:100150844])

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 351/672 (52.23%), Postives = 456/672 (67.86%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERM-MP-RYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            P+  + +K++     GK +   QRK  +Y      T DAH   GR+IQ V+MK     L++A V +  + E C  +KG G    W+DL+P G++M   + V    E     +LD   S+  A++      I RRRGA++  K+H I+ HEF A FF+QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK  NYMSPTFCDHCG LL+G++KQGLKC++C  N H KC+ KV  LCG+NQKLLAE L +V    +++R      PT++     + I DK   A           D   E   +  P R  + DFV  KVLGKGSFGKV+L E+K K GQ FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT L+ TFQS  HLFF+MEYL GGDLMFHIQ  GRF + +A FY++EIIC LQ+LHS  I+YRDLKLDN+++  DG+IKIADFGMCKE    E +ATTFCGTPDYIAPEI+ G  Y+ +VDWWSFGVLLYEMLIGQSPF+G+DED+L  SI  D PHYPR +T+EA   L++LF R+P  RLG+     G+IRGH+FF  I+W  LE +++ PP  PK+KS +DCS FD +F  EKP+L+ +DK L+ +M+Q  F GFSF NP
Sbjct:   24 PFCAIKMKESLSTERGKTL--VQRKPTMYPAWKS-TFDAHIYEGRVIQVVLMKTAEEALSEATVGVSVIAERC--KKGNGHAEFWVDLQPSGKVM---MSVQFFVED---TDLDSKASMT-AKDDDGILTINRRRGAIKQAKVHFIKNHEFTATFFKQPTFCSVCREFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTMFQKERFKIDMPHRFKTNNYMSPTFCDHCGSLLWGMVKQGLKCEDCGMNVHHKCQTKVANLCGINQKLLAEALNQVSLKSSTKRP----DPTLSEIGIYQAI-DKNVPA-----------DPSGELALLHFPFRVSLNDFVFQKVLGKGSFGKVMLAELKGK-GQYFAIKALKKDVVLMDDDVECTMVEKRVLALAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLYRATFYAAEIICGLQYLHSKGIVYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLIGQSPFQGDDEDELFDSIRMDVPHYPRWITKEAKDLLEKLFERDPTRRLGV----VGNIRGHAFFKTINWPALEKREVSPPFKPKVKSSSDCSNFDREFLSEKPRLSQSDKNLIDSMDQTAFAGFSFINP 662          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcda (protein kinase C, delta a [Source:ZFIN;Acc:ZDB-GENE-030131-6503])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 344/683 (50.37%), Postives = 459/683 (67.20%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGK-LVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNI----PEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAA-----NEMNRYEQLWD--TVQETERMM--PRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            P+  V +K+A     GK LV+      P +R     + DAH   GR+IQ ++M+     LAD  V +  L E C  +  G    W+DL+P G++M+ +              L+ SD+ ++ R+      E   + RRRGA++  KIH I+ HEF+A FFRQPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK  NYMSPTFCDHCG LL+GL+KQGLKC++C+ N H KC+ KV  LCG+NQKLLAE L +V    +++R           NNT +    ++FN +      +   Y  +W+  + +   R+    R   E F+  KVLGKGSFGKVLL E+K   G+ FA+KALKK++VL DDDV+CTMVE+RVLAL   + FLT L+STFQ+  HLFF+MEYL GGDLMFHIQ+ GRF + +A FY++EI+C LQFLHS  IIYRDLKLDN+++ GDG+IKIADFGMCKE    + +ATTFCGTPDYIAPEI+ G  Y+ +VDWWSFGVL+YEMLIGQSPF G+DED+L  SI  DTPHYPR +  +    L++LF R+P  RLG+     G+IRGHSFF  ++W  LE +++ PP  PK+K+PNDCS FD +F  EKP+L+  +K L+ +M+Q  F GFSF NP
Sbjct:   24 PFCAVKMKEALSTERGKTLVQKKPTMYPAWRS----SFDAHIFEGRVIQILLMRTAEEPLADVTVGVSVLAERCK-KANGHAEFWVDLQPSGKVMMSV-----------QFFLEDSDTGSVCRHSVVANEEIPTLNRRRGAIKQAKIHFIKNHEFIATFFRQPTFCSVCRDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTMFQKERFKIDMPHRFKTNNYMSPTFCDHCGSLLWGLVKQGLKCEDCSMNVHHKCQTKVANLCGINQKLLAEALTQVSTKSSTKRPD---------NNTQDVGVYQDFNKSPGPDVTDGTPYGHIWEGSSPRPPSRITHQTRITAEHFIFHKVLGKGSFGKVLLAELKGT-GEWFAVKALKKDVVLMDDDVECTMVEKRVLALAWDNPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLYRATFYAAEIVCGLQFLHSKGIIYRDLKLDNVMLDGDGHIKIADFGMCKENVFGDNRATTFCGTPDYIAPEILLGQQYSFSVDWWSFGVLVYEMLIGQSPFHGDDEDELFESIRMDTPHYPRWILLDTRDMLERLFERDPSRRLGI----VGNIRGHSFFKTVNWAALEGREVDPPFKPKVKAPNDCSNFDREFLSEKPRLSHCEKGLIDSMDQCAFAGFSFINP 676          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcq (protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-041210-195])

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 349/722 (48.34%), Postives = 464/722 (64.27%), Query Frame = 1
Query:  118 FIRIKICDIEKD--FIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEV---RQDQNSRRETASIS---------PTVTVNNTSEQIQDKEFNAANEMNRYEQL---WDTVQETER----------MMPR-----YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            F+RI     E D      ++  +PY  V +K+A    +G++   Y++K+P        T DAH + GR++  VV  +   +  +A V+++TL   C  E  G + +W++L+P GRL++         E    +E    +     R       +  RRGA++  K+H ++ HEF A FF QPT+CS C EF+WGLNKQGYQC+ C+ A+HKKC  K++AKC GSA+ S+ET I +ERF I++PH+FK+YNYMSPTFC+HCG LL+GL +QGLKC+EC  N H KC++KV  LCGVNQKL+AE LA +   +Q   S R+T ++          P V +   S ++       A  + R E     WD+  +  R            PR     + I+ F+L K+LGKGSFGKV L E+K   GQ FA+KALKK++VL DDDV+CTMVERRVL+L   H FLT L+ TFQ+  +LFF+MEYL GGDLMFHIQ   RF + ++ FY++EIIC LQFLHS  I+YRDLKLDNIL+  DG+IKIADFGMCKE    E +  TFCGTPDYIAPEI+ G  Y  +VDWWSFGVLLYEMLIGQSPF G DE++L +SI  D P YPR LTR+A   L +LF R P  RLG+     G+IR H FF E DW  LE +Q+ PP  P +KS NDCS FD +F  EKP+L++TD+ ++++M+Q +F+ FSF NP
Sbjct:    4 FLRIAFSSFEMDPGLAYHEEVLNPYCAVYMKEAVETEKGQV---YKQKRPTMYPPWSSTFDAHVHKGRVMHVVVKDKTAELKTEATVQLDTLASRCKKE-NGKLEIWVELKPQGRLLM---------EARYFLERS-GEHGETEREKEGVFALHHRRGAIKQAKVHVVKCHEFTATFFPQPTFCSVCKEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAVNSKETMIHKERFKIDMPHRFKVYNYMSPTFCEHCGTLLWGLARQGLKCEECGMNVHHKCQKKVANLCGVNQKLMAEALAMIESTQQQARSSRDTETVGREGPVSADQPGV-IREPSGRLAISPLTPAPPLPRKEHQGISWDSPADGRRPSLEEPEPLYATPRKEHHKFTIDSFILHKMLGKGSFGKVFLAELKGS-GQFFAVKALKKDVVLMDDDVECTMVERRVLSLAWDHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQTCHRFDLPRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDTDGHIKIADFGMCKENIIGEARTCTFCGTPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTRDARDILVKLFVREPERRLGVK----GNIRQHPFFRETDWSALEERQVEPPFKPTVKSANDCSNFDKEFINEKPRLSVTDRMMINSMDQSMFENFSFINP 705          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcq (protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-041210-195])

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 344/704 (48.86%), Postives = 458/704 (65.06%), Query Frame = 1
Query:  166 DDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEV---RQDQNSRRETASIS---------PTVTVNNTSEQIQDKEFNAANEMNRYEQL---WDTVQETER----------MMPR-----YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            ++  +PY  V +K+A    +G++   Y++K+P        T DAH + GR++  VV  +   +  +A V+++TL   C  E  G + +W++L+P GRL++        ++     E D        R       +  RRGA++  K+H ++ HEF A FF QPT+CS C EF+WGLNKQGYQC+ C+ A+HKKC  K++AKC GSA+ S+ET I +ERF I++PH+FK+YNYMSPTFC+HCG LL+GL +QGLKC+EC  N H KC++KV  LCGVNQKL+AE LA +   +Q   S R+T ++          P V +   S ++       A  + R E     WD+  +  R            PR     + I+ F+L K+LGKGSFGKV L E+K   GQ FA+KALKK++VL DDDV+CTMVERRVL+L   H FLT L+ TFQ+  +LFF+MEYL GGDLMFHIQ   RF + ++ FY++EIIC LQFLHS  I+YRDLKLDNIL+  DG+IKIADFGMCKE    E +  TFCGTPDYIAPEI+ G  Y  +VDWWSFGVLLYEMLIGQSPF G DE++L +SI  D P YPR LTR+A   L +LF R P  RLG+     G+IR H FF E DW  LE +Q+ PP  P +KS NDCS FD +F  EKP+L++TD+ ++++M+Q +F+ FSF NP
Sbjct:   12 EEVLNPYCAVYMKEAVETEKGQV---YKQKRPTMYPPWSSTFDAHVHKGRVMHVVVKDKTAELKTEATVQLDTLASRCKKE-NGKLEIWVELKPQGRLLMEARYFLERSDAAGHGEGDGETE----REKEGVFALHHRRGAIKQAKVHVVKCHEFTATFFPQPTFCSVCKEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAVNSKETMIHKERFKIDMPHRFKVYNYMSPTFCEHCGTLLWGLARQGLKCEECGMNVHHKCQKKVANLCGVNQKLMAEALAMIESTQQQARSSRDTETVGREGPVSADQPGV-IREPSGRLAISPLTPAPPLPRKEHQGISWDSPADGRRPSLEEPEPLYATPRKEHHKFTIDSFILHKMLGKGSFGKVFLAELKGS-GQFFAVKALKKDVVLMDDDVECTMVERRVLSLAWDHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQTCHRFDLPRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDTDGHIKIADFGMCKENIIGEARTCTFCGTPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTRDARDILVKLFVREPERRLGVK----GNIRQHPFFRETDWSALEERQVEPPFKPTVKSANDCSNFDKEFINEKPRLSVTDRMMINSMDQSMFENFSFINP 701          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: fam76b (family with sequence similarity 76 member B [Source:Xenbase;Acc:XB-GENE-5850810])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 345/676 (51.04%), Postives = 453/676 (67.01%), Query Frame = 1
Query:  169 DYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWD--TVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            D+  P+  V +K++     GK +    +KKP          DAH   GR+IQ V+MK     L++A V +  L E C  +KG G    W+DL+P  ++   L+ V    E   M  +  S      R       I RRRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC   I+ +C G+A  SR+T   +ERFNI++PH+FK+YNY SPTFCDHCG LL+GL+KQGLKC EC  N H KC+ KV  LCG+NQKLLAE L +V    +SR+  + +         + +        A + N+Y++LW+  +      +  R  I++FV  KVLGKGSFGKVLL E+K K G+ FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT ++ +FQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY+SEIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    + KA+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG+     G+I+ H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKP+L+ +DK L+ +M+Q  F GFSF NP
Sbjct:   22 DHSQPFCAVKVKESLTTERGKTL---VQKKPTMYPDWKSPFDAHIYEGRVIQIVLMKAAEDPLSEATVGVSVLAERC--KKGNGKSEFWLDLQPQAKV---LMSVQYFLEDAGMFIVCSS-----VREDEGLVTINRRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCRDFVWGLNKQGYKCRQCNAAIHKKCIEMIIGRCTGTAANSRDTMFQKERFNIDMPHRFKVYNYKSPTFCDHCGSLLWGLVKQGLKCDECAMNVHHKCQNKVANLCGINQKLLAEALNQVSMKSSSRKSDSGLDNIAIYQGVNPKTPGLPMPDATD-NQYDRLWEGSSPHPHISLSSRLKIDNFVFHKVLGKGSFGKVLLAELKGK-GEYFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHIYCSFQTKEHLFFVMEFLNGGDLMFHIQDKGRFDLYRATFYASEIICGLQFLHSKGIIYRDLKLDNVMLDKDGHIKIADFGMCKENVYGDNKASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRQDTPHYPRWITKESKDILERLFEREPTKRLGV----VGNIKVHPFFKTINWTALERRELEPPFKPKVKSPSDYSNFDREFLSEKPRLSFSDKNLIDSMDQSAFHGFSFINP 678          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: fam76b (family with sequence similarity 76 member B [Source:Xenbase;Acc:XB-GENE-5850810])

