FGE-sulfatase domain-containing protein

Overview
NameFGE-sulfatase domain-containing protein
Smed IDSMED30015167
Length (bp)1439
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FGE-sulfatase domain-containing protein (SMED30015167) t-SNE clustered cells

Violin plots show distribution of expression levels for FGE-sulfatase domain-containing protein (SMED30015167) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FGE-sulfatase domain-containing protein (SMED30015167) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FGE-sulfatase domain-containing protein (SMED30015167) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015167

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30015167SMESG000000702.1 dd_Smed_v4_8393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015167SMESG000000702.1 dd_Smed_v4_8393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015167SMESG000000702.1 dd_Smed_v4_8393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015167SMESG000000702.1 dd_Smed_v4_8393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30015167SMESG000000702.1 dd_Smed_v6_8393_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015167SMESG000000702.1 OX_Smed_1.0.07097ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Human
Match: SUMF2 (sulfatase modifying factor 2 [Source:HGNC Symbol;Acc:HGNC:20415])

HSP 1 Score: 209.534 bits (532), Expect = 1.840e-63
Identity = 117/276 (42.39%), Postives = 161/276 (58.33%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            SM       F+MGTN    +  G+ P R    KPF ID +PVT  DF++FV+EK+Y  T+ ++  +S+VF   V  ++     + M    W++PV  A W +P G    I +   +PV+HVS+ DA  YC    KRLPTE EWE AAR   K   YPWG+  + NR N+WQGKFP  D   DGF  VSPVNAFP QN++G+YD+LGNVWEWT + Y       +Q  R   VL+G S++DT +G    +  R + ++       ++N+GFRC+ DA
Sbjct:   29 SMVQLQGGRFLMGTNSPDSRD-GDGPVREATVKPFAIDIFPVTNKDFRDFVREKKY-RTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPYQA----AEQDMR---VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCAADA 294          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Human
Match: SUMF2 (sulfatase modifying factor 2 [Source:HGNC Symbol;Acc:HGNC:20415])

HSP 1 Score: 209.92 bits (533), Expect = 1.942e-63
Identity = 116/276 (42.03%), Postives = 161/276 (58.33%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            SM       F+MGTN    +  G+ P R    KPF ID +PVT  DF++FV+EK+Y  T+ ++  +S+VF   V  ++     + M    W++PV  A W +P G    I +   +PV+HVS+ DA  YC    KRLPTE EWE AAR   K   YPWG+  + NR N+WQGKFP  D   DGF  VSPVNAFP QN++G+YD+LGNVWEWT + Y      +  +R    VL+G S++DT +G    +  R + ++       ++N+GFRC+ DA
Sbjct:   48 SMVQLQGGRFLMGTNSPDSRD-GDGPVREATVKPFAIDIFPVTNKDFRDFVREKKY-RTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPY---QAAEQDMR----VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCAADA 313          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Human
Match: SUMF2 (sulfatase modifying factor 2 [Source:HGNC Symbol;Acc:HGNC:20415])

HSP 1 Score: 197.208 bits (500), Expect = 4.017e-58
Identity = 108/245 (44.08%), Postives = 145/245 (59.18%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGD 1021
            SM       F+MGTN    +  G+ P R    KPF ID +PVT  DF++FV+EK+Y  T+ ++  +S+VF   V  ++     + M    W++PV  A W +P G    I +   +PV+HVS+ DA  YC    KRLPTE EWE AAR   K   YPWG+  + NR N+WQGKFP  D   DGF  VSPVNAFP QN++G+YD+LGNVWEWT + Y      +  +R    VL+G S++DT +G 
Sbjct:   29 SMVQLQGGRFLMGTNSPDSRD-GDGPVREATVKPFAIDIFPVTNKDFRDFVREKKY-RTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPY---QAAEQDMR----VLRGASWIDTADGS 264          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Human
Match: SUMF2 (sulfatase modifying factor 2 [Source:HGNC Symbol;Acc:HGNC:20415])

HSP 1 Score: 193.356 bits (490), Expect = 1.723e-57
Identity = 113/276 (40.94%), Postives = 154/276 (55.80%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            SM       F+MGTN    +  G+ P R    KPF ID +PVT  DF++FV+EK+Y  T+ ++  +S+VF   V  ++     + M               KP G    I +   +PV+HVS+ DA  YC    KRLPTE EWE AAR   K   YPWG+  + NR N+WQGKFP  D   DGF  VSPVNAFP QN++G+YD+LGNVWEWT + Y       +Q  R   VL+G S++DT +G    +  R + ++       ++N+GFRC+ DA
Sbjct:   29 SMVQLQGGRFLMGTNSPDSRD-GDGPVREATVKPFAIDIFPVTNKDFRDFVREKKY-RTEAEMFGWSFVFEDFVSDELRNKATQPM---------------KPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPYQA----AEQDMR---VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCAADA 279          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Human
Match: SUMF2 (sulfatase modifying factor 2 [Source:HGNC Symbol;Acc:HGNC:20415])

HSP 1 Score: 193.356 bits (490), Expect = 2.788e-57
Identity = 112/276 (40.58%), Postives = 154/276 (55.80%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            SM       F+MGTN    +  G+ P R    KPF ID +PVT  DF++FV+EK+Y T + ++  +S+VF   V  ++     + M               KP G    I +   +PV+HVS+ DA  YC    KRLPTE EWE AAR   K   YPWG+  + NR N+WQGKFP  D   DGF  VSPVNAFP QN++G+YD+LGNVWEWT + Y      +  +R    VL+G S++DT +G    +  R + ++       ++N+GFRC+ DA
Sbjct:   48 SMVQLQGGRFLMGTNSPDSRD-GDGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRT-EAEMFGWSFVFEDFVSDELRNKATQPM---------------KPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPY---QAAEQDMR----VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCAADA 298          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Fly
Match: CG7049 (gene:FBgn0035102 transcript:FBtr0072537)

HSP 1 Score: 154.451 bits (389), Expect = 1.476e-42
Identity = 100/286 (34.97%), Postives = 151/286 (52.80%), Query Frame = 2
Query:  281 IGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMND-----EPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDR-MRRNR--MNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            I  M +    +  MGT+   + +  E+P+R      F ID+Y V+   F  FV    Y TT+ +    S++F    +  +   ++K + D       W+  V G  W  P G+  +I  +  +PVVHVS+ DA  YC+   KRLP+E EWE A R   +   +PWG++ M RN   +NIWQG FP+ +   DGF + SPV+AF RQN + +++M+GNVWEWT   +  ND+  +  R    V KGGS+L   +        RC+ +       +A N+GFRC+ +A
Sbjct:   64 IADMSLLPGGTVYMGTDKPHFPADREAPERQVKLNDFYIDKYEVSNEAFAKFVLHTNY-TTEAERYGDSFLF----KSLLSPLEQKNLEDFRVASAVWWYKVAGVNWRHPNGVDSDIDHLGRHPVVHVSWRDAVEYCKWAGKRLPSEAEWEAACRGGKERKLFPWGNKLMPRNEHWLNIWQGDFPDGNLAEDGFEYTSPVDAF-RQNIYDLHNMVGNVWEWTADLWDVNDVSDNPNR----VKKGGSYLCHKS---YCYRYRCAARSQNTEDSSAGNLGFRCAKNA 336          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Zebrafish
Match: sumf2 (sulfatase modifying factor 2 [Source:ZFIN;Acc:ZDB-GENE-041010-55])

HSP 1 Score: 201.445 bits (511), Expect = 1.204e-60
Identity = 105/267 (39.33%), Postives = 160/267 (59.93%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
             +MGT+    +  GESP R    +PFKID+YPVT ++F+ FV+ ++Y  T+ +   +S+VF   V +++     + +   PW++PV    W +P G    I      PVV VS+ DA  YCQ   KRLPTE EWE+AAR   +   YPWG++   NR N+WQG FP++D   DG+  V+PV A+P QN++G+YDMLGNVWEWT++ + G         +   VL+G S++DT +G    +  R + ++       ++N+GFRC+M++
Sbjct:   35 MLMGTSAADGRD-GESPTRAVALQPFKIDKYPVTNSNFREFVRLQKY-KTEAETFGWSFVFQDFVSEELKSKVTQKIESAPWWLPVEKVFWRQPAGPGSGIKDRLDCPVVQVSWNDAQAYCQWKKKRLPTEEEWEMAARGGLEGRSYPWGNKYLLNRTNLWQGPFPDKDSAEDGYHGVAPVTAYPPQNNYGLYDMLGNVWEWTSSSFPG--------AQSMFVLRGASWIDTADGSANHR-ARVTTRMGNTADSASDNLGFRCAMNS 290          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Zebrafish
Match: sumf1 (sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-GENE-060421-3113])