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 344/676 (50.89%), Postives = 449/676 (66.42%), Query Frame = 1
Query:  169 DYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWD--TVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            D+  P+  V +K++     GK +    +KKP          DAH   GR+IQ V+MK     L++A V +  L E C  +KG G    W+DL+P  ++   L+ V    E   M     +         PE+   + RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC   I+ +C G+A  SR+T + +ERFNI++PH+FK+YNY SPTFCDHCG LL+GL+KQGLKC EC  N H KC+ KV  LCG+NQKLLAE L +V     S RE                       A  + N+Y++LW+  +      +  R  I++FV  KVLGKGSFGKVLL E+K K G+ FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT ++ +FQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY+SEIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    + KA+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG+     G+I+ H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKP+L+ +DK L+ +M+Q  F GFSF NP
Sbjct:   22 DHSQPFCAVKVKESLTTERGKTL---VQKKPTMYPDWKSPFDAHIYEGRVIQIVLMKAAEDPLSEATVGVSVLAERC--KKGNGKSEFWLDLQPQAKV---LMSVQYFLEDAGMFICCFTPGH------PEYKQESLRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCRDFVWGLNKQGYKCRQCNAAIHKKCIEMIIGRCTGTAANSRDTMVSKERFNIDMPHRFKVYNYKSPTFCDHCGSLLWGLVKQGLKCDECAMNVHHKCQNKVANLCGINQKLLAEALNQV-----SARE-----------------------APVKYNQYDRLWEGSSPHPHISLSSRLKIDNFVFHKVLGKGSFGKVLLAELKGK-GEYFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHIYCSFQTKEHLFFVMEFLNGGDLMFHIQDKGRFDLYRATFYASEIICGLQFLHSKGIIYRDLKLDNVMLDKDGHIKIADFGMCKENVYGDNKASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRQDTPHYPRWITKESKDILERLFEREPTKRLGV----VGNIKVHPFFKTINWTALERRELEPPFKPKVKSPSDYSNFDREFLSEKPRLSFSDKNLIDSMDQSAFHGFSFINP 650          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: fam76b (family with sequence similarity 76 member B [Source:Xenbase;Acc:XB-GENE-5850810])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 338/674 (50.15%), Postives = 441/674 (65.43%), Query Frame = 1
Query:  169 DYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            D+  P+  V +K++     GK +    +KKP          DAH   GR+IQ V+MK     L++A V +  L E C  +KG G    W+DL+P  ++++        + Q  + + D     +  R       I RRRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC   I+ +C G+A  SR+T + +ERFNI++PH+FK+YNY SPTFCDHCG LL+GL+KQGLKC EC  N H KC+ KV  LCG+NQKLLAE L +V                                          +  TV +T  +  R  I++FV  KVLGKGSFGKVLL E+K K G+ FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT ++ +FQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY+SEIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    + KA+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG+     G+I+ H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKP+L+ +DK L+ +M+Q  F GFSF NP
Sbjct:   22 DHSQPFCAVKVKESLTTERGKTL---VQKKPTMYPDWKSPFDAHIYEGRVIQIVLMKAAEDPLSEATVGVSVLAERC--KKGNGKSEFWLDLQPQAKVLM--------SVQYFLEDADPGRPQSSVREDEGLVTINRRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCRDFVWGLNKQGYKCRQCNAAIHKKCIEMIIGRCTGTAANSRDTMVSKERFNIDMPHRFKVYNYKSPTFCDHCGSLLWGLVKQGLKCDECAMNVHHKCQNKVANLCGINQKLLAEALNQV-----------------------------------------SMVSTVGQTFYLSSRLKIDNFVFHKVLGKGSFGKVLLAELKGK-GEYFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHIYCSFQTKEHLFFVMEFLNGGDLMFHIQDKGRFDLYRATFYASEIICGLQFLHSKGIIYRDLKLDNVMLDKDGHIKIADFGMCKENVYGDNKASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRQDTPHYPRWITKESKDILERLFEREPTKRLGV----VGNIKVHPFFKTINWTALERRELEPPFKPKVKSPSDYSNFDREFLSEKPRLSFSDKNLIDSMDQSAFHGFSFINP 636          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: fam76b (family with sequence similarity 76 member B [Source:Xenbase;Acc:XB-GENE-5850810])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 327/676 (48.37%), Postives = 438/676 (64.79%), Query Frame = 1
Query:  169 DYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWD--TVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            D+  P+  V +K++     GK +    +KKP          DAH   GR+IQ V+MK     L++A V +  L E C  +KG G    W+DL+P  ++++        + Q  + + DL  S+   R       I RRRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC   I+ +C G+A  SR+T   +ERFNI++PH+FK+YNY SPTFCDHCG LL+GL+KQGLKC EC  N H KC+ KV  LCG+NQKLLAE L +V    +SR+  + +         + +        A + N+Y++LW+  +      +  R  I++FV  KVLGKGSFGKVLL E+K K G+ FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT ++ +FQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A                      DLKLDN+++  DG+IKIADFGMCKE    + KA+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG+     G+I+ H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKP+L+ +DK L+ +M+Q  F GFSF NP
Sbjct:   22 DHSQPFCAVKVKESLTTERGKTL---VQKKPTMYPDWKSPFDAHIYEGRVIQIVLMKAAEDPLSEATVGVSVLAERC--KKGNGKSEFWLDLQPQAKVLM--------SVQYFLEDADLKSSV---REDEGLVTINRRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCRDFVWGLNKQGYKCRQCNAAIHKKCIEMIIGRCTGTAANSRDTMFQKERFNIDMPHRFKVYNYKSPTFCDHCGSLLWGLVKQGLKCDECAMNVHHKCQNKVANLCGINQKLLAEALNQVSMKSSSRKSDSGLDNIAIYQGVNPKTPGLPMPDATD-NQYDRLWEGSSPHPHISLSSRLKIDNFVFHKVLGKGSFGKVLLAELKGK-GEYFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHIYCSFQTKEHLFFVMEFLNGGDLMFHIQDKGRFDLYRA---------------------TDLKLDNVMLDKDGHIKIADFGMCKENVYGDNKASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRQDTPHYPRWITKESKDILERLFEREPTKRLGV----VGNIKVHPFFKTINWTALERRELEPPFKPKVKSPSDYSNFDREFLSEKPRLSFSDKNLIDSMDQSAFHGFSFINP 654          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: fam76b (family with sequence similarity 76 member B [Source:Xenbase;Acc:XB-GENE-5850810])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 333/703 (47.37%), Postives = 444/703 (63.16%), Query Frame = 1
Query:   91 DKMKFVSKGFIRIKICDIE-KDFIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWD--TVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            +K  F    F+RI     +    +   D+  P+  V +K++     GK +    +KKP          DAH   GR+IQ V+MK     L++A V +  L E C  +KG G    W+DL+P  ++++        + Q  + + DL  S+   R       I RRRGA++  KIH I+ HEF+A FF                         C+ A+HKKC   I+ +C G+A  SR+T   +ERFNI++PH+FK+YNY SPTFCDHCG LL+GL+KQGLKC EC  N H KC+ KV  LCG+NQKLLAE L +V    +SR+  + +         + +        A + N+Y++LW+  +      +  R  I++FV  KVLGKGSFGKVLL E+K K G+ FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT ++ +FQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY+SEIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    + KA+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG+     G+I+ H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKP+L+ +DK L+ +M+Q  F GFSF NP
Sbjct:   37 EKHGFTMSPFLRISFNSFDLGGMLSLPDHSQPFCAVKVKESLTTERGKTL---VQKKPTMYPDWKSPFDAHIYEGRVIQIVLMKAAEDPLSEATVGVSVLAERC--KKGNGKSEFWLDLQPQAKVLM--------SVQYFLEDADLKSSV---REDEGLVTINRRRGAIKQAKIHYIKNHEFIATFFE------------------------CNAAIHKKCIEMIIGRCTGTAANSRDTMFQKERFNIDMPHRFKVYNYKSPTFCDHCGSLLWGLVKQGLKCDECAMNVHHKCQNKVANLCGINQKLLAEALNQVSMKSSSRKSDSGLDNIAIYQGVNPKTPGLPMPDATD-NQYDRLWEGSSPHPHISLSSRLKIDNFVFHKVLGKGSFGKVLLAELKGK-GEYFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHIYCSFQTKEHLFFVMEFLNGGDLMFHIQDKGRFDLYRATFYASEIICGLQFLHSKGIIYRDLKLDNVMLDKDGHIKIADFGMCKENVYGDNKASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRQDTPHYPRWITKESKDILERLFEREPTKRLGV----VGNIKVHPFFKTINWTALERRELEPPFKPKVKSPSDYSNFDREFLSEKPRLSFSDKNLIDSMDQSAFHGFSFINP 693          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcd (protein kinase C, delta [Source:MGI Symbol;Acc:MGI:97598])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 340/676 (50.30%), Postives = 451/676 (66.72%), Query Frame = 1
Query:  166 DDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            D+   P+  V +K+A     GK +    +KKP        T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++   L+CV     Q  + + D   S+  +    +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK+YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + + +T              ++   +    N    Y ++W+          R  +E+F   KVLGKGSFGKVLL E+K K  + FAIK LKK++VL DDDV+CTMVE+RVLAL     FLT L  TFQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY++EIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y+ +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   +++LF R+P  RLG++    G+IR H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKPQL+ +DK L+ +M+Q+ F GFSF NP +
Sbjct:   21 DEASQPFCAVKMKEALSTERGKTL---VQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKV---LMCV-----QYFLEDGDCKQSMR-SEEEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILDNN--GTYGKIWEGST-------RCTLENFTFQKVLGKGSFGKVLLAELKGK-DKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVT----GNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKF 668          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcd (protein kinase C, delta [Source:MGI Symbol;Acc:MGI:97598])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 343/700 (49.00%), Postives = 459/700 (65.57%), Query Frame = 1
Query:  166 DDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETAS-------------ISPTVTVNNTSEQI--------QDKEFNAA---NEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            D+   P+  V +K+A     GK +    +KKP        T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++   L+CV     Q  + + D   S+  +    +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK+YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + + +T               +S +  +      I        + KE +++   +    Y ++W+          R  +E+F   KVLGKGSFGKVLL E+K K  + FAIK LKK++VL DDDV+CTMVE+RVLAL     FLT L  TFQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY++EIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y+ +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   +++LF R+P  RLG++    G+IR H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKPQL+ +DK L+ +M+Q+ F GFSF NP +
Sbjct:   21 DEASQPFCAVKMKEALSTERGKTL---VQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKV---LMCV-----QYFLEDGDCKQSMR-SEEEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCDNNGTYGKIWEGST-------RCTLENFTFQKVLGKGSFGKVLLAELKGK-DKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVT----GNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKF 694          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcd (protein kinase C, delta [Source:MGI Symbol;Acc:MGI:97598])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 343/700 (49.00%), Postives = 459/700 (65.57%), Query Frame = 1
Query:  166 DDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETAS-------------ISPTVTVNNTSEQI--------QDKEFNAA---NEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            D+   P+  V +K+A     GK +    +KKP        T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++   L+CV     Q  + + D   S+  +    +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK+YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + + +T               +S +  +      I        + KE +++   +    Y ++W+          R  +E+F   KVLGKGSFGKVLL E+K K  + FAIK LKK++VL DDDV+CTMVE+RVLAL     FLT L  TFQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY++EIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y+ +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   +++LF R+P  RLG++    G+IR H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKPQL+ +DK L+ +M+Q+ F GFSF NP +
Sbjct:   21 DEASQPFCAVKMKEALSTERGKTL---VQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKV---LMCV-----QYFLEDGDCKQSMR-SEEEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCDNNGTYGKIWEGST-------RCTLENFTFQKVLGKGSFGKVLLAELKGK-DKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVT----GNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKF 694          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcq (protein kinase C, theta [Source:MGI Symbol;Acc:MGI:97601])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 335/696 (48.13%), Postives = 452/696 (64.94%), Query Frame = 1
Query:  178 DPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPE-FGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSR--RETASIS---------PTVTVNNTSEQI-------------QDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPA 2187
            +PY  V +K+   +  G++   Y +KKP        T DAH N GR++Q +V  +   ++++  VE+ +L E C  +  G   +W++L+P GR+++                L++SD+ +++    E F  + +RRGA++  K+H ++ HEF A FF QPT+CS C EF+WGLNKQGYQC+ C+ A+HKKC  K++AKC GSA+ SRET   +ERF I++PH+FK+YNY SPTFC+HCG LL+GL +QGLKC  C  N H +C+ KV  LCG+NQKL+AE LA +   Q +R  R++  I          P  T N T                  D   + +N+     +   +++ T   + +  I+DF+L K+LGKGSFGKV L E K +  Q FAIKALKK++VL DDDV+CTMVE+RVL+L   H FLT +  TFQ+  +LFF+MEYL GGDLM+HIQ   +F + +A FY++E+I  LQFLHS  I+YRDLKLDNIL+  DG+IKIADFGMCKE    + K  TFCGTPDYIAPEI+ G  YN +VDWWSFGVL+YEMLIGQSPF G+DE++L  SI  D P YPR L REA   L +LF R P  RLG+     G IR H  F EI+WE+LE K+I PP  PK+KSP DCS FD +F  EKP+L+  D+ L+++M+Q++F  FSF NP 
Sbjct:   26 NPYCAVLVKEYVESENGQM---YIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCR-KNNGRTEIWLELKPQGRMLM-----------NARYFLEMSDTKDMSEFENEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKREPQGISWDSPLDGSNKSAGPPEPEVSMRRTSLQL-KLKIDDFILHKMLGKGSFGKVFLAEFK-RTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVR----GDIRQHPLFREINWEELERKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPG 700          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcd (protein kinase C, delta [Source:MGI Symbol;Acc:MGI:97598])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 304/539 (56.40%), Postives = 390/539 (72.36%), Query Frame = 1
Query:  577 RRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            RRGA++  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK+YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + + +T              ++   +    N    Y ++W+          R  +E+F   KVLGKGSFGKVLL E+K K  + FAIK LKK++VL DDDV+CTMVE+RVLAL     FLT L  TFQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY++EIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y+ +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   +++LF R+P  RLG++    G+IR H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKPQL+ +DK L+ +M+Q+ F GFSF NP +
Sbjct:   29 RRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILDNN--GTYGKIWEGST-------RCTLENFTFQKVLGKGSFGKVLLAELKGKD-KYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVT----GNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKF 553          

HSP 2 Score: 51.9878 bits (123), Expect = 2.839e-6
Identity = 25/66 (37.88%), Postives = 35/66 (53.03%), Query Frame = 1
Query:  790 SRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLC 987
            +R   I Q + +    H+F    +  PTFC  C   ++GL KQG KC++CN   HKKC  K+   C
Sbjct:   28 NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRC 93          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P09215|KPCD_RAT (Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1)

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 349/694 (50.29%), Postives = 459/694 (66.14%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDG-DDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMN-RYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +   DD   P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++   L+CV    E     +   S+   +   +        RRGA++  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK+YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + + ET     TV +    E+      N   + N  Y ++W+          R  +E+F   KVLGKGSFGKVLL E+K K  + FAIK LKK++VL DDDV+CTMVE+RVLAL   + FLT L  TFQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY++EIIC LQFLH   IIYRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y+ +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   +++LF R+P  RLG++    G+IR H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKPQL+ +DK L+ +M+Q  FKGFSF NP Y
Sbjct:    4 FLRISFNSYELGSLQAEDDASQPFCAVKMKEALTTDRGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEDPMSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKV---LMCVQYFLEDGDCKQSMRSEEEAMFPTM-------NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGTLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQKASRKPETPE---TVGIYQGFEKKTAVSGNDIPDNNGTYGKIWEGSN-------RCRLENFTFQKVLGKGSFGKVLLAELKGKE-RYFAIKYLKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHGKGIIYRDLKLDNVMLDKDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPAKRLGVT----GNIRLHPFFKTINWNLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQTAFKGFSFVNPKY 668          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P28867|KPCD_MOUSE (Protein kinase C delta type OS=Mus musculus OX=10090 GN=Prkcd PE=1 SV=3)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 340/676 (50.30%), Postives = 451/676 (66.72%), Query Frame = 1
Query:  166 DDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            D+   P+  V +K+A     GK +    +KKP        T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++   L+CV     Q  + + D   S+  +    +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK+YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + + +T              ++   +    N    Y ++W+          R  +E+F   KVLGKGSFGKVLL E+K K  + FAIK LKK++VL DDDV+CTMVE+RVLAL     FLT L  TFQ+  HLFF+ME+L GGDLMFHIQ  GRF + +A FY++EIIC LQFLHS  IIYRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y+ +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   +++LF R+P  RLG++    G+IR H FF  I+W  LE +++ PP  PK+KSP+D S FD +F  EKPQL+ +DK L+ +M+Q+ F GFSF NP +
Sbjct:   21 DEASQPFCAVKMKEALSTERGKTL---VQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKV---LMCV-----QYFLEDGDCKQSMR-SEEEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILDNN--GTYGKIWEGST-------RCTLENFTFQKVLGKGSFGKVLLAELKGK-DKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVT----GNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKF 668          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q05655|KPCD_HUMAN (Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 338/693 (48.77%), Postives = 462/693 (66.67%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDGDDYFD-PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +  +D  + P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +  G    W+DL+P  ++++        + Q  + ++D   S+  + +  +F  +  RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK++NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC  KV  LCG+NQKLLAE L +V Q  + R ++AS  P        ++      +  +    Y ++W+   +         I +F+  KVLGKGSFGKVLLGE+K + G+ FAIKALKK++VL DDDV+CTMVE+RVL L   + FLT L  TFQ+  HLFF+ME+L GGDLM+HIQ  GRF + +A FY++EI+C LQFLHS  IIYRDLKLDN+L+  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y  +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++LF R P  RLG++    G+I+ H FF  I+W  LE +++ PP  PK+KSP D S FD +F  EK +L+ +DK L+ +M+Q  F GFSF NP +
Sbjct:    4 FLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCK-KNNGKAEFWLDLQPQAKVLM--------SVQYFLEDVDCKQSMR-SEDEAKFPTM-NRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCN-------INNFIFHKVLGKGSFGKVLLGELKGR-GEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVT----GNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKF 670          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q5PU49|KPCD_CANLF (Protein kinase C delta type OS=Canis lupus familiaris OX=9615 GN=PRKCD PE=2 SV=1)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 336/695 (48.35%), Postives = 459/695 (66.04%), Query Frame = 1
Query:  118 FIRIKICDIEKDFIDG-DDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLA--RNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            F+RI     E   +   D+   P+  V +K+A     GK +   Q+K  +Y +    T DAH   GR+IQ V+M+     +++  V +  L E C  +       W+DL+P  ++++        + Q  + ++D   S++      +P       RRGA++  KIH I+ HEF+A FF QPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERFNI++PH+FK+YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC++KV  LCG+NQKLLAE L +V Q  + + ET S+   +  N   +     +     +   Y ++W+          R  I++F+  KVLGKGSFGKVLL E+K K  + FAIKALKK++VL DDDV+CTMVE+RVLAL   + FLT L  TFQ+  HLFF+ME+L GGDLM+HIQ  GRF + +A FY++EI+C LQFLH+  IIYRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ Y+ +VDWWSFGVLLYEMLIGQSPF G+DED+L  SI  DTPHYPR +T+E+   L++L  R+   RLG++    G+I+ H FF  I+W  LE + + PP  PK+KSP D S FD +F  EK +L+ TDK L+ +M+Q  F GFSF NP +
Sbjct:    4 FLRIAFTSYELGSLQAADEASQPFCAVKMKEALSTERGKTL--VQKKPTMYPEWKS-TFDAHIYEGRVIQIVLMRAAEEPMSEVTVGVSVLAERCK-KNNXKAEFWLDLQPQAKVLM--------SVQYFLEDIDCRQSMHGEDEAKLPTMN----RRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLCGINQKLLAEALNQVTQRSSRKSETESVG--IYQNFERKPGVSGDIAPGEDNGTYGKIWEG-------STRCNIDNFIFHKVLGKGSFGKVLLVELKGKK-EFFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLFCTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIVCGLQFLHNKGIIYRDLKLDNVMLDQDGHIKIADFGMCKENIFGEKQASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLLERDTTKRLGVT----GNIKIHPFFKTINWTLLEKRAVEPPFKPKVKSPGDYSNFDQEFLNEKARLSYTDKNLIDSMDQTAFAGFSFVNPKF 668          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q04759|KPCT_HUMAN (Protein kinase C theta type OS=Homo sapiens OX=9606 GN=PRKCQ PE=1 SV=3)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 338/695 (48.63%), Postives = 451/695 (64.89%), Query Frame = 1
Query:  178 DPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPE-FGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSR--RETASI-------------------SPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETER--MMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPA 2187
            +PY  V +K+   +  G++   Y +KKP        T DAH N GR++Q +V  +   ++++  VE+ +L E C  +  G   +W++L+P GR+++                L++SD+ ++     E F  + +RRGA++  K+H ++ HEF A FF QPT+CS C EF+WGLNKQGYQC+ C+ A+HKKC  K++AKC GSA+ SRET   +ERF I++PH+FK+YNY SPTFC+HCG LL+GL +QGLKC  C  N H +C+ KV  LCG+NQKL+AE LA +   Q +R  R+T  I                    P +      E       +  +E+++   L +     ER  +  +  IEDF+L K+LGKGSFGKV L E K K  Q FAIKALKK++VL DDDV+CTMVE+RVL+L   H FLT +  TFQ+  +LFF+MEYL GGDLM+HIQ   +F + +A FY++EII  LQFLHS  I+YRDLKLDNIL+  DG+IKIADFGMCKE    + K  TFCGTPDYIAPEI+ G  YN +VDWWSFGVLLYEMLIGQSPF G+DE++L  SI  D P YPR L +EA   L +LF R P  RLG+     G IR H  F EI+WE+LE K+I PP  PK+KSP DCS FD +F  EKP+L+  D+ L+++M+Q++F+ FSF NP 
Sbjct:   26 NPYCAVLVKEYVESENGQM---YIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCR-KNNGKTEIWLELKPQGRMLM-----------NARYFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFK-KTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVR----GDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG 700          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A2T7NTK6 (Protein kinase C OS=Pomacea canaliculata OX=400727 GN=C0Q70_14959 PE=3 SV=1)

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 386/703 (54.91%), Postives = 491/703 (69.84%), Query Frame = 1
Query:  100 KFVSKGFIRIKICDIEKDFIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMP--------RYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTN 2181
            K    GFIR+K+   E    +G    DP+  +NIK+A   + G+  +  Q+K+ +Y + N    DAH N GR+IQ V+M+RPN  LAD ++  + L + C    G     W+DLRPHGR+ V +             E D    L+ +    +  GI RR GA++ QK+H ++GH+F+AKFFRQP++CSFC+EFLWGLN+QGYQC++CHCAVHKKCH KIL KCPGSA ESRET +L ERFNINVPH+FK YNYMSPTFCDHCG +L+GL +QGLKC+ CNTNCH KC++ +P LCGVNQK+LAE L +VR   + RR                          +E   Y+++W    E+E  +P        ++  EDF  LKVLGKGSFGKV+L E K   G+ +AIKALKK++VLEDDDV+CTM+ERRVLA+G +H FLT LHSTFQS SHLFF+MEYL GGDLMFHIQ +G+F   +A+FY++EI+C LQFLHS+ ++YRDLKLDN+++  DG+IKIADFGMCKE    E +A+TFCGTPDYIAPEI++G+ YN +VDWWSFGVLLYEMLIGQSPF G+DEDDL  SI +DTP YP S+ +EA   L  LF RNP++RLGM  CP+G IR   FF  IDW  LE +++ PP  PK+K+  D S FDSDFT E+ QLT  DK+LL TMNQ +FK FSFT+
Sbjct:  123 KMPGVGFIRVKLLQAETG-PNGPALTDPFLAINIKEA-VEVPGRGTQLVQKKRTLYPEWN-TCFDAHLNHGRVIQMVLMERPNTSLADVSIGAKILADKCA--DGNATRTWLDLRPHGRIEVQIRF---------FKEDDNGAILSPSVTGRDKPGIVRR-GAMKQQKVHEVRGHQFIAKFFRQPSFCSFCNEFLWGLNRQGYQCKVCHCAVHKKCHDKILGKCPGSAKESRETMLLTERFNINVPHRFKTYNYMSPTFCDHCGSMLFGLFRQGLKCEICNTNCHHKCQKFMPNLCGVNQKMLAEALRQVRISSSDRRHEDEK-------------------EESEDESYQEMWS---ESESGLPKRAPTVVRKFTPEDFHFLKVLGKGSFGKVMLAEQKGT-GKYYAIKALKKDVVLEDDDVECTMIERRVLAMGSKHPFLTHLHSTFQSPSHLFFVMEYLNGGDLMFHIQLSGKFEFQRAQFYAAEIVCGLQFLHSNGVVYRDLKLDNVMLDKDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILKGLKYNSSVDWWSFGVLLYEMLIGQSPFHGDDEDDLFHSILHDTPRYPHSMPKEAAAMLSLLFERNPVERLGMPGCPHGPIRSQIFFRNIDWSNLEARKVNPPFRPKVKNDGDSSNFDSDFTSERAQLTPPDKELLKTMNQHVFKRFSFTS 787          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A2C9JCV2 (Protein kinase C OS=Biomphalaria glabrata OX=6526 GN=106052518 PE=3 SV=1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 381/696 (54.74%), Postives = 492/696 (70.69%), Query Frame = 1
Query:  115 GFIRIKICDIEKDFIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTE-CCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMP-----RYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTN 2181
            GFIR+K+  +  D   G D  DP+  VN+K+A  ++ GK V+  Q+KK +Y + N    DAH   GR IQ +VM++PN  + + ++ ++ L + C GG   G I  W++L+P GRL + +   P A E  P+++             P F     RRGA++ QK+H ++GH+F+AKFFR PTYCSFC++FLWGLNKQGYQCQ+C+CAVHKKCH KIL KCPG+A +SRET +L ERFNINVPH+FK+YNYMSPTFCDHCG +L+GL +QGLKC+ C  NCHKKC++ +P LCG+NQKLLAE L +VR          S SP           Q  +   +++ + Y+++WD  +    M P     ++  E+F  LK LGKGSFGKV L E+K      +AIKAL+K++VLEDDDV+CT++E+RVL++GC+H FLT LHSTFQ+ SHLFF+MEYL GGDLMFHIQ +G+F   +A+FY++EIIC LQFLH + I+YRDLKLDN+++  DG+IKIADFGMCKE    + KA+TFCGTPDYIAPEI++G  YN +VDWWSFGVL+YEMLIGQSPF G+DEDDL  SI +DTP YP +  +EA+  L  LF RNP DRLGM TCP G I    FF  IDWEKLE +QIPPP  PK+K+ +D S FDSDFT EK  LT  D  LL TMNQ++FK FSFT+
Sbjct:   38 GFIRVKL--LAADVTQGPDAEDPFLAVNVKEA-LDIPGKGVQLIQKKKTLYPKWNS-CFDAHLYEGRTIQMIVMEKPNKNMGEISIGVKALADKCNGGVNSGPI--WLELKPSGRLQIQVRFYPEAGEPIPIMD----------PQKPHF----VRRGAMKQQKVHEVKGHQFIAKFFRSPTYCSFCTDFLWGLNKQGYQCQICNCAVHKKCHDKILGKCPGNAKDSRETMMLTERFNINVPHRFKLYNYMSPTFCDHCGSMLFGLFRQGLKCEVCGINCHKKCKQFMPNLCGINQKLLAEALQQVR---------ISTSPGGQRPQPGSAPQPDDDEDSDDDSPYQKVWDIDEVPTEMAPALQVRKFTPEEFTFLKTLGKGSFGKVFLAELKEN-NTFYAIKALRKDVVLEDDDVECTLIEKRVLSIGCQHPFLTHLHSTFQNKSHLFFVMEYLNGGDLMFHIQLSGKFEFQRAQFYAAEIICGLQFLHKNGIVYRDLKLDNVMLDKDGHIKIADFGMCKEKIFGDNKASTFCGTPDYIAPEILKGAKYNASVDWWSFGVLVYEMLIGQSPFHGDDEDDLFHSILHDTPRYPHATPKEAVNMLTLLFDRNPPDRLGMPTCPAGPINSQPFFRNIDWEKLEARQIPPPFKPKVKNASDSSNFDSDFTTEKVGLTPPDPTLLKTMNQNVFKHFSFTS 703          
BLAST of Protein kinase C vs. TrEMBL
Match: R7UCD0 (Protein kinase C OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_114953 PE=3 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 380/656 (57.93%), Postives = 477/656 (72.71%), Query Frame = 1
Query:  226 GKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQET-ERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPA 2187
            GK V+  QRKK +Y + N    DAH   GR IQ VVM+RP  ++AD  V  + L + C    G +  +W+DL+P GRL++ +   P   E+P       +D L+   N     GI  RRGA++HQK+H ++GH+F+AKFFRQPT+CS+C +FLWGLNKQGYQCQ+C  AVHK+CH ++L KCPGSA ESR+TKIL ERFNINVPH+F+++NYMSP+FCDHCG LLYGL +QGLKC EC TNCHKKCE+K+P LCGVNQK+LAE +  V + ++   +++S S   +  ++         N A     YE+LWDT  +     M ++   DF  LKVLGKGSFGKV+L E+K   G  +AIKALKK+IVLEDDDV+CTM+E+R+L+L C+H +LT LHSTFQS SHLFF+MEYL GGDLMFHIQQ GRF ++++RFY++EIIC LQFLH    IYRDLKLDN+++  DG+IKIADFGMCKE    E KA+TFCGTPDYIAPEI++G+ YN +VDWWSFGVLLYEMLIGQSPF G+DEDDL  SIC DTPHYPR +  +A  C+  L  R+   RLGM  C  G IR H FF  +DW +LE ++I PP  PK+KS  D SYFD+DFT EKP LT  DK LL TM+Q+IF+GFSFTN A
Sbjct:   26 GKGVQLVQRKKTIYPEWN-TCFDAHLYDGRCIQMVVMQRPQQLVADVNVGAQHLADKC--RDGEVASVWLDLKPAGRLLIQVRYFP---EEP-------TDPLDTPGNK---SGITGRRGAIKHQKVHEVKGHKFIAKFFRQPTFCSYCGDFLWGLNKQGYQCQVCSAAVHKRCHDRVLGKCPGSAKESRDTKILTERFNINVPHRFRVHNYMSPSFCDHCGTLLYGLFRQGLKCSECGTNCHKKCEKKIPNLCGVNQKILAEAIDNVNRVKSVSGKSSSASQDSSQRSSLG-------NNAISSEDYEKLWDTKHKAINSEMRKFTPTDFSFLKVLGKGSFGKVMLAELKGT-GVHYAIKALKKDIVLEDDDVECTMIEKRILSLSCQHPYLTHLHSTFQSVSHLFFVMEYLNGGDLMFHIQQAGRFDIERSRFYAAEIICGLQFLHERNTIYRDLKLDNVMLDRDGHIKIADFGMCKENVIGESKASTFCGTPDYIAPEILKGLKYNCSVDWWSFGVLLYEMLIGQSPFHGDDEDDLFHSICNDTPHYPRWIKGDAASCISLLLERDAELRLGMPDCTCGPIRSHPFFKTVDWVRLERREIEPPFKPKIKSNTDVSYFDADFTMEKPNLTPPDKDLLKTMDQEIFEGFSFTNMA 657          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A0B6ZCW2 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF58390 PE=3 SV=1)