HSP 1 Score: 161.77 bits (408), Expect = 8.024e-45
Identity = 99/275 (36.00%), Postives = 139/275 (50.55%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMR---RNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT----TTEYIGNDL--PKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            F+MGT+D      GE P+R      F I+ + VT   FQ+F  +  Y T        S+VF   + +++       +   PW+ PV GA W  P G    I     +P +HVS+ DA  YCQ   +RLPTE EWELA R   +   YPWG+++    ++  N+WQG FPN +   DG+ + SPV +FP  N FG+YDM+GN WEWT    T  +   D   PK        V KGGS++   +        RC+ +       +A N+GFRC+ D
Sbjct:   98 FLMGTDDPGIPQDGEGPQRKVKLDAFYIEEHEVTNQQFQHFTNQTGYITEAERFGD-SFVFEGLLSEEVKSTLSHAVAAAPWWSPVKGADWRHPEGPDSTIHNRMNHPALHVSWDDARAYCQWAKRRLPTEAEWELACRGGLQDRMYPWGNKLMPRGQHYANLWQGDFPNHNTAEDGYANTSPVMSFP-ANGFGLYDMVGNAWEWTADWWTVHHSAEDKFNPKGPESGTDRVKKGGSYMCHKS---YCYRYRCAARSQNTPDSSASNLGFRCASD 367          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Zebrafish
Match: sumf1 (sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-GENE-060421-3113])

HSP 1 Score: 161.77 bits (408), Expect = 9.177e-45
Identity = 99/275 (36.00%), Postives = 139/275 (50.55%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRM---RRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT----TTEYIGNDL--PKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            F+MGT+D      GE P+R      F I+ + VT   FQ+F  +  Y T        S+VF   + +++       +   PW+ PV GA W  P G    I     +P +HVS+ DA  YCQ   +RLPTE EWELA R   +   YPWG+++    ++  N+WQG FPN +   DG+ + SPV +FP  N FG+YDM+GN WEWT    T  +   D   PK        V KGGS++   +        RC+ +       +A N+GFRC+ D
Sbjct:   98 FLMGTDDPGIPQDGEGPQRKVKLDAFYIEEHEVTNQQFQHFTNQTGYITEAERFGD-SFVFEGLLSEEVKSTLSHAVAAAPWWSPVKGADWRHPEGPDSTIHNRMNHPALHVSWDDARAYCQWAKRRLPTEAEWELACRGGLQDRMYPWGNKLMPRGQHYANLWQGDFPNHNTAEDGYANTSPVMSFP-ANGFGLYDMVGNAWEWTADWWTVHHSAEDKFNPKGPESGTDRVKKGGSYMCHKS---YCYRYRCAARSQNTPDSSASNLGFRCASD 367          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Zebrafish
Match: sumf1 (sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-GENE-060421-3113])

HSP 1 Score: 114.005 bits (284), Expect = 1.194e-27
Identity = 86/272 (31.62%), Postives = 117/272 (43.01%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT----TTEYIGNDL--PKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            F+MGT+D      GE P+R      F I+ + VT   FQ+F  +  Y T        S+VF   + +++       +   PW+ PV GA W  P G    I     +P +HVS+ DA  YCQ   +RLPTE EWELA R   +       DR                            V +FP  N FG+YDM+GN WEWT    T  +   D   PK        V KGGS++   +        RC+ +       +A N+GFRC+ D
Sbjct:   98 FLMGTDDPGIPQDGEGPQRKVKLDAFYIEEHEVTNQQFQHFTNQTGYITEAERFGD-SFVFEGLLSEEVKSTLSHAVAAAPWWSPVKGADWRHPEGPDSTIHNRMNHPALHVSWDDARAYCQWAKRRLPTEAEWELACRGGLQ-------DR-------------------------CISVMSFP-ANGFGLYDMVGNAWEWTADWWTVHHSAEDKFNPKGPESGTDRVKKGGSYMCHKS---YCYRYRCAARSQNTPDSSASNLGFRCASD 332          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Zebrafish
Match: sumf1 (sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-GENE-060421-3113])

HSP 1 Score: 113.62 bits (283), Expect = 1.511e-27
Identity = 86/272 (31.62%), Postives = 117/272 (43.01%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT----TTEYIGNDL--PKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            F+MGT+D      GE P+R      F I+ + VT   FQ+F  +  Y T        S+VF   + +++       +   PW+ PV GA W  P G    I     +P +HVS+ DA  YCQ   +RLPTE EWELA R   +       DR                            V +FP  N FG+YDM+GN WEWT    T  +   D   PK        V KGGS++   +        RC+ +       +A N+GFRC+ D
Sbjct:   98 FLMGTDDPGIPQDGEGPQRKVKLDAFYIEEHEVTNQQFQHFTNQTGYITEAERFGD-SFVFEGLLSEEVKSTLSHAVAAAPWWSPVKGADWRHPEGPDSTIHNRMNHPALHVSWDDARAYCQWAKRRLPTEAEWELACRGGLQ-------DR-------------------------CISVMSFP-ANGFGLYDMVGNAWEWTADWWTVHHSAEDKFNPKGPESGTDRVKKGGSYMCHKS---YCYRYRCAARSQNTPDSSASNLGFRCASD 332          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Xenopus
Match: mcm5 (minichromosome maintenance complex component 5 [Source:Xenbase;Acc:XB-GENE-985665])

HSP 1 Score: 210.305 bits (534), Expect = 5.435e-64
Identity = 114/278 (41.01%), Postives = 157/278 (56.47%), Query Frame = 2
Query:  272 PEEIGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCS 1105
            P +  +M   D   F MGT     K  GESP R     PF +D+YPVT  DF+ FV+ K+Y  T+ +   +S+VF   V +++ +   + +   PW++PV  A W +P G    I +    PVV VS+ DA  YC+ L KRLPTE EWE AAR   K   YPWG+  + NR N+WQG FP  D   DG+   SPV AFP QN++G+YDMLGN WEWT TEY      K Q + +  VL+G S++DT +G       R + ++       ++N+ FRC+
Sbjct:    1 PTDADNMVQLDGGQFDMGTKASDGKD-GESPVRQVKVLPFAVDKYPVTNKDFREFVRAKKY-KTEAEAFGWSFVFEDFVSEELKKKVTQKLESAPWWLPVERAFWRQPAGPASGIKEKLDYPVVQVSWNDAQAYCKWLGKRLPTEEEWEFAARGGLKGKVYPWGNTFKPNRTNLWQGTFPGMDTATDGYHGASPVAAFPAQNEYGLYDMLGNTWEWTATEYTSARAQK-QNKENMYVLRGASWIDTVDGS-ANHKARVTTRMGNTPDSASDNLSFRCA 274          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Xenopus
Match: mcm5 (minichromosome maintenance complex component 5 [Source:Xenbase;Acc:XB-GENE-985665])

HSP 1 Score: 209.92 bits (533), Expect = 9.641e-64
Identity = 114/277 (41.16%), Postives = 157/277 (56.68%), Query Frame = 2
Query:  275 EEIGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCS 1105
            E+  +M   D   F MGT     K  GESP R     PF +D+YPVT  DF+ FV+ K+Y  T+ +   +S+VF   V +++ +   + +   PW++PV  A W +P G    I +    PVV VS+ DA  YC+ L KRLPTE EWE AAR   K   YPWG+  + NR N+WQG FP  D   DG+   SPV AFP QN++G+YDMLGN WEWT TEY      K Q + +  VL+G S++DT +G       R + ++       ++N+ FRC+
Sbjct:    8 EDADNMVQLDGGQFDMGTKASDGKD-GESPVRQVKVLPFAVDKYPVTNKDFREFVRAKKY-KTEAEAFGWSFVFEDFVSEELKKKVTQKLESAPWWLPVERAFWRQPAGPASGIKEKLDYPVVQVSWNDAQAYCKWLGKRLPTEEEWEFAARGGLKGKVYPWGNTFKPNRTNLWQGTFPGMDTATDGYHGASPVAAFPAQNEYGLYDMLGNTWEWTATEYTSARAQK-QNKENMYVLRGASWIDTVDGS-ANHKARVTTRMGNTPDSASDNLSFRCA 280          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Xenopus
Match: mcm5 (minichromosome maintenance complex component 5 [Source:Xenbase;Acc:XB-GENE-985665])