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 378/684 (55.26%), Postives = 487/684 (71.20%), Query Frame = 1
Query:  145 EKDFIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVR-QDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLW--DTVQETERMMPR-YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTN 2181
            + D +   D  +PY  +N+K+A  ++ GK V+  Q+KK +Y + N    DAH   GRIIQ +VM++PN  +A+ ++  + L + C    G    +W+DL+P G+L + +   P   E+  M              IP       RRGA++ QK+H ++GH F+AKFFR PTYCSFC+EFLWGLNKQGYQCQ+C+CAVHKKCH +IL KCPGSA +SRET +L ERF I+VPH+FKIYNYMSPTFCDHCG +L+GL +QGLKC+ C+ NCHKKCER +P LCGVNQKLLAE L ++R       ++    SP+V         +D + +   E + Y+++W  D V     +  R +  EDF  LKVLGKGSFGKVLL E+K +    +A+KAL+K++VLEDDDV+CT++ERRVLA+G R+ FLT LHSTFQS SHLFF+MEYL GGDLMFHIQ +G+F   +A+FY++EI+C LQ+LH + I+YRDLKLDN+++  DG++KIADFGMCKE    E +A+TFCGTPDYIAPEI++G  YN +VDWWSFGVLLYEMLIGQSPF G+DEDDL  SI +DTP YP +  +EA   +  LF RNP DRLGM +CP G+I   SFF  IDW+KLE KQIPPP  PK+K+ +D S FDSDFT EKP LTL D  LL TMNQ++FK FSFT+
Sbjct:    1 QTDHMSDSDPENPYLAINVKEA-VDIPGKGVQLVQKKKTLYPKWN-TCFDAHIYNGRIIQLIVMEKPNKNIAEISIAAKMLADKCDAATGNSGPVWLDLKPSGKLQIQVKYYPEVNEENEM--------------IPGQAQPFVRRGAMKQQKVHEVKGHHFIAKFFRSPTYCSFCTEFLWGLNKQGYQCQMCNCAVHKKCHDQILGKCPGSAKDSRETMMLTERFKIDVPHRFKIYNYMSPTFCDHCGSMLFGLFRQGLKCEVCSINCHKKCERFMPHLCGVNQKLLAEALQKIRIAGAPGDKKKMQTSPSVNSQTVLINEEDDDEDENGENSVYQEVWGIDDVPRAPAVEVRTFKPEDFTFLKVLGKGSFGKVLLAELK-ETHTFYAVKALRKDVVLEDDDVECTLIERRVLAIGYRNPFLTHLHSTFQSKSHLFFVMEYLNGGDLMFHIQVSGKFEFTRAQFYAAEIVCGLQYLHKNGIVYRDLKLDNVMLDKDGHVKIADFGMCKENILGENRASTFCGTPDYIAPEILKGAKYNSSVDWWSFGVLLYEMLIGQSPFHGDDEDDLFHSILHDTPRYPHATPKEASTMMSLLFERNPTDRLGMPSCPAGTINSQSFFRGIDWQKLEAKQIPPPFKPKIKNASDSSNFDSDFTKEKPNLTLPDPALLKTMNQNVFKHFSFTS 667          
BLAST of Protein kinase C vs. TrEMBL
Match: V4AM51 (Protein kinase C OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_116541 PE=3 SV=1)

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 382/701 (54.49%), Postives = 491/701 (70.04%), Query Frame = 1
Query:  115 GFIRIKICDIEKDFI--DGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIAR---RRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQET----ERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPA 2187
            GFIR+K+  +E+     +  D FDPY  +N+K+   ++ G+  +  Q+K+ +Y   N    DAH   GR+I  VVM+RP   LAD ++  + L E C      +  +W+DLRP G+L +               ++   +  N+++N        R   RRGA++ QK+H ++GH+F+AKFFRQP +CSFCS FLWGLNKQGYQC++C+CAVHKKCH KIL KCPGSA +SRETKIL ERFN+N+PH+FKI NYMSPTFCDHCG +LYGL +QGLKC+ CN+NCHKKCE+ +P LCGVNQK+LA+ L++VR               ++   TS+  Q +E +  ++   Y+ + +    T    E  + R+   DF  L+VLGKGSFGKVLL E+K    Q FAIKALKKEIVLEDDDV+CT++ERR+LALGC+H FLT LHSTFQS +HLFF+MEYL GGDLMFHIQ  G+F  ++A+FY +EI+C LQFLH + +IYRDLKLDN+L+   G+IKIADFGMCKE   ++ KA+TFCGTPDYIAPEI+ G  YN +VD+WSFGVLLYEMLIGQSPF G+DEDDL +SI +DTP YP SL +EA   L  LF RNP+ R+GM  C  G +R   FF  IDWEKLE ++I PP +PK+KS +D S FD DFT EKPQ T T K+LL TMNQ +FK FSFT+ A
Sbjct:    6 GFIRVKLLQVERGSTMQNCQDPFDPYIAINVKET-VDIPGRGPQLIQKKRTLYPNWNS-CFDAHIYEGRVINIVVMERPTKFLADISIGAKMLAEKCN--DSNVTTVWLDLRPSGKLQI---------------QIRYFNENNVSKNSTTEDDFKRGFNRRGAIKQQKVHEVKGHQFIAKFFRQPAFCSFCSLFLWGLNKQGYQCKVCNCAVHKKCHEKILGKCPGSAKDSRETKILSERFNVNIPHRFKINNYMSPTFCDHCGTMLYGLFRQGLKCEVCNSNCHKKCEKFMPNLCGVNQKILADALSQVR---------------ISTPRTSQSSQKEEEDEDSDSESYQPIPEGTGPTRLPSETTVKRFTQNDFNYLRVLGKGSFGKVLLAELKGS-NQYFAIKALKKEIVLEDDDVECTLIERRILALGCKHPFLTHLHSTFQSPTHLFFVMEYLNGGDLMFHIQLTGKFDYERAQFYGAEIVCGLQFLHRNGVIYRDLKLDNVLLDKSGHIKIADFGMCKENIFEDKKASTFCGTPDYIAPEILSGHKYNASVDYWSFGVLLYEMLIGQSPFHGDDEDDLFKSILHDTPRYPHSLPKEAAILLSLLFERNPLIRMGMPGCGNGPVRSQPFFRNIDWEKLENREITPPFLPKIKSASDSSNFDKDFTMEKPQFTPTQKELLKTMNQAVFKNFSFTSNA 671          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:103036366])

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 350/683 (51.24%), Postives = 462/683 (67.64%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLM--VLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMP--------RYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAYN 2193
            P+  + +K++     GK +   QRK  +Y      + DAH   GR+IQ ++MK     L++A V +  + E C  +KG G    W+DL+P G++M  V        TE  P V     D + L  N        RRRGA++  K+H I+ HEF A FF+QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK +NYMSPTFCDHCG LL+G++KQGLKC++C  N H KC+ KV  LCG+NQKLLAE L +V    +++R   ++S      + +   ++   + + + N+Y +LWD    T    P        R   E+FV  KVLGKGSFGKVLL E+K + G+ FA+KALKK++VL DDDV+CTMVE+RVL+L   + FLT L+ TFQS  HLFF+MEYL GGDLMFHIQ  GRF + +A FYS+EIIC LQFLHS  +IYRDLKLDN+++  DG+IKIADFGMCKE    E +ATTFCGTPDYIAPEI+ G  Y  +VDWWSFGVL+YEMLIGQSPF+G+DED+L  SI  D PHYPR +T+E+   L++LF R+P  RLG+     G+IRGHSFF  I+W  LE +++PPP  PK+KSPNDCS FD +F  EKP+L+  DK L+ +M+Q  F GFSF NP+ +
Sbjct:   24 PFCAIKMKESLSTERGKTL--VQRKPTMYPAWKS-SFDAHIYEGRVIQVLLMKTAEETLSEATVGVSVIAERC--KKGNGRAEFWVDLQPSGKVMMSVQFFVEDTDTESRPSVREKEEDGI-LTLN--------RRRGAIKQAKVHFIKNHEFTATFFKQPTFCSVCREFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTVFQKERFKIDMPHRFKTHNYMSPTFCDHCGSLLWGMVKQGLKCEDCAMNVHHKCQTKVANLCGINQKLLAEALTQVSLKSSTKRPDPTLSDIGIYQDIA---KNTPADPSADSNQYGKLWDGSTPTPPAAPSASITHQTRINFENFVFHKVLGKGSFGKVLLAELKGR-GEYFAVKALKKDVVLMDDDVECTMVEKRVLSLAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLFRATFYSAEIICGLQFLHSKGVIYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIGQSPFQGDDEDELFESIRMDVPHYPRWITKESKDLLEKLFERDPTRRLGV----VGNIRGHSFFKTINWPALEKREVPPPFKPKVKSPNDCSNFDREFLSEKPRLSHADKNLIDSMDQTAFSGFSFINPSMD 684          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:103036366])

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 344/675 (50.96%), Postives = 450/675 (66.67%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKG-GMIGLWIDLRPHGRLM--VLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAYN 2193
            P+  + +K++     GK +   QRK  +Y      + DAH   GR+IQ ++MK     L++A V +  + E C  +KG G    W+DL+P G++M  V        T  P + E +    L L R          RRGA++  K+H I+ HEF A FF+QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK +NYMSPTFCDHCG LL+G++KQGLKC++C  N H KC+ KV  LCG+NQKLLAE L +V                         + + + N  ++ N+Y +LWD    T          +FV  KVLGKGSFGKVLL E+K + G+ FA+KALKK++VL DDDV+CTMVE+RVL+L   + FLT L+ TFQS  HLFF+MEYL GGDLMFHIQ  GRF + +A FYS+EIIC LQFLHS  +IYRDLKLDN+++  DG+IKIADFGMCKE    E +ATTFCGTPDYIAPEI+ G  Y  +VDWWSFGVL+YEMLIGQSPF+G+DED+L  SI  D PHYPR +T+E+   L++LF R+P  RLG+     G+IRGHSFF  I+W  LE +++PPP  PK+KSPNDCS FD +F  EKP+L+  DK L+ +M+Q  F GFSF NP+ +
Sbjct:   24 PFCAIKMKESLSTERGKTL--VQRKPTMYPAWKS-SFDAHIYEGRVIQVLLMKTAEETLSEATVGVSVIAERC--KKGNGRAEFWVDLQPSGKVMMSVQFFVEDTDTGGPSVREKEEDGILTLNR----------RRGAIKQAKVHFIKNHEFTATFFKQPTFCSVCREFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTVFQKERFKIDMPHRFKTHNYMSPTFCDHCGSLLWGMVKQGLKCEDCAMNVHHKCQTKVANLCGINQKLLAEALTQV-----------------------SLVGESQHNIMSDSNQYGKLWDGSTPTPP-------ANFVFHKVLGKGSFGKVLLAELKGR-GEYFAVKALKKDVVLMDDDVECTMVEKRVLSLAWENPFLTHLYCTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLFRATFYSAEIICGLQFLHSKGVIYRDLKLDNVMLDKDGHIKIADFGMCKENMIGENRATTFCGTPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIGQSPFQGDDEDELFESIRMDVPHYPRWITKESKDLLEKLFERDPTRRLGV----VGNIRGHSFFKTINWPALEKREVPPPFKPKVKSPNDCSNFDREFLSEKPRLSHADKNLIDSMDQTAFSGFSFINPSMD 648          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcq (protein kinase C theta [Source:NCBI gene;Acc:103040891])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 348/730 (47.67%), Postives = 471/730 (64.52%), Query Frame = 1
Query:  118 FIRIKICDIEKD--FIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLN------LARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSR----------RE-TASISPTVTVNNTSEQIQDKEFNAANEMNRYEQ---LWDT----------VQETERM--MPR-----YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPA 2187
            F+RI     E D      ++  +PY  V +K+A    +G++   Y++K+P        T DAH + GR++  VV  +   +  +A V+++TL   C  E  G + +W++L+P GRL++                L+ SD+ +        R       + +RRGA++  K+H ++ HEF A FF QPT+CS C EF+WGLNKQGYQC+ C+ A+HKKC  K++AKC GSA+ S+ET I +ERF I++PH+FK+YNY SPTFC+HCG LL+G+ +QGLKC+EC+ N H KC++KV  LCGVNQKL+AE LA +   Q +R          RE    +S    V  +   +       A  + R EQ    WDT          ++ +E +  +PR     + +E+F L K+LGKGSFGKV LGE+K+  GQ +A+KALKK++VL DDDV+CTMVERRVL+L   H FLT L+ TFQ+  +LFF+MEYL GGDLMFHIQ   RF + ++ FY++EIIC LQFLHS  I+YRDLKLDNIL+  DG+IKIADFGMCKE    +++ +TFCGTPDYIAPEI+ G  Y  +VDWWSFGVLLYEMLIGQSPF G DE++L +SI  D P YPR LTR+A   L +LF R P  RLG+     G+IR HSFF + DW  LE +Q+ PP  P +KS +DCS FD +F  EKP+L+  D+ L+++M+Q +FK FSF NP 
Sbjct:    5 FLRIGFSSFEMDPGLAYHEEVLNPYCAVYMKEAVETEKGQV---YKQKRPTMYPPWSSTFDAHVHRGRVMHVVVKDKTAELKTEATVQLDTLASRCKKE-NGKLEIWVELKPQGRLLM-----------EARYFLERSDAGHGEGDGETEREKEGVFALHQRRGAIKQAKVHVVKCHEFTATFFPQPTFCSVCKEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSKETMIHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGIARQGLKCEECSMNVHHKCQKKVANLCGVNQKLMAEALAMIEVTQQARTSGRDNELSGREGPVGVSQAGMVKESQGCLPIHSLTPAPPLPRKEQQGIAWDTPPLQGDRRSSIETSEPLYAVPRKEYHKFTLEEFTLHKMLGKGSFGKVFLGELKAT-GQFYAVKALKKDVVLMDDDVECTMVERRVLSLAWEHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQSCHRFDLVRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDFDGHIKIADFGMCKENMLGDVRTSTFCGTPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTRDARDILIKLFVREPERRLGIK----GNIRQHSFFRDTDWNALEKRQVEPPFRPTVKSASDCSNFDKEFINEKPRLSSADRTLINSMDQTMFKNFSFINPG 714          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcq (protein kinase C theta [Source:NCBI gene;Acc:103040891])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 348/730 (47.67%), Postives = 471/730 (64.52%), Query Frame = 1
Query:  118 FIRIKICDIEKD--FIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLN------LARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSR----------RE-TASISPTVTVNNTSEQIQDKEFNAANEMNRYEQ---LWDT----------VQETERM--MPR-----YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPA 2187
            F+RI     E D      ++  +PY  V +K+A    +G++   Y++K+P        T DAH + GR++  VV  +   +  +A V+++TL   C  E  G + +W++L+P GRL++                L+ SD+ +        R       + +RRGA++  K+H ++ HEF A FF QPT+CS C EF+WGLNKQGYQC+ C+ A+HKKC  K++AKC GSA+ S+ET I +ERF I++PH+FK+YNY SPTFC+HCG LL+G+ +QGLKC+EC+ N H KC++KV  LCGVNQKL+AE LA +   Q +R          RE    +S    V  +   +       A  + R EQ    WDT          ++ +E +  +PR     + +E+F L K+LGKGSFGKV LGE+K+  GQ +A+KALKK++VL DDDV+CTMVERRVL+L   H FLT L+ TFQ+  +LFF+MEYL GGDLMFHIQ   RF + ++ FY++EIIC LQFLHS  I+YRDLKLDNIL+  DG+IKIADFGMCKE    +++ +TFCGTPDYIAPEI+ G  Y  +VDWWSFGVLLYEMLIGQSPF G DE++L +SI  D P YPR LTR+A   L +LF R P  RLG+     G+IR HSFF + DW  LE +Q+ PP  P +KS +DCS FD +F  EKP+L+  D+ L+++M+Q +FK FSF NP 
Sbjct:    5 FLRIGFSSFEMDPGLAYHEEVLNPYCAVYMKEAVETEKGQV---YKQKRPTMYPPWSSTFDAHVHRGRVMHVVVKDKTAELKTEATVQLDTLASRCKKE-NGKLEIWVELKPQGRLLM-----------EARYFLERSDAGHGEGDGETEREKEGVFALHQRRGAIKQAKVHVVKCHEFTATFFPQPTFCSVCKEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSKETMIHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGIARQGLKCEECSMNVHHKCQKKVANLCGVNQKLMAEALAMIEVTQQARTSGRDNELSGREGPVGVSQAGMVKESQGCLPIHSLTPAPPLPRKEQQGIAWDTPPLQGDRRSSIETSEPLYAVPRKEYHKFTLEEFTLHKMLGKGSFGKVFLGELKAT-GQFYAVKALKKDVVLMDDDVECTMVERRVLSLAWEHPFLTHLYCTFQTKENLFFVMEYLNGGDLMFHIQSCHRFDLVRSTFYAAEIICGLQFLHSKGIVYRDLKLDNILLDFDGHIKIADFGMCKENMLGDVRTSTFCGTPDYIAPEILLGQKYGTSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRTDDPCYPRWLTRDARDILIKLFVREPERRLGIK----GNIRQHSFFRDTDWNALEKRQVEPPFRPTVKSASDCSNFDKEFINEKPRLSSADRTLINSMDQTMFKNFSFINPG 714          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcda (protein kinase C, delta a [Source:ZFIN;Acc:ZDB-GENE-030131-6503])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 326/672 (48.51%), Postives = 431/672 (64.14%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMM---PRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            P+  V +K+A     GK +   QRK  ++      + DAH   GR++Q ++M+     LA+  V +  L E C  +  G    W+DL+P G++M+              V+  L DS+    +  E   + RRRGA++  KIH I+ HEF+A FFRQPT+CS C +F+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK YNYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC+ KV  LCG+NQKLLAE L +V Q ++++R   +  P        +           +   Y  LW+        +    R   E F   KVLGKGSFGKV L EMKS  G+ FA+KALKK++VL DDDV+CTMVE+RVLAL   + FLT L+STFQ+  HLFF+MEYL GGDLMFHIQ+ GRF + +A   +S                 DLKLDN+++ GDG+IKIADFGMCKE    E  ATTFCGTPDYIAPEI+ G  Y+ +VDWWSFGVL+YEMLIGQSPF G+DED+L  SI  DTPHYPR +T +  + L++LF R+P  RLG+     G+IR  +FF  ++W  LE ++I PP  PK+K+PNDCS FD +F  EKP+L+  +K L+ +M+Q  F GFSF NP
Sbjct:   24 PFCAVKMKEALSTERGKTL--IQRKPTMFPAWRA-SFDAHIYEGRVLQVLLMRTAENPLAEVTVGVSVLAERCK-KANGRAEFWVDLQPSGKVMM-------------SVQYFLEDSIQSVVSEEEAPTLTRRRGAIKQAKIHFIKNHEFIATFFRQPTFCSVCRDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTVFQKERFKIDMPHRFKTYNYMSPTFCDHCGSLLWGLVKQGLKCEDCAMNVHHKCQTKVANLCGINQKLLAEALTQVSQ-KSTKRPDPNADPQTKDTGVYQDFNKSPGPDVTDGTPYGLLWEGSSPRPVSITHQTRITAEHFTFHKVLGKGSFGKVFLAEMKSS-GEWFAVKALKKDVVLMDDDVECTMVEKRVLALAWDNPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLYRATLNTSNYYLV------------DLKLDNVMLDGDGHIKIADFGMCKENVFGENLATTFCGTPDYIAPEILLGQQYSFSVDWWSFGVLVYEMLIGQSPFHGDDEDELFESIRMDTPHYPRWITVDTREMLERLFERDPSRRLGV----VGNIRHQTFFKTVNWSALERREIEPPFKPKVKAPNDCSNFDREFLSEKPRLSHCEKGLIDSMDQTAFAGFSFINP 660          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 496.123 bits (1276), Expect = 1.931e-168
Identity = 251/518 (48.46%), Postives = 329/518 (63.51%), Query Frame = 1
Query:  574 RRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQ------------------------------------NSRRETASISPT--VTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKA--RFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDW 2004
            RRRGA++  K+  ++GH F+  FF QPT+CS C EF+WGLNKQG+QC+ C+ + HK+C   +LA+C GSA  +R+T+I++E FN+++ H FK+++Y SPTFCDHCG LL+G  +QGL+C+ C+ N H KC+ KV  LCG++ + LAE+L +V   Q                                     + R   S  P+   T +   +Q                   ++ + +  +  +  ++ F LLKVLGKGSFGKV+L E+K + G+ FAIKALKKE+VL  DDV+CTMVE+RVL + C H FLT L  TFQ+  HLFF+ME+L GGDLMFHIQ  G+F +     RFY++E+IC LQFLHSH IIYRDLKLDN+L+  +G++KIADFGMCKE       ATTFCGTPDYIAPEI+ G  Y  +VDWWS GVL+YEMLIGQSPF G DED+L  +I   TPHYPR L+  +   L  LF R+   RLG      G IR H FF  IDW
Sbjct:    1 RRRGAIKQAKVKFVKGHAFVTTFFPQPTFCSVCKEFVWGLNKQGFQCKECNASSHKRCVDNVLARCTGSADTNRQTEIVRESFNLHMSHSFKVHSYRSPTFCDHCGTLLWGFARQGLQCEACDANVHHKCKGKVANLCGISTERLAELLRQVEGGQVSCVGRRRGGAGRGILSRSLPEFDCISVETKEKGAPGAERPVESQPPSRKATRSVIFDQRAKGHLTPPQPAPPQSVPDESTRPSGEIAGKLSLDHFHLLKVLGKGSFGKVMLAELKEQ-GKFFAIKALKKEVVLMGDDVECTMVEKRVLLMACEHPFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGSDEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLGA----VGDIRLHPFFKNIDW 513          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 320.857 bits (821), Expect = 2.147e-104
Identity = 151/252 (59.92%), Postives = 190/252 (75.40%), Query Frame = 1
Query: 1252 KVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDW 2004
            +V L E+KS+P   FAIKALKK++V+  DDV+CT+VE+R+L+L   H +L  L+STFQ+  HL F+MEYL GGDLMFHIQ  GRF +D+A FY++EI+  LQFLH   IIYRDLKLDNIL+  DG++KIADFGMCKE    +++A TFCGTPDYIAPEIV G  YN +VDWWSFGVLLYEMLIGQSPFRG+DE++L  SI    P+YPR +T+++   L  L  R P+ RLG++    G IR H FF  I+W
Sbjct:    1 QVFLAELKSRPRNFFAIKALKKDVVIMSDDVECTLVEKRILSLAWGHPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGVT----GEIRQHPFFRTINW 248          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.684 bits (657), Expect = 1.807e-77
Identity = 134/313 (42.81%), Postives = 199/313 (63.58%), Query Frame = 1
Query: 1195 RYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHK-IIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDK 2127
            +  + +F  LK+LGKG+FGKV+L   K+  GQ +A+K LKKE+++  D+V  T+ E RVL    +H FLT L  +FQ+   L F+MEY+ GG+L FH+ +   F+ D+ RFY +EI+ AL +LH+ K ++YRDLKL+N+++  DG+IKIADFG+CKE  +D     TFCGTP+Y+APE++    Y  AVDWW  GV++YEM+ G+ PF  +D + L   I  +   +PR+L+ +A   L  L  ++P  RLG        I  HSFFA I W+ +  +++ PP  P++ S  D  YFD +FT +   +T  D+
Sbjct:  144 KVTMNNFDYLKLLGKGTFGKVILVREKAT-GQYYAMKILKKEVIVAKDEVAHTLTENRVLQT-TKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPDR 454          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 248.44 bits (633), Expect = 1.069e-74
Identity = 138/329 (41.95%), Postives = 194/329 (58.97%), Query Frame = 1
Query: 1210 DFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTM------NQDIFKGFSF 2175
            DF  L VLGKGSFGKVLL + KS  G  +A+K +KK I+L+  +    M ER VL    RH FL  LH +FQS   L+F+M+Y+ GG+L FH+Q+ G F   +A+FY++EI  A+ +LHS  I+YRDLK +NIL+   G+I + DFG+CKE  D    T TFCGTP+Y+APE+++  PY+  VDWW  G +LYEML G  PF  ++   +  SI +         T  A+  L+ L  ++P  RLG +T     I+ H FF+ I+W  L+ K+IP P  P +  P D   FD  FT E   +++      S++        D F GF++
Sbjct:   91 DFDFLTVLGKGSFGKVLLAKHKSD-GIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLG-ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSMAQSSDTSSVCANVDEAADAFVGFTY 417          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002460.1 (pep scaffold:Pmarinus_7.0:GL479588:3:23579:-1 gene:ENSPMAG00000002237.1 transcript:ENSPMAT00000002460.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.098 bits (575), Expect = 8.911e-69
Identity = 109/260 (41.92%), Postives = 160/260 (61.54%), Query Frame = 1
Query:  235 VEYYQRKKPVY----RQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQK 1002
            V Y Q K  +Y     + N +  D H     ++Q +VM      ++D  V +++L + C     G+   W+DL+P GR++  + C         + + D  +S       P    + +RRGA++  K+H ++GH+F A FF QPT+CS C E+  GLNKQGYQC++C+ A+HK+C   +LA C GSA  S ET+I++ERF ++VPH+F++ +YMSPTFCDHCG LL+GL +QGLKC EC  N H KC+ KV  +CG+NQK
Sbjct:    2 VTYIQNKPTMYPRWETKFNTLLHDEH-----LLQVIVMSAAGRPISDTEVPLQSLVQKCRNSAEGIAEFWLDLKPQGRVLTTVQC---------LQDCDCDESARAEARGP----LKKRRGAIKQAKVHHVKGHQFTATFFPQPTFCSVCKEYFKGLNKQGYQCRVCNAAIHKRCIDIVLANCTGSAENSSETQIMKERFKLDVPHRFRVNSYMSPTFCDHCGTLLWGLARQGLKCDECAMNIHHKCKGKVANMCGINQK 243          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: PKC1 (Protein serine/threonine kinase; essential for cell wall remodeling during growth; localized to sites of polarized growth and the mother-daughter bud neck; homolog of the alpha, beta, and gamma isoforms of mammalian protein kinase C (PKC) [Source:SGD;Acc:S000000201])

HSP 1 Score: 293.508 bits (750), Expect = 1.213e-85
Identity = 165/409 (40.34%), Postives = 261/409 (63.81%), Query Frame = 1
Query: 1024 EVRQDQNSR---RETASISPTVT-VNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPR--YCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRV--LALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEM----KATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAYNMNPSDMD 2214
            ++ QD  S+   +ET S++PT T  + T++Q          +  +  Q   + +  +R   R    +++FVLLKVLGKG+FGKV+L + K+   ++ AIK LKK+ ++++ D++    E++V  LA   +H FLT L+ +FQ+ + ++F ME++ GGDLM+H+Q N R +V +A+FY++E++ AL++ H + +IYRDLKL+NIL+  +G+IKIAD+G+CK   DEM    + +TFCGTP+++APEI++   Y +AVDWW+FGVLLY+ML+ QSPF G+DED++  +I  D P YP  +  E +Q  Q L +++P  RLG        +    FF  I+++ +   ++ PP IP++KSP D SYF+ +FT   P LT     +L+T  Q+ F+GFSF        P D+D
Sbjct:  765 QIEQDHASKEVLQETVSLAPTSTHASRTTDQ----------QSPQKSQTSTSAKHKKRAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNT-DRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQ-NQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCK---DEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTSAPPTLTPL-PSVLTTSQQEEFRGFSFM-------PDDLD 1150          