HSP 1 Score: 210.69 bits (535), Expect = 1.756e-63
Identity = 114/277 (41.16%), Postives = 157/277 (56.68%), Query Frame = 2
Query:  275 EEIGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCS 1105
            E+  +M   D   F MGT     K  GESP R     PF +D+YPVT  DF+ FV+ K+Y  T+ +   +S+VF   V +++ +   + +   PW++PV  A W +P G    I +    PVV VS+ DA  YC+ L KRLPTE EWE AAR   K   YPWG+  + NR N+WQG FP  D   DG+   SPV AFP QN++G+YDMLGN WEWT TEY      K Q + +  VL+G S++DT +G       R + ++       ++N+ FRC+
Sbjct:   54 EDADNMVQLDGGQFDMGTKASDGKD-GESPVRQVKVLPFAVDKYPVTNKDFREFVRAKKY-KTEAEAFGWSFVFEDFVSEELKKKVTQKLESAPWWLPVERAFWRQPAGPASGIKEKLDYPVVQVSWNDAQAYCKWLGKRLPTEEEWEFAARGGLKGKVYPWGNTFKPNRTNLWQGTFPGMDTATDGYHGASPVAAFPAQNEYGLYDMLGNTWEWTATEYTSARAQK-QNKENMYVLRGASWIDTVDGS-ANHKARVTTRMGNTPDSASDNLSFRCA 326          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Xenopus
Match: mcm5 (minichromosome maintenance complex component 5 [Source:Xenbase;Acc:XB-GENE-985665])

HSP 1 Score: 207.608 bits (527), Expect = 4.568e-63
Identity = 113/273 (41.39%), Postives = 154/273 (56.41%), Query Frame = 2
Query:  290 MQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSM 1108
            M   D   F MGT     K  GESP R     PF +D+YPVT  DF+ FV+ K+Y  T+ +   +S+VF   V +++ +   + +   PW++PV  A W +P G    I +    PVV VS+ DA  YC+ L KRLPTE EWE AAR   K   YPWG+  + NR N+WQG FP  D   DG+   SPV AFP QN++G+YDMLGN WEWT TEY      K Q + +  VL+G S++DT +G       R + ++       ++N+ FRC+ 
Sbjct:    1 MVQLDGGQFDMGTKASDGKD-GESPVRQVKVLPFAVDKYPVTNKDFREFVRAKKY-KTEAEAFGWSFVFEDFVSEELKKKVTQKLESAPWWLPVERAFWRQPAGPASGIKEKLDYPVVQVSWNDAQAYCKWLGKRLPTEEEWEFAARGGLKGKVYPWGNTFKPNRTNLWQGTFPGMDTATDGYHGASPVAAFPAQNEYGLYDMLGNTWEWTATEYTSARAQK-QNKENMYVLRGASWIDTVDGS-ANHKARVTTRMGNTPDSASDNLSFRCTA 269          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Xenopus
Match: mcm5 (minichromosome maintenance complex component 5 [Source:Xenbase;Acc:XB-GENE-985665])

HSP 1 Score: 207.608 bits (527), Expect = 9.782e-63
Identity = 113/273 (41.39%), Postives = 155/273 (56.78%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCS 1105
            +M   D   F MGT     K  GESP R     PF +D+YPVT  DF+ FV+ K+Y  T+ +   +S+VF   V +++ +   + +   PW++PV  A W +P G    I +    PVV VS+ DA  YC+ L KRLPTE EWE AAR   K   YPWG+  + NR N+WQG FP  D   DG+   SPV AFP QN++G+YDMLGN WEWT TEY      K Q + +  VL+G S++DT +G       R + ++       ++N+ FRC+
Sbjct:   22 NMVQLDGGQFDMGTKASDGKD-GESPVRQVKVLPFAVDKYPVTNKDFREFVRAKKY-KTEAEAFGWSFVFEDFVSEELKKKVTQKLESAPWWLPVERAFWRQPAGPASGIKEKLDYPVVQVSWNDAQAYCKWLGKRLPTEEEWEFAARGGLKGKVYPWGNTFKPNRTNLWQGTFPGMDTATDGYHGASPVAAFPAQNEYGLYDMLGNTWEWTATEYTSARAQK-QNKENMYVLRGASWIDTVDGS-ANHKARVTTRMGNTPDSASDNLSFRCA 290          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Mouse
Match: Sumf2 (sulfatase modifying factor 2 [Source:MGI Symbol;Acc:MGI:1915152])

HSP 1 Score: 203.756 bits (517), Expect = 2.341e-61
Identity = 117/267 (43.82%), Postives = 156/267 (58.43%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            F+MGT D      GE P R    KPF ID +PVT  DF+ FV+EK+Y  T+ +   +S+VF   V  ++ R  + LM    W+ PV  A W +P G    I +    PVVHVS+ DA  YC    +RLPTE EWE AAR   K   YPWG+R + NR N+WQGKFP  D   DGF  +SPVNAFP QN++G+YD++GNVWEWT + Y     P  Q  R   VL+G S++DT +G    +  R + ++       ++N+GFRC+  A
Sbjct:   46 FLMGT-DAPDGRDGEGPAREVTVKPFAIDIFPVTNKDFREFVREKKY-QTEAEAFGWSFVFEDFVSPEL-RKQENLMPAVHWWQPVPKAFWRQPAGPGSGIREKLELPVVHVSWNDAGAYCAWRGRRLPTEEEWEFAARGGLKGQVYPWGNRFQPNRTNLWQGKFPKGDKAEDGFHGLSPVNAFPPQNNYGLYDLMGNVWEWTASTY----QPAGQDMR---VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCASSA 301          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Mouse
Match: Sumf1 (sulfatase modifying factor 1 [Source:MGI Symbol;Acc:MGI:1889844])

HSP 1 Score: 169.088 bits (427), Expect = 1.749e-47
Identity = 103/295 (34.92%), Postives = 156/295 (52.88%), Query Frame = 2
Query:  266 AKPEEIGSMQMFDYPS--FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKF--SYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMR---RNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDL------PKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            + P  +   +M   P+  F MGT+D   +  GE+P R      F +D Y V+ ADF+ FV    Y T   +  KF  S+VF   + + +  +  + +   PW++PV GA W  P G   +I     +PV+HVS+ DA  YC    KRLPTE EWE + R   ++  +PWG++++   ++  NIWQGKFP  + G DGF   +PV+AFP  N +G+Y+++GNVWEWT+  +  +        PK        V KGGS++   +        RC+ +       +A N+GFRC+ D
Sbjct:   79 SGPRPLALTKMVPIPAGVFTMGTDDPQIRQDGEAPARRVTVDGFYMDAYEVSNADFEKFVNSTGYLT---EAEKFGDSFVFEGMLSEQVKTHIHQAVAAAPWWLPVKGANWRHPEGPDSSILHRSNHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLQNRLFPWGNKLQPKGQHYANIWQGKFPVSNTGEDGFQGTAPVDAFP-PNGYGLYNIVGNVWEWTSDWWTVHHSVEETFNPKGPTSGKDRVKKGGSYMCHKS---YCYRYRCAARSQNTPDSSASNLGFRCAAD 366          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Mouse
Match: Sumf1 (sulfatase modifying factor 1 [Source:MGI Symbol;Acc:MGI:1889844])