HSP 2 Score: 92.4337 bits (228), Expect = 1.221e-19
Identity = 52/181 (28.73%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  559 FGGIARRRGAV--RHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNT 1095
             GG+  R GA+  R ++I    GH F+ K F     C++C +FL      G+QCQ C    HKKC+  ++ KC   A  S +T   + + N  +PH+F   +     +C HCG +L     +  KC EC   CH +C   VP  CG++ ++  ++L  ++  + ++ +     P+  + ++
Sbjct:  393 MGGL-HRHGAIINRKEEIFEQHGHHFVQKSFYNIMCCAYCGDFL---RYTGFQCQDCKFLCHKKCYTNVVTKC--IAKTSTDTDPDEAKLNHRIPHRFLPTSNRGTKWCCHCGYILPWGRHKVRKCSECGIMCHAQCAHLVPDFCGMSMEMANKILKTIQDTKRNQEKKKRTVPSAQLGSS 567          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 251.906 bits (642), Expect = 1.542e-73
Identity = 145/367 (39.51%), Postives = 221/367 (60.22%), Query Frame = 1
Query: 1120 FNAANEMNRYEQLWDTVQ------------ETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQ-MFAIKALKKEIVLEDDDVDCTMVERRVLA-LGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCK-ECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSF 2175
            F++A  +  Y   W T+             +  R  P   I+DF LLKV+GKGSFGKV+  +++ K  Q ++A+KA++K  ++   +V  T+ ER VLA + C   F+  L  +FQS   L+F++ ++ GG+L +H+Q+ GRF + +ARFY++E++CAL  LH   ++YRDLK +NIL+   G+I + DFG+CK    D+ K  TFCGTP+Y+APE++ G+ Y +AVDWW+ GVLLYEML G  P+  ED   + + I  +   +P    R+A   L  L SR+P  RLG +      IR H FF+++ W++L +K   PP  P + +  D S FD +FT EKP  ++ D + LS   Q  F G+++
Sbjct:  305 FDSAASIRLYNHHWITLDNGLGKINISIDYKPSRNKP-LSIDDFDLLKVIGKGSFGKVM--QVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDC--PFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGYNGA--DEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVD-EYLSESVQKQFGGWTY 663          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 237.269 bits (604), Expect = 2.777e-68
Identity = 148/400 (37.00%), Postives = 234/400 (58.50%), Query Frame = 1
Query:  985 CGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQ-MFAIKALKKEIVLEDDDVDCTMVERRVLA-LGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCK-ECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSF 2175
             G   ++L E+L ++  +Q+   ++  +   + +++ + QI+    +  +    Y +L  TV           I+DF LLKV+GKGSFGKV+  +++ K  Q ++A+KAL+K  ++   +V  T+ ER VLA + C   F+  L  +FQS   L+ ++ ++ GG+L +H+Q  GRF++ ++RFY +E++CAL  LH   +IYRDLK +NIL+   G+I + DFG+CK    D  K  TFCGTP+Y+APEI+ G  Y + VDWW+ G+LLYEM+ G  P+  E+   + + I      +P      A   L  L SR+P  RLG++      IR H FF +I W+KL LK   PP  P +KS  D + FD +FT EKP  ++ D+ L +++ Q  F G+++
Sbjct:  269 IGEQDEVLKEILKKINTNQDIHLDSFHLPLNLKIDSAA-QIRLYNHHWISLERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVM--QVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC--PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGT--DEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASI-QKQFGGWTY 660          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 216.853 bits (551), Expect = 7.868e-64
Identity = 110/270 (40.74%), Postives = 163/270 (60.37%), Query Frame = 1
Query: 1195 RYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDW 2004
            +Y + DF +++ LG GSFG+V L       G+ +AIK LKK+ V++   V+ T  ERR+L L   H FL ++  TFQ   ++F +M+Y+ GG+L   ++++ RF    A+FY++E+I AL++LH+H IIYRDLK +NIL+  +G+IKI DFG  KE   +    T CGTPDYIAPE++   PYN++VDWWS GVL+YEML G +PF           I      YP     + +  L +L + +   R+G        I+ H +F+E+ W
Sbjct:   64 KYTLHDFQIMRTLGTGSFGRVHLVRSVHN-GRYYAIKVLKKQQVVKMKQVEHTNDERRMLKL-VEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEV--QTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVW 329          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 217.238 bits (552), Expect = 9.955e-64
Identity = 124/343 (36.15%), Postives = 187/343 (54.52%), Query Frame = 1
Query:  988 GVNQKLLAEVLAEVRQD-QNSRRETASI---SPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDW 2004
            G  QK L +   E  Q  + S RET +    + + +V     + Q+K           EQ    + +      +Y ++DF +L+ LG GSFG+V L   +   G+ +A+K LKKEIV+    V+ T  ER +L++   H F+ ++  TFQ    +F IM+Y+ GG+L   ++++ RF    A+FY++E+  AL++LHS  IIYRDLK +NIL+  +G+IKI DFG  K   D     T CGTPDYIAPE+V   PYN+++DWWSFG+L+YEML G +PF   +       I      +P     +    L +L +R+   RLG        ++ H +F E+ W
Sbjct:    8 GGGQKSLDDRQGEESQKGETSERETTATESGNESKSVEKEGGETQEKPKQPHVTYYNEEQYKQFIAQARVTSGKYSLQDFQILRTLGTGSFGRVHLIRSRHN-GRYYAMKVLKKEIVVRLKQVEHTNDERLMLSI-VTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVW 346          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 515.383 bits (1326), Expect = 3.914e-173
Identity = 298/710 (41.97%), Postives = 425/710 (59.86%), Query Frame = 1
Query:  178 DPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKR----PNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWG-LNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKIL---QERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFN-----AANEMN----RYEQLWDTVQET--------------------ERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMK-ATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMS-TCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAY 2190
            DPY  V + D +        + +    PV+ +   + V+     GR ++F V       P   +A+  V +E +       K G   +WI L PHG++ V +   P  T      + +        R   E  G   RR     ++IH I  H+F+A + RQPT+CS C++F+WG + KQGYQCQ+C C VHK+CH  ++ KCPG+  ++ ET  L     RF ++VPHKF+  +Y  PTFC+ CG LLYG+++QG++C  C  N H++C + V   CG+N K +AE+L E+            ISP   ++  S+QI+   F+      A +M         + ++V E                       ++ +  ++DF  +KVLGKGSFGKVLL E K    +++AIK LKKE VL+DDDV+CTM+ERRVLAL   H FLT LHS+FQ+   LFF+MEY+ GGDLMF IQ++ +F  +++RFY++E++ ALQFLH + +IYRDLKLDN+L+  DG+IK+ADFGMCKE     K  TTFCGTPDYIAPEI++  PY  +VDWW+ GVL+YEM+ GQ PF  E+E+DL  SI +D   YP  L+REA+  L+   ++N + RLG + T    SIR H+FF  I++EKLE +QI PP  PK++S  D   FD+DFT E+P+LT TD+ ++  ++Q  F+GFSF NP +
Sbjct:   34 DPYLLVKVDDVQIAQTTSKTKTFT---PVWNEEFIVEVEN----GRDLEFAVFHNAIMPPKPFIANTTVSLEEVI------KSGSSEIWIPLEPHGQVHVNIELKPSNTAHQHYHDKE-------QRVFKENPGGINRRRGAMRRRIHQINSHKFMATYLRQPTFCSHCNDFIWGVIGKQGYQCQVCTCVVHKRCHKMVVTKCPGTRQDA-ETMPLGGGSLRFKMDVPHKFEKKSYNRPTFCELCGSLLYGIVRQGMQCTVCKMNVHRRCHQNVANNCGINPKKMAEILEEI-----------GISPD-RIHEESQQIKKPSFHDCTNKPAKKMTPRSVSSPSMMESVNENGLPGSTFKLESHQTSPGERRRHVLRKMTLKDFTFIKVLGKGSFGKVLLAERKGT-DEVYAIKILKKESVLQDDDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKEEPKLTPTDRNVIVNIDQREFRGFSFVNPHF 709          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 305.064 bits (780), Expect = 4.636e-94
Identity = 179/460 (38.91%), Postives = 257/460 (55.87%), Query Frame = 1
Query:  838 HKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFR--------GEDEDDLLRSICYDTP-HYPRSLTREALQCLQQLFSRNPIDRLG-MSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            H F    +     C  C   ++GL + G KC EC    HKKC + +   CG  Q+L+ +  A            +S+ P   +                ++   E L    +          + DF L++V+G+GS+ KV+L E+K K  +++A+K +KKE+V +D+D+D    E+ V      H FL  LHS FQ++S LFF++EY+ GGDLM+H+Q+  R   D ARFYS+EI CAL FLH   +IYRDLKLDN+L+  DG+IK+ D+GMCKE       T TFCGTP+YIAPEI+RG  Y  +VDWW+ GVLLYEML G+SPF          ++ +D L  +  + P   PRSL+ +A   L+   ++NP +RLG      +  I  H+FF  + WE+LE +Q+ PP  P+ + P     FD  FT E  Q T  D ++L T++Q  F+GF + NP
Sbjct:  123 HSFVAKRFSRLAACAFCSDRIWGLGRSGYKCLECKLVVHKKCHKLIKIQCG--QQLMTQGNAM----------HSSLPPIGAI--------------GTKLPTNEDLGPKRKPGSGAGALISVNDFNLIRVIGRGSYAKVMLVELK-KTKRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPPFKPRQEDPYGLENFDPQFTNEDVQFTPDDPKMLETIDQTEFEGFEYINP 555          

HSP 2 Score: 78.9518 bits (193), Expect = 3.093e-15
Identity = 37/78 (47.44%), Postives = 48/78 (61.54%), Query Frame = 1
Query:  577 RRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKC------PGSAMES 792
            RRGA R +KIH + GH F+AK F +   C+FCS+ +WGL + GY+C  C   VHKKCH  I  +C       G+AM S
Sbjct:  108 RRGAKRWRKIHIVNGHSFVAKRFSRLAACAFCSDRIWGLGRSGYKCLECKLVVHKKCHKLIKIQCGQQLMTQGNAMHS 185          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO44925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL8])

HSP 1 Score: 268.085 bits (684), Expect = 5.087e-82
Identity = 165/420 (39.29%), Postives = 230/420 (54.76%), Query Frame = 1
Query:  622 HEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKK--CERKVPPLCG-----------VNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSE-------QIQDKEFNAANEMNRYEQLWDTVQETERMMP-----RYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQ 1803
            H F    ++ P +C  C   L+G+  QG +C  C   VHKKC   +   C     E R       R ++ + ++ +    + P   D  G L    +K  L     NT+  K    +  + P+              +++L  EV    R  +N    + S   +    N  E       Q + + +N   +  R E+     Q+ E+ +      ++  EDF  LKVLGKGSFGKV+L E K    Q++AIK LKK+++++DDDV+CTM E+RVLA+  +  FLT+L   F S   L+F+ME++ GGDLMFHIQQ GRF   +A FY++EI+  L FLH   I+YRDLKLDN+++  DG+IKIADFGMCKE     + T TFCGTPDYIAPEIV   PY  +VDWW+ GVL+YEML GQ
Sbjct:    3 HNFGPHTYKSPCFCDHCGSLLYGVYHQGLKCTACDMNVHKKCEKAVPKLCGADHTERRG------RIHLKISYELREARNLMPM--DPNG-LSDPYVKVKLLPDPDNTSKKKTKIFKESLSPVFNETFEFKIQNKDKDRRLSIEVWDWDRTTRNDFMGSLSFGVSELQKNGVEGWFKLLSQEEGEYYNIPIDDAREEEERKCRQKLEQSLSDPNAKKFRPEDFHFLKVLGKGSFGKVMLAERKGT-DQVYAIKVLKKDVIVQDDDVECTMTEKRVLAVPGKPPFLTQLFCCFHSVDRLYFVMEFVNGGDLMFHIQQAGRFKEPQAVFYAAEIVIGLVFLHKRGIVYRDLKLDNVMLDSDGHIKIADFGMCKESMFNNQTTRTFCGTPDYIAPEIVAYQPYGFSVDWWALGVLIYEMLAGQ 412          

HSP 2 Score: 81.6481 bits (200), Expect = 2.293e-16
Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  835 PHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQ-----KLLAEVLAEVRQDQN 1044
            PH F  + Y SP FCDHCG LLYG+  QGLKC  C+ N HKKCE+ VP LCG +      ++  ++  E+R+ +N
Sbjct:    2 PHNFGPHTYKSPCFCDHCGSLLYGVYHQGLKCTACDMNVHKKCEKAVPKLCGADHTERRGRIHLKISYELREARN 76          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 236.113 bits (601), Expect = 4.410e-70
Identity = 130/343 (37.90%), Postives = 196/343 (57.14%), Query Frame = 1
Query: 1180 ERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTL---TDKQLLSTM---NQDIFKGFSFTNPA 2187
            E   P+    DF+ LKV+GKGSFGKV L + K +  + +AIK L K  + + ++    M ER VL     H FL  LH +FQ+   L+F+++Y+ GG+L FH+Q+   F   +ARFY++EI  A+ +LH  +IIYRDLK +NIL+   G+I + DFG+CKE  D    T TFCGTP+Y+APE++R   Y+++VDWW  G +LYEM+ G  PF   D  ++  +I +       ++++ A   L+ L  ++   RLG     +  IR HSFF  I+W++L  + I PP  P +    D  +FD +F  E    ++    D   +S       D F GF++  P+
Sbjct:   63 ESNNPKAKPSDFLFLKVIGKGSFGKVFLSKNKQE-DKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVREPVPGSVGKSADSNFVSASVDDPDDAFVGFTYVAPS 404          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO43312 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ0])

HSP 1 Score: 242.662 bits (618), Expect = 4.606e-68
Identity = 139/331 (41.99%), Postives = 211/331 (63.75%), Query Frame = 1
Query: 1201 CIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVL--ALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPE-IVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLT-DKQLLSTMNQDIFKGFSFT 2178
             + +F  + VLG+G FGKV+L E ++   ++FAIKALKK  ++  ++V+  + E+R+   A   RH FL  L + FQ+  H+ F+MEY  GGDLM HI  +  F   +  FY++ ++  LQ+LH H+I+YRDLKLDN+L+  +G +KIADFG+CKE      +  TFCGTP+++APE +V    Y  AVDWW  GVL++EML+G+SPF G+DE+++  SI  D   YPR L+ EA+  +++L  RNP  RLG +      ++   FF ++ W+ L  ++I PP +P++K   D S FD +FT E+P LT   + + L+   Q +F  F++T
Sbjct:  608 SMSNFRCISVLGRGHFGKVILAEYRNT-NELFAIKALKKGDIIAREEVESLLAEKRIFLTANKTRHPFLVNLFACFQTQEHVCFVMEYAPGGDLMMHIHAD-VFAESRTVFYTACVVLGLQYLHDHEIVYRDLKLDNLLLDSEGYVKIADFGLCKEDMGYGARTGTFCGTPEFLAPEMLVTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIAIMRRLLRRNPERRLGAAEKDAEEVKKQPFFRDMRWDDLLARKIRPPFVPQVKHAEDVSNFDEEFTSEEPILTPPKEARSLNPDEQGLFADFNYT 936          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 344/677 (50.81%), Postives = 460/677 (67.95%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLM--VLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPT--VTVNNTSEQIQDKEFNAANEMNRYEQLWDTV----QETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            P+  + IK+A     GK +    +KKP          DAH   GR+++ ++M+  +  LA+ +V +  L E C  +  G    W+DL+P G++M  V         E    V+ + + +LN            RRRGA++  KIH I+ HEF+A FFRQPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK  NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC++KV  LCG+NQKLLAE L +V Q  ++RR   ++ P   + + +   ++   E N A+    Y +LW+      Q     + R  +++F+  KVLGKGSFGKVLL E+K   G+ FA+KALKKE+VL DDDV+CTMVE+RVLAL   + FLT L+STFQ+  HLFF+MEYL GGDLMFHIQ+ GRF +++A FYS+EI+C L+FLHS  IIYRDLKLDN+++  +G+IKIADFGMCKE    + +ATTFCGTPDYIAPEI+ G  Y+ +VDWWSFGVLLYEML+GQSPF G+DED+L  SI  DTPHYPR + +EA   L+QLF R P  RLG+     G+IR HSFF  I+W+ LE +++ PP  PK+K+PNDCS FD +F  EKP+L+ +DK  + +M+Q  F GFSF NP
Sbjct:   49 PFCAIKIKEALTTDRGKTL---IQKKPTMYPAWKACFDAHIYEGRVLELLLMRTADEALAEVSVGVSVLAERCK-KANGRAEFWVDLQPSGKVMMAVQYFLEDVDAESKQAVKEEEAPTLN------------RRRGAIKQAKIHFIKNHEFIATFFRQPTFCSVCREFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTVFQKERFKIDMPHRFKTNNYMSPTFCDHCGSLLWGLVKQGLKCEDCAMNVHHKCQKKVANLCGINQKLLAEALTQVSQKSSTRRSDPNLPPMPDIGIYDEVNKLAGLELNDASP---YGRLWEGCSPRPQSRITHLTRINVDNFIFHKVLGKGSFGKVLLAELKGS-GEYFAVKALKKEVVLMDDDVECTMVEKRVLALAWENPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLNRATFYSAEIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGDNRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVGQSPFHGDDEDELFESIRMDTPHYPRWINKEAKDLLEQLFDREPTHRLGV----VGNIRQHSFFKTINWQALERREVEPPFKPKVKAPNDCSNFDREFLSEKPRLSQSDKNFIDSMDQSAFSGFSFINP 701          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 338/673 (50.22%), Postives = 448/673 (66.57%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTV----QETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            P+  + IK+A     GK +    +KKP          DAH   GR+++ ++M+  +  LA+ +V +  L E C  +  G    W+DL+P G++M+ +        Q  + ++D            E   + RRRGA++  KIH I+ HEF+A FFRQPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK  NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC++KV  LCG+NQKLLAE L +V Q       ++  SP                        Y +LW+      Q     + R  +++F+  KVLGKGSFGKVLL E+K   G+ FA+KALKKE+VL DDDV+CTMVE+RVLAL   + FLT L+STFQ+  HLFF+MEYL GGDLMFHIQ+ GRF +++A FYS+EI+C L+FLHS  IIYRDLKLDN+++  +G+IKIADFGMCKE    + +ATTFCGTPDYIAPEI+ G  Y+ +VDWWSFGVLLYEML+GQSPF G+DED+L  SI  DTPHYPR + +EA   L+QLF R P  RLG+     G+IR HSFF  I+W+ LE +++ PP  PK+K+PNDCS FD +F  EKP+L+ +DK  + +M+Q  F GFSF NP
Sbjct:   24 PFCAIKIKEALTTDRGKTL---IQKKPTMYPAWKACFDAHIYEGRVLELLLMRTADEALAEVSVGVSVLAERCK-KANGRAEFWVDLQPSGKVMMAV--------QYFLEDVD-----------EEAPTLNRRRGAIKQAKIHFIKNHEFIATFFRQPTFCSVCREFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTVFQKERFKIDMPHRFKTNNYMSPTFCDHCGSLLWGLVKQGLKCEDCAMNVHHKCQKKVANLCGINQKLLAEALTQVSQ------VSSYASP------------------------YGRLWEGCSPRPQSRITHLTRINVDNFIFHKVLGKGSFGKVLLAELKGS-GEYFAVKALKKEVVLMDDDVECTMVEKRVLALAWENPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLNRATFYSAEIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGDNRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVGQSPFHGDDEDELFESIRMDTPHYPRWINKEAKDLLEQLFDREPTHRLGV----VGNIRQHSFFKTINWQALERREVEPPFKPKVKAPNDCSNFDREFLSEKPRLSQSDKNFIDSMDQSAFSGFSFINP 638          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:101162283])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 338/695 (48.63%), Postives = 453/695 (65.18%), Query Frame = 1
Query:  118 FIRIKICDIEK-DFIDGDDYFDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEK-GGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTS--EQIQDKEFNA-ANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            F+RI I   E  D    +D   P   + +KD+     GK +   QRK  +Y      + DAH   GR+++ ++M+  ++ +A A + +  L E C   K  G    W+DL+P G++ + +        Q  + + D+  +    +   E   + RRRGAVR  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+  C G+A  SRET   +ERF I++PH+FK YNY SPTFCDHCG LL+GL KQGLKC+ C+ N H  C  KV  LCGVNQKLLAE L+++   Q S +++        V +    + ++    +  A++ N+      T     ++     +   V  KVLGKGSFGKVLL E++ K GQ FA+K LKK +VL DDDV+CTMVE+RVLAL   + FLT L+STFQS  HLFF+MEYL GGDLMFHIQ  GRF + +A FY++EI+  L FLHS  I+YRDLKLDNI++  DG+IK+ADFGMC+E  S E +A+TFCGTPDYIAPEI+ G  Y  +VDWWSFGVL+YEMLIGQSPF+G+DED+L  +I  DTPHYPR +T+++   L+QLF ++PI R+ +     G+IR HSFF  I+W  LE +Q+ PP  PK+KSP+DCS FD +F  EKP L+  DK L+ +M+ + F GFSF NP
Sbjct:    4 FLRIAINAYEAGDLPAFNDL--PVCAIRLKDSINTERGKAL--VQRKPTMYPPWM-TSFDAHIYEGRVLEVILMQGTDVTVAKATMGMSVLAERCKKAKTSGKNEFWVDLQPSGKVQMAV--------QFFLEDGDIVATTQSVKPEEETYTLPRRRGAVRQPKIHIIKNHEFIATFFNQPTFCSVCKEFVWGLNKQGYKCKQCNAAIHKKCKDKIIYNCTGTAANSRETMFQKERFKIDMPHRFKAYNYKSPTFCDHCGSLLWGLYKQGLKCEACSMNVHFNCNSKVANLCGVNQKLLAEALSQLTVSQKSSKKSQGSESEAEVPDVGIYQDVKTTTVDPNADDKNKTPTPSPTPSPAPQL--HLTLNHLVFHKVLGKGSFGKVLLAELRGK-GQFFAVKVLKKHVVLMDDDVECTMVEKRVLALAWENPFLTHLYSTFQSNEHLFFVMEYLNGGDLMFHIQDKGRFDITRATFYAAEIVVGLNFLHSRGIVYRDLKLDNIMLDCDGHIKLADFGMCRENISQENRASTFCGTPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIGQSPFQGDDEDELFEAIRTDTPHYPRWITKDSKNLLEQLFIKDPITRMSV----VGNIRLHSFFKSINWTALEKRQVEPPYKPKVKSPSDCSNFDREFLNEKPHLSKCDKNLVESMDCNAFAGFSFINP 678          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 322/677 (47.56%), Postives = 430/677 (63.52%), Query Frame = 1
Query:  181 PYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTECCGGEKGGMIGLWIDLRPHGRLM--VLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPT--VTVNNTSEQIQDKEFNAANEMNRYEQLWDTV----QETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            P+  + IK+A     GK +    +KKP          DAH   GR+++ ++M+  +  LA+ +V +  L E C  +  G    W+DL+P G++M  V         E    V+ + + +LN            RRRGA++  KIH I+ HEF+A FFRQPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+ +C G+A  SR+T   +ERF I++PH+FK  NYMSPTFCDHCG LL+GL+KQGLKC++C  N H KC++KV  LCG+NQKLLAE L +V Q  ++RR   ++ P   + + +   ++   E N A+    Y +LW+      Q     + R  +++F+  KVLGKGSFGKVLL E+K   G+ FA+KALKKE+VL DDDV+CTMVE+RVLAL   + FLT L+STFQ+  HLFF+MEYL GGDLMFHIQ+ GRF +++A FYS+EI+C L+FLHS  IIYRDLKLDN+++  +G+IKIADFGMCKE    + +ATTFCGTPDYIAPEI+ G  Y+ +VDWWSFGVLLYEML+GQSPF G+DED+L  SI  DTPHYPR + +EA   L+Q                                               K+PNDCS FD +F  EKP+L+ +DK  + +M+Q  F GFSF NP
Sbjct:   49 PFCAIKIKEALTTDRGKTL---IQKKPTMYPAWKACFDAHIYEGRVLELLLMRTADEALAEVSVGVSVLAERCK-KANGRAEFWVDLQPSGKVMMAVQYFLEDVDAESKQAVKEEEAPTLN------------RRRGAIKQAKIHFIKNHEFIATFFRQPTFCSVCREFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTVFQKERFKIDMPHRFKTNNYMSPTFCDHCGSLLWGLVKQGLKCEDCAMNVHHKCQKKVANLCGINQKLLAEALTQVSQKSSTRRSDPNLPPMPDIGIYDEVNKLAGLELNDASP---YGRLWEGCSPRPQSRITHLTRINVDNFIFHKVLGKGSFGKVLLAELKGS-GEYFAVKALKKEVVLMDDDVECTMVEKRVLALAWENPFLTHLYSTFQTKEHLFFVMEYLNGGDLMFHIQEKGRFDLNRATFYSAEIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGDNRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVGQSPFHGDDEDELFESIRMDTPHYPRWINKEAKDLLEQ-----------------------------------------------KAPNDCSNFDREFLSEKPRLSQSDKNFIDSMDQSAFSGFSFINP 658          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcdb (protein kinase C delta type [Source:NCBI gene;Acc:101162283])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 301/540 (55.74%), Postives = 386/540 (71.48%), Query Frame = 1
Query:  568 IARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKE-CSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNP 2184
            + RRRGAVR  KIH I+ HEF+A FF QPT+CS C EF+WGLNKQGY+C+ C+ A+HKKC  KI+  C G+A  SRET   +ERF I++PH+FK YNY SPTFCDHCG LL+GL KQGLKC+ C+ N H  C  KV  LCGVNQKLLAE L+++   Q        ++ T+ ++    ++ +  F  A++ N+      T     ++     +   V  KVLGKGSFGKVLL E++ K GQ FA+K LKK +VL DDDV+CTMVE+RVLAL   + FLT L+STFQS  HLFF+MEYL GGDLMFHIQ  GRF + +A FY++EI+  L FLHS  I+YRDLKLDNI++  DG+IK+ADFGMC+E  S E +A+TFCGTPDYIAPEI+ G  Y  +VDWWSFGVL+YEMLIGQSPF+G+DED+L  +I  DTPHYPR +T+++   L+QLF ++PI R+ +     G+IR HSFF  I+W  LE +Q+ PP  PK+KSP+DCS FD +F  EKP L+  DK L+ +M+ + F GFSF NP
Sbjct:   25 LPRRRGAVRQPKIHIIKNHEFIATFFNQPTFCSVCKEFVWGLNKQGYKCKQCNAAIHKKCKDKIIYNCTGTAANSRETMFQKERFKIDMPHRFKAYNYKSPTFCDHCGSLLWGLYKQGLKCEACSMNVHFNCNSKVANLCGVNQKLLAEALSQLTVSQ--------VALTIDLHFCLLKVWECVF-TADDKNKTPTPSPTPSPAPQL--HLTLNHLVFHKVLGKGSFGKVLLAELRGK-GQFFAVKVLKKHVVLMDDDVECTMVEKRVLALAWENPFLTHLYSTFQSNEHLFFVMEYLNGGDLMFHIQDKGRFDITRATFYAAEIVVGLNFLHSRGIVYRDLKLDNIMLDCDGHIKLADFGMCRENISQENRASTFCGTPDYIAPEILLGQKYTFSVDWWSFGVLVYEMLIGQSPFQGDDEDELFEAIRTDTPHYPRWITKDSKNLLEQLFIKDPITRMSV----VGNIRLHSFFKSINWTALEKRQVEPPYKPKVKSPSDCSNFDREFLNEKPHLSKCDKNLVESMDCNAFAGFSFINP 548          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000032747.1 (SMESG000032747.1)

HSP 1 Score: 852.818 bits (2202), Expect = 0.000e+0
Identity = 406/411 (98.78%), Postives = 409/411 (99.51%), Query Frame = 1
Query:  688 GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFS 1920
            GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSE IQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRF+VDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQ+ +
Sbjct:  160 GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSE-IQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFSVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQVLN 569          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000032747.1 (SMESG000032747.1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 406/411 (98.78%), Postives = 409/411 (99.51%), Query Frame = 1
Query:  688 GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFS 1920
            GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSE IQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRF+VDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQ+ +
Sbjct:   65 GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSE-IQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFSVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQVLN 474          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000032747.1 (SMESG000032747.1)

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 406/411 (98.78%), Postives = 409/411 (99.51%), Query Frame = 1
Query:  688 GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFS 1920
            GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSE IQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRF+VDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQ+ +
Sbjct:   34 GLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSE-IQDKEFNAANEMNRYEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFSVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQVLN 443          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000042308.1 (SMESG000042308.1)