HSP 1 Score: 154.066 bits (388), Expect = 4.164e-42
Identity = 98/293 (33.45%), Postives = 144/293 (49.15%), Query Frame = 2
Query:  266 AKPEEIGSMQMFDYPS--FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMR---RNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDL------PKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            + P  +   +M   P+  F MGT+D   +  GE+P R      F +D Y V+ ADF+ FV    Y T                           +   PW++PV GA W  P G   +I     +PV+HVS+ DA  YC    KRLPTE EWE + R   ++  +PWG++++   ++  NIWQGKFP  + G DGF   +PV+AFP  N +G+Y+++GNVWEWT+  +  +        PK        V KGGS++   +        RC+ +       +A N+GFRC+ D
Sbjct:   79 SGPRPLALTKMVPIPAGVFTMGTDDPQIRQDGEAPARRVTVDGFYMDAYEVSNADFEKFVNSTGYLTE--------------------------VAAAPWWLPVKGANWRHPEGPDSSILHRSNHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLQNRLFPWGNKLQPKGQHYANIWQGKFPVSNTGEDGFQGTAPVDAFP-PNGYGLYNIVGNVWEWTSDWWTVHHSVEETFNPKGPTSGKDRVKKGGSYMCHKS---YCYRYRCAARSQNTPDSSASNLGFRCAAD 341          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Mouse
Match: Sumf2 (sulfatase modifying factor 2 [Source:MGI Symbol;Acc:MGI:1915152])

HSP 1 Score: 58.151 bits (139), Expect = 1.120e-9
Identity = 40/104 (38.46%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKI 625
            F+MGT D      GE P R    KPF ID +PVT  DF+ FV+EK+ Y T+ +   +S+VF   V  + +R  + LM    W+ PV  A W +P  L    S+ 
Sbjct:   37 FLMGT-DAPDGRDGEGPAREVTVKPFAIDIFPVTNKDFREFVREKK-YQTEAEAFGWSFVFEDFVSPE-LRKQENLMPAVHWWQPVPKAFWRQPRFLLPQPSEC 137          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Mouse
Match: Sumf2 (sulfatase modifying factor 2 [Source:MGI Symbol;Acc:MGI:1915152])

HSP 1 Score: 53.1434 bits (126), Expect = 3.830e-8
Identity = 44/113 (38.94%), Postives = 58/113 (51.33%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVS 652
            F+MGT D      GE P R    KPF ID +PVT  DF+ FV+EK+ Y T+ +   +S+VF   V  + +R  + LM   P   P  G R            K++L PVVHVS
Sbjct:   41 FLMGT-DAPDGRDGEGPAREVTVKPFAIDIFPVTNKDFREFVREKK-YQTEAEAFGWSFVFEDFVSPE-LRKQENLM---PPAGPGSGIR-----------EKLEL-PVVHVS 135          
BLAST of FGE-sulfatase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RCR5|SUMF2_PONAB (Inactive C-alpha-formylglycine-generating enzyme 2 OS=Pongo abelii OX=9601 GN=SUMF2 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.990e-63
Identity = 118/276 (42.75%), Postives = 161/276 (58.33%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            SM       F+MGTN    +  GE P R    KPF ID +PVT  DF++FV+EK+Y  T+ ++  +S+VF   V  ++     + M    W++PV  A W +P G    I +   +PV+HVS+ DA  YC    KRLPTE EWE AAR   K   YPWG+  + NR N+WQGKFP  D   DGF  VSPVNAFP QN++G+YD+LGNVWEWT + Y       +Q  R   VL+G S++DT +G    +  R + ++       ++N+GFRC+ DA
Sbjct:   29 SMVQLQGGRFLMGTNSPDSRD-GEGPVREATVKPFAIDIFPVTNKDFRDFVREKKY-RTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPYQA----AEQDMR---VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCAADA 294          
BLAST of FGE-sulfatase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NBJ7|SUMF2_HUMAN (Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 8.835e-63
Identity = 117/276 (42.39%), Postives = 161/276 (58.33%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            SM       F+MGTN    +  G+ P R    KPF ID +PVT  DF++FV+EK+Y  T+ ++  +S+VF   V  ++     + M    W++PV  A W +P G    I +   +PV+HVS+ DA  YC    KRLPTE EWE AAR   K   YPWG+  + NR N+WQGKFP  D   DGF  VSPVNAFP QN++G+YD+LGNVWEWT + Y       +Q  R   VL+G S++DT +G    +  R + ++       ++N+GFRC+ DA
Sbjct:   29 SMVQLQGGRFLMGTNSPDSRD-GDGPVREATVKPFAIDIFPVTNKDFRDFVREKKY-RTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPYQA----AEQDMR---VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCAADA 294          
BLAST of FGE-sulfatase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q58CP2|SUMF2_BOVIN (Inactive C-alpha-formylglycine-generating enzyme 2 OS=Bos taurus OX=9913 GN=SUMF2 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.626e-62
Identity = 121/284 (42.61%), Postives = 164/284 (57.75%), Query Frame = 2
Query:  278 EIGSMQ---MFDYPS--FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            E+G+ Q   M   P   F MGT+    +  GE P R    KPF ID +PVT  DF+ FV+EK+Y T + ++  +S+VF   V  ++     + M    W++PV  A W +P G    I +    PVVHVS+ DA  YC    KRLPTE EWE AAR   K   YPWG++ + NR N+WQGKFP  D   DGF  VSPVNAFP QND+G+YD++GNVWEWT ++Y       DQ  R   VL+G S++DT +G    +  R + ++       ++N+GFRC+  A
Sbjct:   21 ELGNGQTVNMVQLPGGRFQMGTDSPDGRD-GEGPVREVTVKPFAIDIFPVTNKDFREFVREKKYRT-EAEVFGWSFVFEDLVSDELRNKATQRMQSLLWWLPVERAFWRQPAGPGSGIREKLEFPVVHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNKFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPPQNDYGLYDLVGNVWEWTASQYQA----ADQDMR---VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCASGA 294          
BLAST of FGE-sulfatase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BPG6|SUMF2_MOUSE (Inactive C-alpha-formylglycine-generating enzyme 2 OS=Mus musculus OX=10090 GN=Sumf2 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 1.638e-60
Identity = 117/267 (43.82%), Postives = 156/267 (58.43%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            F+MGT D      GE P R    KPF ID +PVT  DF+ FV+EK+Y  T+ +   +S+VF   V  ++ R  + LM    W+ PV  A W +P G    I +    PVVHVS+ DA  YC    +RLPTE EWE AAR   K   YPWG+R + NR N+WQGKFP  D   DGF  +SPVNAFP QN++G+YD++GNVWEWT + Y     P  Q  R   VL+G S++DT +G    +  R + ++       ++N+GFRC+  A
Sbjct:   46 FLMGT-DAPDGRDGEGPAREVTVKPFAIDIFPVTNKDFREFVREKKY-QTEAEAFGWSFVFEDFVSPEL-RKQENLMPAVHWWQPVPKAFWRQPAGPGSGIREKLELPVVHVSWNDAGAYCAWRGRRLPTEEEWEFAARGGLKGQVYPWGNRFQPNRTNLWQGKFPKGDKAEDGFHGLSPVNAFPPQNNYGLYDLMGNVWEWTASTY----QPAGQDMR---VLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCASSA 301          
BLAST of FGE-sulfatase domain-containing protein vs. UniProt/SwissProt
Match: sp|D1A7C3|FGE_THECD (Formylglycine-generating enzyme OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NBRC 15933 / NCIMB 10081 / Henssen B9) OX=471852 GN=Tcur_4811 PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.137e-46
Identity = 112/309 (36.25%), Postives = 154/309 (49.84%), Query Frame = 2
Query:  236 DYDFEINEDDAKPEEIG-SMQMFDYPSFVMGTNDK-TYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMR---RNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT----TTEYIGNDLPKDQIRRHWV------VLKGGSFL--DTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
             +DF+I      P+EI   M      +F MG  D   +   GE P R     PF IDRY V+   F  FVK   Y T   +   +S+VF+ HV       D  ++ + PW++ V GA W  P G   +I+    +PVVHVS+ DA  Y     KRLPTE EWE+AAR       YPWG+ +    R+R NIWQG FP  D G DG+T  +PVNAF   N +G+Y++ GNVWEW     + ++   + P  +I           V KGGSFL  +++         R + +       +A + GFRC+ D
Sbjct:    3 SFDFDIPRR--SPQEIAKGMVAIPGGTFRMGGEDPDAFPEDGEGPVRTVRLSPFLIDRYAVSNRQFAAFVKATGYVTDA-ERYGWSFVFHAHVAPGTPVMDA-VVPEAPWWVAVPGAYWKAPEGPGSSITDRPNHPVVHVSWNDAVAYATWAGKRLPTEAEWEMAARGGLDQARYPWGNELTPRGRHRCNIWQGTFPVHDTGEDGYTGTAPVNAF-APNGYGLYNVAGNVWEWCADWWSADWHATESPATRIDPRGPETGTARVTKGGSFLCHESY-----CNRYRVAARTCNTPDSSAAHTGFRCAAD 301          
BLAST of FGE-sulfatase domain-containing protein vs. TrEMBL
Match: A0A267EBT0 (FGE-sulfatase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008542g3 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 3.134e-92
Identity = 147/319 (46.08%), Postives = 206/319 (64.58%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLN-PVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAXXXXXXXXXXMILYEDTYEYRMNIKKLAKKFITLKEKINRTQ 1240
             M+ FD  S+ MG     Y+ +GE P R EY KPF +DRYPVT   F  FV + +++ T P+L  FSYVF++H+++     +K  + DEPW++P+ GARW +PYG   +      N P VH+  ADA  YC+   KRLPTE+EWE AAR NNKSW YPWGD  R+ RMN WQG FP ++ G+DG   ++PV+A+P+QN   MYDMLGN WEWT+TEY G+D P  ++   W++LKGGSF+D+ +  I T  VR S K+ R   +TAEN+GFRC+       + + +++I  EDT+EY+ + K+   +     EK+ +TQ
Sbjct:   44 QMEEFDGGSYFMGVTHPEYEYKGEHPVRQEYVKPFAMDRYPVTNQQFSEFVYDTKFFRTDPELKGFSYVFFQHMKQAAKLMEKYKLLDEPWWLPIAGARWYQPYGPESSWKDGLANHPAVHIGAADADSYCKWKGKRLPTEFEWEYAARANNKSWIYPWGDHYRKMRMNTWQGLFPYENMGFDGHKGLAPVDAYPQQNHRDMYDMLGNTWEWTSTEYYGSDRPPGKV---WLILKGGSFVDSIDEGINTI-VRTSTKIGREIDFTAENIGFRCARTIIPKPEVKPQRVIRLEDTWEYKQSQKEKKARL----EKLQKTQ 354          
BLAST of FGE-sulfatase domain-containing protein vs. TrEMBL
Match: A0A267FC10 (FGE-sulfatase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008542g1 PE=4 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 4.962e-91
Identity = 146/318 (45.91%), Postives = 205/318 (64.47%), Query Frame = 2
Query:  290 MQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLN-PVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAXXXXXXXXXXMILYEDTYEYRMNIKKLAKKFITLKEKINRTQ 1240
            M+ F   S+ MG     Y+ +GE P R EY KPF +DRYPVT   F  FV + +++ T P+L  FSYVF++H+++     +K  + DEPW++P+ GARW +PYG   +      N P VH+  ADA  YC+   KRLPTE+EWE AAR NNKSW YPWGD  R+ RMN WQG FP ++ G+DG   ++PV+A+P+QN   MYDMLGN WEWT+TEY G+D P  ++   W++LKGGSF+D+ +  I T  VR S K+ R   +TAEN+GFRC+       + + +++I  EDT+EY+ + K+   +     EK+ +TQ
Sbjct:   45 MEEFAGGSYFMGVTHPEYEYKGEHPVRQEYVKPFAMDRYPVTNQQFSEFVYDTKFFRTDPELKGFSYVFFQHMKQTAKLMEKYKLLDEPWWLPIAGARWYQPYGPESSWKDGLANHPAVHIGAADADSYCKWKGKRLPTEFEWEYAARANNKSWIYPWGDHYRKMRMNTWQGLFPYENTGFDGHKGLAPVDAYPQQNHRDMYDMLGNTWEWTSTEYYGSDRPPGKV---WLILKGGSFVDSIDEGINTI-VRTSTKIGREIDFTAENIGFRCARTIIPKPEVKPQRVIRLEDTWEYKQSQKEKKARL----EKLQKTQ 354          
BLAST of FGE-sulfatase domain-containing protein vs. TrEMBL
Match: A0A1I8GIX1 (FGE-sulfatase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.626e-77
Identity = 128/280 (45.71%), Postives = 182/280 (65.00%), Query Frame = 2
Query:  404 YPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLN-PVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAXXXXXXXXXXMILYEDTYEYRMNIKKLAKKFITLKEKINRTQ 1240
            Y VT   F  FV + +++ T P+L  FSYVF++H+++     +K  + DEPW++P+ GARW +PYG   +      N P VH+  ADA  YC+   KRLPTE+EWE AAR NNKSW YPWGD  R+ RMN WQG FP ++ G+DG   ++PV+A+P+QN   MYDMLGN WEWT+TEY G+D P  ++   W++LKGGSF+D+ +  I T  VR S K+ R   +TAEN+GFRC+       + + +++I  EDT+EY+ + K+   +     EK+ +TQ
Sbjct:   64 YKVTNQQFSEFVYDTKFFRTDPELKGFSYVFFQHMKQTAKLMEKYKLLDEPWWLPIAGARWYQPYGPESSWKDGLANHPAVHIGAADADSYCKWKGKRLPTEFEWEYAARANNKSWIYPWGDHYRKMRMNTWQGLFPYENTGFDGHKGLAPVDAYPQQNHRDMYDMLGNTWEWTSTEYYGSDRPPGKV---WLILKGGSFVDSIDEGINT-IVRTSTKIGREIDFTAENIGFRCARTIIPKPEVKPQRVIRLEDTWEYKQSQKEKKARL----EKLQKTQ 335          
BLAST of FGE-sulfatase domain-containing protein vs. TrEMBL
Match: A0A1I8GEG6 (FGE-sulfatase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.732e-70
Identity = 125/266 (46.99%), Postives = 172/266 (64.66%), Query Frame = 2
Query:  446 KRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLN-PVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAXXXXXXXXXXMILYEDTYEYRMNIKKLAKKFITLKEKINRTQ 1240
            + ++ T P+L  FSYVF++H     M+   KLM  E W +P+ GARW +PYG   +      N P VH+  ADA  YC+   KRLPTE+EWE AAR NNKSW YPWGD  R+ RMN WQG FP ++ G+DG   ++PV+A+P+QN   MYDMLGN WEWT+TEY G+D P  ++   W++LKGGSF+D+ +  I T  VR S K+ R   +TAEN+GFRC+       + + +++I  EDT+EY+ + KK A+      EK+ +TQ
Sbjct:   28 RNFFRTDPELKGFSYVFFQH-----MKQTAKLM--EKW-LPIAGARWYQPYGPESSWKDGLANHPAVHIGAADADSYCKWKGKRLPTEFEWEYAARANNKSWIYPWGDHYRKMRMNTWQGLFPYENTGFDGHKGLAPVDAYPQQNHRDMYDMLGNTWEWTSTEYYGSDRPPGKV---WLILKGGSFVDSIDEGINTI-VRTSTKIGREIDFTAENIGFRCARTIIPKPEVKPQRVIRLEDTWEYKQSQKKKAR-----LEKLQKTQ 276          
BLAST of FGE-sulfatase domain-containing protein vs. TrEMBL
Match: T1FRC1 (FGE-sulfatase domain-containing protein OS=Helobdella robusta OX=6412 GN=20211368 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 5.981e-64
Identity = 133/334 (39.82%), Postives = 183/334 (54.79%), Query Frame = 2
Query:  203 IECFLINF--AVCDYDFEINEDDAKPEEIGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAXXXXXXXXXXMI------LYEDTYEYRM 1180
            +E  L+ F  A+    F   ED        S+   D  SF+MG+  +     GE P++    KPF IDRYPVT ADF+ F  EK  Y T  +L+ +S+VF+KH  +        +  D   ++ V  A W +PYGL  N+    L PV+HVS+ DAY +C    KR+ +EYEWE AAR       +PWG+     R N+WQG+FP+ + G DGF  VSPV+A+  QN+FGMYDM+GNVWEWT T +    +  D       V +GGSFLDT +G +  +  R S++      Y AEN+GFRC+   K   K  K   +       YE+T+EY+M
Sbjct:    1 MEFCLLRFMVAIIVASFSAGEDKKD-----SIVYLDRGSFMMGSPRRELLKTGEFPQKHIQVKPFAIDRYPVTNADFKVFKSEKPNYLTNAELDGYSWVFFKHKSQQAQVNKHLVHPDGGHWVAVRNATWYQPYGLGSNLDGKDLYPVIHVSYHDAYAFCLWAGKRVVSEYEWEYAARGGAAGNKFPWGNVSDFTRANLWQGRFPDFNIGRDGFEGVSPVDAYEPQNNFGMYDMIGNVWEWTNTAFTVPRVESDANNPQHTV-RGGSFLDTLDGRV-NEETRVSLRKGLSPDYKAENLGFRCAYLWKPGTKYSKPIKLRPPVRHRYEETWEYKM 327          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042609.1 (sulfatase modifying factor 2 [Source:NCBI gene;Acc:103024782])

HSP 1 Score: 196.823 bits (499), Expect = 3.473e-59
Identity = 112/275 (40.73%), Postives = 159/275 (57.82%), Query Frame = 2
Query:  290 MQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLN-PVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            M +    +  MGTN    +  GESP R      FK+D+YPVT +DF+ FV+  +Y  T+ +   +S+VF   V  D+     + +   PW++PV    W +P G    I K +LN PVV VS+ DA  YC+   KRLPTE EWE+AAR       YPWG+++  NR N+WQG FP+ D   DG+  V+PV AFP QN++G+YDMLGNVWEWT+T +     P  Q      VL+G S++DT +G    +  R + ++       ++N+GFRC+ D
Sbjct:    1 MVLIPGGNLKMGTNAADGRD-GESPLRSVKVASFKMDKYPVTNSDFREFVRLNKY-KTEAETFGWSFVFQDFVSDDLKSKITQKIESAPWWLPVEKVFWRQPTGPGSGI-KDRLNFPVVQVSWNDAQAYCKWKKKRLPTEEEWEIAARGGLDGRTYPWGNKLLPNRTNLWQGTFPDGDTAEDGYHGVAPVTAFPSQNNYGLYDMLGNVWEWTSTPF-----PSAQTM---YVLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCASD 263          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000006209.2 (sulfatase modifying factor 2 [Source:NCBI gene;Acc:103024782])

HSP 1 Score: 201.445 bits (511), Expect = 6.247e-57
Identity = 113/276 (40.94%), Postives = 160/276 (57.97%), Query Frame = 2
Query:  287 SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLN-PVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            SM +    +  MGTN    +  GESP R      FK+D+YPVT +DF+ FV+  +Y T + +   +S+VF   V  D+     + +   PW++PV    W +P G    I K +LN PVV VS+ DA  YC+   KRLPTE EWE+AAR       YPWG+++  NR N+WQG FP+ D   DG+  V+PV AFP QN++G+YDMLGNVWEWT+T +     P  Q      VL+G S++DT +G    +  R + ++       ++N+GFRC+ D
Sbjct:   26 SMVLIPGGNLKMGTNAADGRD-GESPLRSVKVASFKMDKYPVTNSDFREFVRLNKYKT-EAETFGWSFVFQDFVSDDLKSKITQKIESAPWWLPVEKVFWRQPTGPGSGI-KDRLNFPVVQVSWNDAQAYCKWKKKRLPTEEEWEIAARGGLDGRTYPWGNKLLPNRTNLWQGTFPDGDTAEDGYHGVAPVTAFPSQNNYGLYDMLGNVWEWTSTPF-----PSAQT---MYVLRGASWIDTADGSANHR-ARVTTRMGNTPDSASDNLGFRCASD 289          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Cavefish
Match: sumf1 (sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-GENE-060421-3113])

HSP 1 Score: 162.155 bits (409), Expect = 1.267e-44
Identity = 99/287 (34.49%), Postives = 148/287 (51.57%), Query Frame = 2
Query:  281 IGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRM---RRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTT----TEYIGNDL--PKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            +  M   +   F+MGT+       GE+P+R  +   F I+ + V    FQ F+ +  + T        S+VF   + ++I     + +   PW+ PV GA W  P G    IS    +PV+HVS+ADA  YCQ   +RLPTE EWELA R   +   YPWG+++     +  N+WQG+FPN +   DG+ + SPV +FP  N FG+YDM+GN WEWT       +  ++   PK   +    V KGGS++   +        RC+ +       +A N+GFRC+ D+
Sbjct:  126 LSKMVQLEGGFFLMGTDVPGIPQDGETPQRRVWIDTFLIEEHEVNNKQFQRFINQTGHITEAERFGD-SFVFEGLLSEEIKNTLTQAVAAAPWWSPVKGADWRHPEGPDSTISNRMDHPVLHVSWADAQAYCQWAQRRLPTEAEWELACRGGLEDKLYPWGNKLMPREEHYANLWQGEFPNVNTAEDGYLNTSPVMSFP-ANGFGLYDMVGNAWEWTADWWNVHHTRDEARNPKGPEKGTDKVKKGGSYMCHKS---YCYRYRCAARSQNTPDSSASNLGFRCAADS 407          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Sea Lamprey
Match: sumf1 (sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-GENE-060421-3113])

HSP 1 Score: 143.28 bits (360), Expect = 1.517e-39
Identity = 96/286 (33.57%), Postives = 144/286 (50.35%), Query Frame = 2
Query:  293 QMFDYPS--FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMR---RNRMNIWQGKFPNQDFGYDGF-THVSP-VNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWV------VLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            QM   P   F MGT++      GE P R    + F+   + V+ ADF+ FV    + T     +  S+V    +   +     + +   PW++PV GA W  P G   NI+    +PVVHVS+ DA  +C+    RLPTE EWE A R   ++  +PWG++M    ++ MN+WQG FP  D G DG+   + P V AFP  N +G+++M+GNVWEWT   +  +   ++Q            V KGGS++   +        RC+ +       +A N+GFRC+ D
Sbjct:    4 QMKAVPGGVFTMGTDEPIIVPDGEGPARRVRVRAFRAHTHEVSNADFERFVSATGHVTEAESFSD-SFVLSGKLSDTVRDEITQAVAAAPWWLPVKGANWRHPEGPDSNITGRMDHPVVHVSWNDASAFCKWAGSRLPTEAEWEYACRGGLENRLFPWGNKMTPRGQHYMNVWQGDFPTHDTGEDGYPVALCPKVTAFP-PNAYGLHNMVGNVWEWTADWWTVHHTAEEQSNPTGPQTGSDKVKKGGSYMCHKS---YCHRYRCAARSQNTPDSSASNLGFRCAAD 284          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010503.1 (pep scaffold:Pmarinus_7.0:GL493411:57:2838:-1 gene:ENSPMAG00000009514.1 transcript:ENSPMAT00000010503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 5.729e-26
Identity = 54/120 (45.00%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  554 PWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNN--KSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGN 907
            PW++PV  A W +P+G    I     +PVVHVS  DA  +C    KRLP+E EWE AAR      + +YPWG+     R N+WQG FP+ D   DGF   SPV+AFP Q DF  +   G+
Sbjct:    3 PWWMPVERAYWRQPFGPGSGIRDRLDHPVVHVSLRDATAFCSWAGKRLPSEEEWERAARGRRLATASEYPWGENFETGRANLWQGAFPDADAAADGFHGTSPVDAFPAQTDFKEFHRNGD 122          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Nematostella
Match: EDO43741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXX9])

HSP 1 Score: 189.119 bits (479), Expect = 1.097e-56
Identity = 106/265 (40.00%), Postives = 152/265 (57.36%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLN-PVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCS 1105
            F MGTN +  K  GE+P R    K F IDRYP+T   F+ FV+ K++ T       +S+ F+  V +++     + +   PW+IPV  A W +P G    I K KLN PVVH+S+ DA  YC    KRL TE EWE AAR   +   YPWG +    RMNIWQG FP ++   DG+  ++PVNA+P QN +GMYDM+GN WEW   E+     P+ +  + + VL+GGS++D+ +G       R + ++       ++N+ FRC+
Sbjct:    9 FRMGTNSEDGKD-GENPARDVRVKAFAIDRYPITNELFRAFVRSKKFKTEAEKFG-WSFAFHTFVPENVRSKVTQSVQGAPWWIPVNKAYWRQPGGPGTTI-KDKLNYPVVHISYNDATAYCNWAGKRLATEAEWEFAARGGLQGQVYPWGKKFEEKRMNIWQGDFPGKNTKLDGYDWLAPVNAYPPQNSYGMYDMIGNAWEWVGDEF---KSPEGRGEKKF-VLRGGSYIDSRDGKF-NHKARVTTRMGNTADAGSDNISFRCA 265          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Nematostella
Match: EDO49703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFE6])

HSP 1 Score: 149.058 bits (375), Expect = 2.077e-41
Identity = 95/290 (32.76%), Postives = 150/290 (51.72%), Query Frame = 2
Query:  290 MQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRN---RMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT--------TTEY----IGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDA 1114
            M   +   F MGTN       GE P R    +PF +D Y V+  +F+ FV    +  T+ ++   S+V    V K+I +   + +   PW++PV GA W +P G   +I +   +PV+H+S+ DA  +C+   KRLPTE E+E A +  +    YPWG+ +  N     N+WQG+FP ++   DG+    PV AFP QN +G+Y+++GN WEWT        T+++     G    KD+++R      GGS++     +      R + +       TA N+GFRC+ D+
Sbjct:    1 MVRIEGGEFTMGTNKPYIVVDGEGPARKVRLRPFYMDIYEVSNREFELFVNATGH-KTEAEVFGDSFVLGSRVSKEIEKDIHQAVAAAPWWLPVKGAYWRRPEGPDTDIRERMNHPVLHISWNDAVAFCKWSGKRLPTEAEFEYALKGGSDDTLYPWGNELLVNGKHMANLWQGRFPVENTAEDGYEGTCPVTAFP-QNGYGLYNIIGNAWEWTSDWWNVRHTSDFQDNPTGPTTGKDKVKR------GGSYMCH---ESYCYRYRSAARSQNSPDTTASNLGFRCASDS 279          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Nematostella
Match: EDO26016 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD39])

HSP 1 Score: 63.929 bits (154), Expect = 3.033e-13
Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 2
Query:  752 YPWGDRMRRN---RMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTT 925
            YPWG+ +  N     N+WQG+FP ++   DG+    PV AFP QN +G+Y+++GN WEWT+
Sbjct:    2 YPWGNELLVNGKHMANLWQGRFPVENTAEDGYEGTCPVTAFP-QNGYGLYNIIGNAWEWTS 61          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Medaka
Match: sumf2 (sulfatase modifying factor 2 [Source:NCBI gene;Acc:105355577])

HSP 1 Score: 183.726 bits (465), Expect = 5.693e-54
Identity = 96/264 (36.36%), Postives = 151/264 (57.20%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCS 1105
             +MGTN    +  GES  R    +PF +D+YPVT A F++FV+ ++Y + + +   +S+VF   V  ++     + +   PW++PV    W +P G    I +    PVV VS+ DA  +C+    RLPTE EWE AAR   +   YPWG++ + NR N+WQG FP+ D   DG+  ++PV AFP QN++G+YDM+GN WEWT++ ++          +   VL+G S++DT +G       R + ++       ++N+GFRC+
Sbjct:   31 LLMGTNAADGRD-GESSIREVEIQPFGMDKYPVTNAQFRDFVRSQKYRS-EAETFGWSFVFQDFVSDELKSKVTQTIESAPWWLPVERVFWRQPAGPGSGIRERLDFPVVQVSWNDAQAFCRWKGHRLPTEEEWEWAARGGLQGRTYPWGNKFQVNRTNLWQGPFPDGDTAEDGYHGLAPVTAFPPQNNYGLYDMMGNTWEWTSSVFLA--------AKQMYVLRGASWIDTADGS-ANHKARVTTRMGNTPDSASDNLGFRCA 283          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Medaka
Match: sumf1 (sulfatase modifying factor 1 [Source:NCBI gene;Acc:101167950])

HSP 1 Score: 171.785 bits (434), Expect = 1.373e-48
Identity = 105/281 (37.37%), Postives = 151/281 (53.74%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKF--SYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMR---RNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT--------TTEYIGNDLPKDQIRRHWVVLKGGSFL--DTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            F+MGT+     + GE P+R  +   F +D + VT   FQ+FV+   Y T   +  KF  S+VF   V +D+     + +   PW++PV GA W  P G   NI+    +PVV VS+ DA  YC  +NKRLPTE EWE+A R   K   YPWG+++    ++  N+WQG+FP  +   DG+T  SPV +FP  N FG+YDM+GN WEWT        TT++  N  P         V KGGS++   ++         RC+ +       +A N+GFRC+ +
Sbjct:   96 FLMGTDQPGIAADGEGPQRPVHVDSFHMDIHEVTNRQFQSFVRATGYIT---EAEKFGDSFVFEGIVSEDVKSQISQAVAAAPWWLPVKGANWKHPEGPDSNITDRMDHPVVQVSWNDALAYCSWVNKRLPTEAEWEVACRGGLKDRLYPWGNKLNPKGQHYANLWQGEFPAHNSAEDGYTKTSPVMSFP-GNAFGLYDMVGNAWEWTSDWWSVHHTTDHQHN--PTGPPSGTDKVKKGGSYMCHKSY-----CYRYRCAARSQNTPDSSASNLGFRCAAE 365          
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Medaka
Match: sumf1 (sulfatase modifying factor 1 [Source:NCBI gene;Acc:101167950])

HSP 1 Score: 154.066 bits (388), Expect = 2.995e-42
Identity = 98/279 (35.13%), Postives = 139/279 (49.82%), Query Frame = 2
Query:  314 FVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMR---RNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWT--------TTEYIGNDLPKDQIRRHWVVLKGGSFL--DTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMD 1111
            F+MGT+     + GE P+R  +   F +D + VT   FQ+FV+   Y T                           +   PW++PV GA W  P G   NI+    +PVV VS+ DA  YC  +NKRLPTE EWE+A R   K   YPWG+++    ++  N+WQG+FP  +   DG+T  SPV +FP  N FG+YDM+GN WEWT        TT++  N  P         V KGGS++   ++         RC+ +       +A N+GFRC+ +
Sbjct:   96 FLMGTDQPGIAADGEGPQRPVHVDSFHMDIHEVTNRQFQSFVRATGYITE--------------------------VAAAPWWLPVKGANWKHPEGPDSNITDRMDHPVVQVSWNDALAYCSWVNKRLPTEAEWEVACRGGLKDRLYPWGNKLNPKGQHYANLWQGEFPAHNSAEDGYTKTSPVMSFP-GNAFGLYDMVGNAWEWTSDWWSVHHTTDHQHN--PTGPPSGTDKVKKGGSYMCHKSY-----CYRYRCAARSQNTPDSSASNLGFRCAAE 340          
BLAST of FGE-sulfatase domain-containing protein vs. Planmine SMEST
Match: SMESG000000702.1 (SMESG000000702.1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 362/364 (99.45%), Postives = 363/364 (99.73%), Query Frame = 2
Query:  209 CFLINFAVCDYDFEINEDDAKPEEIGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAXXXXXXXXXXMILYEDTYEYRMNIKKLAKKFITLKEKINRTQIQRPKSPYEHKHHFNLKDEL 1300
             FLINFAVCDYDFEINEDDAKPEEIGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQN+FGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAKIVKKREKKKMILYEDTYEYRMNIKKLAKKFITLKEKINRTQIQRPKSPYEHKHHFNLKDEL
Sbjct:    8 SFLINFAVCDYDFEINEDDAKPEEIGSMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNFVKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARWDKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTNNKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNNFGMYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQPVRCSIKVTRPYYYTAENVGFRCSMDAKIVKKREKKKMILYEDTYEYRMNIKKLAKKFITLKEKINRTQIQRPKSPYEHKHHFNLKDEL 371          
The following BLAST results are available for this feature:
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUMF21.840e-6342.39sulfatase modifying factor 2 [Source:HGNC Symbol;A... [more]
SUMF21.942e-6342.03sulfatase modifying factor 2 [Source:HGNC Symbol;A... [more]
SUMF24.017e-5844.08sulfatase modifying factor 2 [Source:HGNC Symbol;A... [more]
SUMF21.723e-5740.94sulfatase modifying factor 2 [Source:HGNC Symbol;A... [more]
SUMF22.788e-5740.58sulfatase modifying factor 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG70491.476e-4234.97gene:FBgn0035102 transcript:FBtr0072537[more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sumf21.204e-6039.33sulfatase modifying factor 2 [Source:ZFIN;Acc:ZDB-... [more]
sumf18.024e-4536.00sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-... [more]
sumf19.177e-4536.00sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-... [more]
sumf11.194e-2731.62sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-... [more]
sumf11.511e-2731.62sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm55.435e-6441.01minichromosome maintenance complex component 5 [So... [more]
mcm59.641e-6441.16minichromosome maintenance complex component 5 [So... [more]
mcm51.756e-6341.16minichromosome maintenance complex component 5 [So... [more]
mcm54.568e-6341.39minichromosome maintenance complex component 5 [So... [more]
mcm59.782e-6341.39minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sumf22.341e-6143.82sulfatase modifying factor 2 [Source:MGI Symbol;Ac... [more]
Sumf11.749e-4734.92sulfatase modifying factor 1 [Source:MGI Symbol;Ac... [more]
Sumf14.164e-4233.45sulfatase modifying factor 1 [Source:MGI Symbol;Ac... [more]
Sumf21.120e-938.46sulfatase modifying factor 2 [Source:MGI Symbol;Ac... [more]
Sumf23.830e-838.94sulfatase modifying factor 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RCR5|SUMF2_PONAB1.990e-6342.75Inactive C-alpha-formylglycine-generating enzyme 2... [more]
sp|Q8NBJ7|SUMF2_HUMAN8.835e-6342.39Inactive C-alpha-formylglycine-generating enzyme 2... [more]
sp|Q58CP2|SUMF2_BOVIN5.626e-6242.61Inactive C-alpha-formylglycine-generating enzyme 2... [more]
sp|Q8BPG6|SUMF2_MOUSE1.638e-6043.82Inactive C-alpha-formylglycine-generating enzyme 2... [more]
sp|D1A7C3|FGE_THECD1.137e-4636.25Formylglycine-generating enzyme OS=Thermomonospora... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EBT03.134e-9246.08FGE-sulfatase domain-containing protein OS=Macrost... [more]
A0A267FC104.962e-9145.91FGE-sulfatase domain-containing protein OS=Macrost... [more]
A0A1I8GIX11.626e-7745.71FGE-sulfatase domain-containing protein OS=Macrost... [more]
A0A1I8GEG65.732e-7046.99FGE-sulfatase domain-containing protein OS=Macrost... [more]
T1FRC15.981e-6439.82FGE-sulfatase domain-containing protein OS=Helobde... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000042609.13.473e-5940.73sulfatase modifying factor 2 [Source:NCBI gene;Acc... [more]
ENSAMXT00000006209.26.247e-5740.94sulfatase modifying factor 2 [Source:NCBI gene;Acc... [more]
sumf11.267e-4434.49sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sumf11.517e-3933.57sulfatase modifying factor 1 [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000010503.15.729e-2645.00pep scaffold:Pmarinus_7.0:GL493411:57:2838:-1 gene... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO437411.097e-5640.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497032.077e-4132.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260163.033e-1345.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sumf25.693e-5436.36sulfatase modifying factor 2 [Source:NCBI gene;Acc... [more]
sumf11.373e-4837.37sulfatase modifying factor 1 [Source:NCBI gene;Acc... [more]
sumf12.995e-4235.13sulfatase modifying factor 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of FGE-sulfatase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000702.10.000e+099.45SMESG000000702.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015167 ID=SMED30015167|Name=FGE-sulfatase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1439bp
AAAATATTATTTATTTTTATTAAATAAAAATGGTTAATAAGCAATGCCAT
TTGAAATAATTTTAATGAATCAGATATTTCACAGGAAAATAAATCCGTCT
ACTCGATTTCCTATTTTTTGACGATTTGACTGGCTTATGTTGGGGAATGG
AGTGCAGATTAACTGCCACACGTGGCACAAGAGGAAATATGTTTCCCTCA
CAATTGAATGTTTTTTGATTAACTTTGCTGTGTGTGACTATGACTTCGAA
ATCAACGAGGACGATGCGAAGCCAGAAGAAATCGGTAGTATGCAGATGTT
TGACTACCCATCATTTGTGATGGGTACAAATGACAAAACTTACAAATCCA
GAGGTGAATCTCCAAAACGATGGGAATATACGAAGCCATTCAAAATTGAT
CGCTATCCTGTCACGGTTGCTGATTTTCAAAATTTTGTCAAAGAAAAGCG
ATATTATACAACTCAACCGGATTTAAACAAGTTTTCATATGTATTCTATA
AACACGTACGAAAAGATATCATGAGGTATGATAAAAAACTTATGAATGAT
GAGCCATGGTTTATTCCCGTTGTTGGAGCCAGGTGGGATAAGCCATATGG
GTTATTTTATAATATTTCAAAGATCAAACTTAATCCGGTTGTACATGTGA
GTTTTGCAGATGCATATCGGTATTGCCAGCATCTCAACAAACGGTTGCCA
ACAGAATATGAATGGGAATTGGCGGCTAGAACAAATAATAAGAGTTGGGA
TTATCCTTGGGGAGACAGAATGCGCAGGAATCGAATGAATATTTGGCAAG
GCAAGTTTCCGAATCAGGATTTTGGTTACGACGGATTTACTCACGTTTCT
CCAGTAAATGCCTTTCCACGACAAAATGATTTTGGTATGTATGACATGCT
TGGCAATGTTTGGGAATGGACAACAACAGAATATATAGGAAATGACTTGC
CAAAGGATCAAATACGCCGTCATTGGGTGGTTTTAAAAGGAGGTTCATTT
CTTGATACTTTTAATGGAGATATAGGTACTCAGCCAGTGAGATGTAGTAT
TAAAGTAACTAGACCATATTATTATACTGCTGAAAACGTAGGGTTTCGTT
GCTCAATGGATGCAAAAATTGTGAAGAAAAGAGAAAAGAAGAAAATGATT
CTATATGAAGATACTTACGAATATCGAATGAATATTAAGAAACTTGCGAA
AAAATTTATCACCTTAAAAGAAAAAATAAACCGAACTCAGATTCAGAGAC
CAAAATCGCCATACGAACACAAGCATCACTTTAATTTGAAAGATGAACTG
TAATATTTAATAGTTGAATTGGAAACATTTATTTATTTTTATTCTGCACC
AAAATAATATTTCATATTTTCTGTATTTATTCGAAAGAAAAATTATGATA
ACTCTAATTATTCTTTGAGCCAAAAGTTTCTTGGCAACT
back to top

protein sequence of SMED30015167-orf-1

>SMED30015167-orf-1 ID=SMED30015167-orf-1|Name=SMED30015167-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
MLGNGVQINCHTWHKRKYVSLTIECFLINFAVCDYDFEINEDDAKPEEIG
SMQMFDYPSFVMGTNDKTYKSRGESPKRWEYTKPFKIDRYPVTVADFQNF
VKEKRYYTTQPDLNKFSYVFYKHVRKDIMRYDKKLMNDEPWFIPVVGARW
DKPYGLFYNISKIKLNPVVHVSFADAYRYCQHLNKRLPTEYEWELAARTN
NKSWDYPWGDRMRRNRMNIWQGKFPNQDFGYDGFTHVSPVNAFPRQNDFG
MYDMLGNVWEWTTTEYIGNDLPKDQIRRHWVVLKGGSFLDTFNGDIGTQP
VRCSIKVTRPYYYTAENVGFRCSMDAKIVKKREKKKMILYEDTYEYRMNI
KKLAKKFITLKEKINRTQIQRPKSPYEHKHHFNLKDEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
Vocabulary: molecular function
TermDefinition
GO:0042802identical protein binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR042095SUMF_sf
IPR005532SUMF_dom
IPR016187CTDL_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 350..370
NoneNo IPR availablePANTHERPTHR23150:SF31SULFATASE-MODIFYING FACTOR 2coord: 59..324
NoneNo IPR availablePANTHERPTHR23150SULFATASE MODIFYING FACTOR 1, 2coord: 59..324
IPR042095Sulfatase-modifying factor enzyme superfamilyGENE3DG3DSA:3.90.1580.10coord: 51..326
e-value: 9.3E-69
score: 234.3
IPR005532Sulfatase-modifying factor enzymePFAMPF03781FGE-sulfatasecoord: 59..322
e-value: 8.1E-57
score: 192.8
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 58..322