HSP 1 Score: 501.901 bits (1291), Expect = 4.652e-167
Identity = 293/719 (40.75%), Postives = 406/719 (56.47%), Query Frame = 1
Query:  175 FDPYFEVNIKDAKYNMEGKLVEYYQRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNI------VLADAAVE-IETLTECCGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQ-----NSRRETASISPTVTVNNTSEQ---IQDKEFNAA------------NEMNRYEQLWDTVQETERMM-------------PRY-CIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYG--SIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFDSDFTCEKPQLTLTDKQL-LSTMNQDIFKGFSFTNPAYNM 2196
             DPY  V + +    + GK     +   P +       V   C    II F V     I       +AD + E IE+ ++            W+DL P G+L +      C      + E+         ++I  F G   R GA+R ++IH I+GH+F    F+Q T+CS C+ F+WGL  QGYQCQ+C C VHK+C+  ++ +CPG       ++    RFNINVPHKF+++ +M P FCDHCG LL+GL++QGL+C+ C  N HK+CE+ V P CGVN K L E + +   +      N R E  S S  +T +        I ++  ++               +N+   L    + ++R++             P+  C+ DF  +KVLGKGSFGKV+L E KS    ++AIK LKKE++L+D+DV+CTM E+R+LAL  +H FLT LHS+FQ+   LFF+MEY+ GGDLMF IQ+  RF   +A FYSSE+  AL FLH H IIYRDLKLDNIL+  +G+ K+ADFGMCKE     K T TFCGTPDYIAPEI+    Y  +VDWW+ GVL+YEM+ G  PF G+ E DL  +I YD+  +P SL   ++  + +   +NP+ RLG      G  +I  H FF EIDW  LE ++I PP  PK++S  D S FD DFT E P LT  +    ++ + +D+F GF F N  YN+
Sbjct:   39 LDPYVIVEVDE---RIVGKSSTKNKNNNPKWSDEISFDVTHGC----IITFTVYHDAAIPPDDFIAIADKSFESIESTSD-----------YWLDLEPEGKLRI-----SCILNGSKIEEISREKLSPGTQSIGGFHGKHYRAGALR-RRIHQIKGHKFQVTLFKQFTFCSLCNSFIWGLWNQGYQCQVCTCVVHKRCYQNVIVRCPGVKDTYSSSEAQLNRFNINVPHKFRVHTFMRPAFCDHCGSLLFGLMRQGLQCEACKLNIHKRCEKNVAPHCGVNTKDLVEAIKKCGLNPLDLGYNPRYERTSTSANITDSTQKSSDLPIHERSLSSPIPTHPDNYPITIEPVNKCLVLNSGDRSSKRVISHRPSSLQEYGDTPKVPCLSDFNFVKVLGKGSFGKVILAEHKST-CDVYAIKILKKEVILQDEDVECTMTEQRILALAAKHPFLTALHSSFQTDDRLFFVMEYVNGGDLMFQIQRVRRFDEPRACFYSSEVTLALMFLHKHGIIYRDLKLDNILLDAEGHCKLADFGMCKEGMSGSKLTSTFCGTPDYIAPEILAEQDYGFSVDWWALGVLMYEMMAGAPPFEGDTEQDLFNAISYDSVSFPSSLQPASVDIVSKFLIKNPLKRLGCVAHEGGQQAIMRHPFFREIDWVLLEERRIRPPFRPKVRSRTDTSNFDKDFTSEDPVLTPIENSCEIAALGKDVFAGFDFFNTDYNI 732          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000042308.1 (SMESG000042308.1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.245e-157
Identity = 259/588 (44.05%), Postives = 355/588 (60.37%), Query Frame = 1
Query:  430 WIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLARNIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLNKQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKFKIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVNQKLLAEVLAEVRQDQ-----NSRRETASISPTVTVNNTSEQ---IQDKEFNAA------------NEMNRYEQLWDTVQETERMM-------------PRY-CIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMFAIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFFIMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLKLDNILIAGDGNIKIADFGMCKECSDEMKAT-TFCGTPDYIAPEIVRGVPYNEAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREALQCLQQLFSRNPIDRLGMSTCPYG--SIRGHSFFAEIDWXXXXXXXXXXXXXXXXXSPNDCSYFD 2082
            W+DL P G+L +      C      + E+         ++I  F G   R GA+R ++IH I+GH+F    F+Q T+CS C+ F+WGL  QGYQCQ+C C VHK+C+  ++ +CPG       ++    RFNINVPHKF+++ +M P FCDHCG LL+GL++QGL+C+ C  N HK+CE+ V P CGVN K L E + +   +      N R E  S S  +T +        I ++  ++               +N+   L    + ++R++             P+  C+ DF  +KVLGKGSFGKV+L E KS    ++AIK LKKE++L+D+DV+CTM E+R+LAL  +H FLT LHS+FQ+   LFF+MEY+ GGDLMF IQ+  RF   +A FYSSE+  AL FLH H IIYRDLKLDNIL+  +G+ K+ADFGMCKE     K T TFCGTPDYIAPEI+    Y  +VDWW+ GVL+YEM+ G  PF G+ E DL  +I YD+  +P SL   ++  + +   +NP+ RLG      G  +I  H FF EIDW  LE ++I PP  PK++S  D S FD
Sbjct:  113 WLDLEPEGKLRI-----SCILNGSKIEEISREKLSPGTQSIGGFHGKHYRAGALR-RRIHQIKGHKFQVTLFKQFTFCSLCNSFIWGLWNQGYQCQVCTCVVHKRCYQNVIVRCPGVKDTYSSSEAQLNRFNINVPHKFRVHTFMRPAFCDHCGSLLFGLMRQGLQCEACKLNIHKRCEKNVAPHCGVNTKDLVEAIKKCGLNPLDLGYNPRYERTSTSANITDSTQKSSDLPIHERSLSSPIPTHPDNYPITIEPVNKCLVLNSGDRSSKRVISHRPSSLQEYGDTPKVPCLSDFNFVKVLGKGSFGKVILAEHKST-CDVYAIKILKKEVILQDEDVECTMTEQRILALAAKHPFLTALHSSFQTDDRLFFVMEYVNGGDLMFQIQRVRRFDEPRACFYSSEVTLALMFLHKHGIIYRDLKLDNILLDAEGHCKLADFGMCKEGMSGSKLTSTFCGTPDYIAPEILAEQDYGFSVDWWALGVLMYEMMAGAPPFEGDTEQDLFNAISYDSVSFPSSLQPASVDIVSKFLIKNPLKRLGCVAHEGGQQAIMRHPFFREIDWVLLEERRIRPPFRPKVRSRTDTSNFD 693          
The following BLAST results are available for this feature:
BLAST of Protein kinase C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCD0.000e+048.77protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD0.000e+048.77protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD0.000e+048.77protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD0.000e+048.77protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD0.000e+048.77protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpa-10.000e+047.08Protein kinase C-like 1 [Source:UniProtKB/Swiss-P... [more]
tpa-11.348e-652.05Protein kinase C-like 1 [Source:UniProtKB/Swiss-P... [more]
tpa-11.348e-652.05Protein kinase C-like 1 [Source:UniProtKB/Swiss-P... [more]
pkc-11.166e-18043.85Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
pkc-16.171e-18043.85Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkcdelta0.000e+052.89gene:FBgn0259680 transcript:FBtr0299936[more]
Pkcdelta0.000e+052.89gene:FBgn0259680 transcript:FBtr0299937[more]
Pkc98E4.955e-17539.46gene:FBgn0003093 transcript:FBtr0339149[more]
Pkc98E6.923e-17439.54gene:FBgn0003093 transcript:FBtr0339150[more]
Pkc98E6.923e-17439.54gene:FBgn0003093 transcript:FBtr0085359[more]
back to top
BLAST of Protein kinase C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcdb0.000e+051.63protein kinase C, delta b [Source:ZFIN;Acc:ZDB-GEN... [more]
BX005175.10.000e+052.23protein kinase C, delta b [Source:NCBI gene;Acc:10... [more]
prkcda0.000e+050.37protein kinase C, delta a [Source:ZFIN;Acc:ZDB-GEN... [more]
prkcq0.000e+048.34protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-... [more]
prkcq0.000e+048.86protein kinase C, theta [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam76b0.000e+051.04family with sequence similarity 76 member B [Sourc... [more]
fam76b0.000e+050.89family with sequence similarity 76 member B [Sourc... [more]
fam76b0.000e+050.15family with sequence similarity 76 member B [Sourc... [more]
fam76b0.000e+048.37family with sequence similarity 76 member B [Sourc... [more]
fam76b0.000e+047.37family with sequence similarity 76 member B [Sourc... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkcd0.000e+050.30protein kinase C, delta [Source:MGI Symbol;Acc:MGI... [more]
Prkcd0.000e+049.00protein kinase C, delta [Source:MGI Symbol;Acc:MGI... [more]
Prkcd0.000e+049.00protein kinase C, delta [Source:MGI Symbol;Acc:MGI... [more]
Prkcq0.000e+048.13protein kinase C, theta [Source:MGI Symbol;Acc:MGI... [more]
Prkcd2.839e-656.40protein kinase C, delta [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Protein kinase C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09215|KPCD_RAT0.000e+050.29Protein kinase C delta type OS=Rattus norvegicus O... [more]
sp|P28867|KPCD_MOUSE0.000e+050.30Protein kinase C delta type OS=Mus musculus OX=100... [more]
sp|Q05655|KPCD_HUMAN0.000e+048.77Protein kinase C delta type OS=Homo sapiens OX=960... [more]
sp|Q5PU49|KPCD_CANLF0.000e+048.35Protein kinase C delta type OS=Canis lupus familia... [more]
sp|Q04759|KPCT_HUMAN0.000e+048.63Protein kinase C theta type OS=Homo sapiens OX=960... [more]
back to top
BLAST of Protein kinase C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NTK60.000e+054.91Protein kinase C OS=Pomacea canaliculata OX=400727... [more]
A0A2C9JCV20.000e+054.74Protein kinase C OS=Biomphalaria glabrata OX=6526 ... [more]
R7UCD00.000e+057.93Protein kinase C OS=Capitella teleta OX=283909 GN=... [more]
A0A0B6ZCW20.000e+055.26Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
V4AM510.000e+054.49Protein kinase C OS=Lottia gigantea OX=225164 GN=L... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcdb0.000e+051.24protein kinase C delta type [Source:NCBI gene;Acc:... [more]
prkcdb0.000e+050.96protein kinase C delta type [Source:NCBI gene;Acc:... [more]
prkcq0.000e+047.67protein kinase C theta [Source:NCBI gene;Acc:10304... [more]
prkcq0.000e+047.67protein kinase C theta [Source:NCBI gene;Acc:10304... [more]
prkcda0.000e+048.51protein kinase C, delta a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCD1.931e-16848.46protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD2.147e-10459.92protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000008480.11.807e-7742.81pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000006766.11.069e-7441.95pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000002460.18.911e-6941.92pep scaffold:Pmarinus_7.0:GL479588:3:23579:-1 gene... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PKC11.213e-8540.34Protein serine/threonine kinase; essential for cel... [more]
YPK11.542e-7339.51S/T protein kinase; phosphorylates, downregulates ... [more]
YPK22.777e-6837.00Protein kinase similar to S/T protein kinase Ypk1p... [more]
TPK27.868e-6440.74cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK19.955e-6436.15cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355853.914e-17341.97Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO449384.636e-9438.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449255.087e-8239.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378004.410e-7037.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433124.606e-6841.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcda0.000e+050.81protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
prkcda0.000e+050.22protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
prkcdb0.000e+048.63protein kinase C delta type [Source:NCBI gene;Acc:... [more]
prkcda0.000e+047.56protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
prkcdb0.000e+055.74protein kinase C delta type [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein kinase C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032747.10.000e+098.78SMESG000032747.1[more]
SMESG000032747.10.000e+098.78SMESG000032747.1[more]
SMESG000032747.10.000e+098.78SMESG000032747.1[more]
SMESG000042308.14.652e-16740.75SMESG000042308.1[more]
SMESG000042308.14.245e-15744.05SMESG000042308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015172 ID=SMED30015172|Name=Protein kinase C|organism=Schmidtea mediterranea sexual|type=transcript|length=2416bp
GTTTGTGAACGTATTTAAATAACGTTTTAAAATCTAAAATTTACTAAAAA
TCAAAATTTTGAAATTTGTAAAAATTAAATAAAATACTTTGATAAAATGA
AATTTGTATCTAAAGGATTTATTCGGATAAAAATTTGTGATATTGAAAAA
GATTTTATAGATGGCGATGATTATTTTGATCCTTATTTTGAAGTGAATAT
TAAAGATGCTAAATATAATATGGAAGGGAAATTAGTAGAATATTATCAAA
GAAAGAAACCGGTTTACAGGCAAATAAATGGCATGACTGTTGATGCGCAT
TGCAATCCCGGTCGAATTATCCAGTTCGTCGTGATGAAACGACCTAATAT
AGTATTAGCTGATGCAGCAGTCGAAATTGAAACTTTGACTGAGTGCTGCG
GAGGAGAGAAAGGCGGAATGATTGGTCTATGGATTGATCTGAGGCCTCAC
GGCCGACTGATGGTGTTACTTCTGTGCGTTCCGTGTGCAACAGAGCAACC
TCCAATGGTCGAATTGGACTTGTCAGATTCTCTCAATCTTGCTCGCAACA
TTCCAGAGTTCGGTGGGATAGCCAGACGCAGAGGAGCTGTCCGTCATCAG
AAAATTCACGCCATTCAAGGTCATGAATTCCTCGCGAAATTTTTCCGCCA
ACCAACTTATTGTTCCTTTTGTTCGGAATTTCTCTGGGGGCTCAACAAAC
AAGGATACCAATGTCAACTTTGTCATTGCGCCGTACACAAAAAATGTCAT
GTCAAAATACTTGCCAAATGCCCTGGTAGTGCTATGGAGAGTCGCGAAAC
AAAGATTCTGCAAGAACGATTTAATATAAACGTCCCTCACAAGTTTAAGA
TCTATAATTACATGTCCCCGACATTTTGCGATCACTGTGGCAGGCTGTTG
TACGGGCTCATTAAACAAGGCTTGAAATGCCAAGAATGTAATACAAACTG
CCACAAGAAATGCGAAAGAAAAGTACCTCCGCTTTGCGGCGTCAACCAAA
AGCTATTGGCTGAGGTGCTAGCAGAAGTGCGGCAGGATCAGAATAGCCGC
AGAGAGACAGCATCAATAAGTCCGACAGTTACCGTGAACAATACGAGTGA
ACAGATTCAAGATAAGGAATTCAACGCAGCTAATGAAATGAACCGATACG
AACAATTATGGGATACCGTCCAAGAGACAGAAAGGATGATGCCTAGATAC
TGCATTGAGGATTTTGTTCTCTTGAAGGTTCTGGGAAAAGGCAGTTTTGG
AAAGGTTTTGCTGGGCGAAATGAAATCGAAACCCGGGCAAATGTTTGCCA
TTAAAGCGCTGAAAAAGGAAATTGTCCTTGAAGATGACGATGTTGATTGT
ACAATGGTCGAGAGGCGTGTTCTAGCACTGGGCTGTCGGCACGCTTTTCT
AACCAAGCTCCACAGCACATTCCAATCTACTAGTCATCTATTTTTCATCA
TGGAATATCTCTTTGGGGGAGATCTGATGTTCCACATACAGCAAAATGGC
CGTTTCACAGTTGATAAAGCCCGCTTTTATTCCTCTGAAATAATATGTGC
TCTTCAATTTTTACATAGTCACAAGATTATCTATAGAGATTTGAAATTGG
ACAACATTCTCATTGCCGGTGATGGCAACATAAAGATTGCTGATTTTGGC
ATGTGCAAGGAGTGCTCCGATGAAATGAAGGCAACGACCTTCTGTGGCAC
TCCGGATTACATTGCTCCAGAGATTGTCCGTGGAGTGCCCTACAATGAGG
CTGTCGATTGGTGGTCATTCGGAGTGTTGCTGTACGAAATGTTGATTGGG
CAATCGCCGTTTCGTGGCGAAGATGAGGATGATCTATTGAGGTCGATTTG
TTACGATACGCCTCATTATCCTCGCTCATTAACTCGGGAGGCCCTCCAGT
GCTTGCAGCAGCTTTTCTCGAGGAATCCCATCGACCGCCTCGGTATGTCT
ACATGTCCCTATGGTAGCATCAGAGGCCATAGTTTCTTTGCAGAAATTGA
CTGGGAGAAATTGGAACTGAAACAAATCCCTCCGCCATTGATACCAAAAT
TAAAATCTCCCAATGACTGTTCCTATTTCGACAGTGATTTCACCTGCGAA
AAGCCCCAGCTGACACTCACAGATAAGCAACTGTTGAGTACAATGAACCA
AGACATTTTCAAAGGGTTTTCCTTTACTAATCCGGCATACAACATGAATC
CCAGCGACATGGACTAGTTGCCATGCGTTGTTGTCGTCTTCGTTGTTGTT
GTTGTGGTCTGAGATGTCCGGTTGTTATTGGTTATTTGATTTCCTCTGTT
TTATCCGTTGTAACGTGCTACTATCAGATATTGGTGTTTAGGTTATATTA
TGGTACATACATTTTGCAATAAATGTTTTTGTCGGTGGGATAGTCCTCGT
TGGTCCTCATTTGATA
back to top

protein sequence of SMED30015172-orf-1

>SMED30015172-orf-1 ID=SMED30015172-orf-1|Name=SMED30015172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=707bp
MKFVSKGFIRIKICDIEKDFIDGDDYFDPYFEVNIKDAKYNMEGKLVEYY
QRKKPVYRQINGMTVDAHCNPGRIIQFVVMKRPNIVLADAAVEIETLTEC
CGGEKGGMIGLWIDLRPHGRLMVLLLCVPCATEQPPMVELDLSDSLNLAR
NIPEFGGIARRRGAVRHQKIHAIQGHEFLAKFFRQPTYCSFCSEFLWGLN
KQGYQCQLCHCAVHKKCHVKILAKCPGSAMESRETKILQERFNINVPHKF
KIYNYMSPTFCDHCGRLLYGLIKQGLKCQECNTNCHKKCERKVPPLCGVN
QKLLAEVLAEVRQDQNSRRETASISPTVTVNNTSEQIQDKEFNAANEMNR
YEQLWDTVQETERMMPRYCIEDFVLLKVLGKGSFGKVLLGEMKSKPGQMF
AIKALKKEIVLEDDDVDCTMVERRVLALGCRHAFLTKLHSTFQSTSHLFF
IMEYLFGGDLMFHIQQNGRFTVDKARFYSSEIICALQFLHSHKIIYRDLK
LDNILIAGDGNIKIADFGMCKECSDEMKATTFCGTPDYIAPEIVRGVPYN
EAVDWWSFGVLLYEMLIGQSPFRGEDEDDLLRSICYDTPHYPRSLTREAL
QCLQQLFSRNPIDRLGMSTCPYGSIRGHSFFAEIDWEKLELKQIPPPLIP
KLKSPNDCSYFDSDFTCEKPQLTLTDKQLLSTMNQDIFKGFSFTNPAYNM
NPSDMD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004698calcium-dependent protein kinase C activity
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004697protein kinase C activity
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR020454DAG/PE-bd
IPR002219PE/DAG-bd
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR017892Pkinase_C
IPR014376Prot_kin_PKC_delta
IPR000008C2_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular