3-hydroxy-3-methylglutaryl-coenzyme A reductase

Overview
Name3-hydroxy-3-methylglutaryl-coenzyme A reductase
Smed IDSMED30015159
Length (bp)646
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3-hydroxy-3-methylglutaryl-coenzyme A reductase (SMED30015159) t-SNE clustered cells

Violin plots show distribution of expression levels for 3-hydroxy-3-methylglutaryl-coenzyme A reductase (SMED30015159) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Human
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:HGNC Symbol;Acc:HGNC:5006])

HSP 1 Score: 124.02 bits (310), Expect = 5.460e-32
Identity = 86/196 (43.88%), Postives = 121/196 (61.73%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELE-SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN---EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LKT + ++ ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E S P+       DL ++CTMP +EIG +GGGT L  Q +C++ML +    ++ P E+    AR++C TV+  E++L+A L    LVKSHM  NR++
Sbjct:  684 SGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITLMEASGPTN-----EDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSK 873          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Human
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:HGNC Symbol;Acc:HGNC:5006])

HSP 1 Score: 124.02 bits (310), Expect = 5.460e-32
Identity = 86/196 (43.88%), Postives = 121/196 (61.73%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELE-SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN---EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LKT + ++ ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E S P+       DL ++CTMP +EIG +GGGT L  Q +C++ML +    ++ P E+    AR++C TV+  E++L+A L    LVKSHM  NR++
Sbjct:  684 SGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITLMEASGPTN-----EDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSK 873          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Human
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:HGNC Symbol;Acc:HGNC:5006])

HSP 1 Score: 123.635 bits (309), Expect = 5.640e-32
Identity = 86/196 (43.88%), Postives = 121/196 (61.73%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELE-SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN---EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LKT + ++ ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E S P+       DL ++CTMP +EIG +GGGT L  Q +C++ML +    ++ P E+    AR++C TV+  E++L+A L    LVKSHM  NR++
Sbjct:  631 SGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITLMEASGPTN-----EDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSK 820          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Human
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:HGNC Symbol;Acc:HGNC:5006])

HSP 1 Score: 51.2174 bits (121), Expect = 1.166e-7
Identity = 22/45 (48.89%), Postives = 31/45 (68.89%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISL 136
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LKT + ++
Sbjct:   14 SGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAM 58          

HSP 2 Score: 46.2098 bits (108), Expect = 6.361e-6
Identity = 34/112 (30.36%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  305 VPSKVHIDKRDLIVTCTMPCLEIGV----IG-------GGTKLHAQS-------SCIKMLNLN---EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            +P+KV    R+++ T T   +E+ +    +G       GG   HA +       +C +ML +    ++ P E+    AR++C TV+  E++L+A L    LVKSHM  NR++
Sbjct:   42 IPAKV---VREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSK 150          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Human
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:HGNC Symbol;Acc:HGNC:5006])

HSP 1 Score: 46.9802 bits (110), Expect = 1.795e-6
Identity = 20/38 (52.63%), Postives = 26/38 (68.42%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSIL 115
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +L
Sbjct:   11 SGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREML 48          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Celegans
Match: hmgr-1 (3-hydroxy-3-methylglutaryl coenzyme A reductase [Source:UniProtKB/TrEMBL;Acc:Q19207])

HSP 1 Score: 132.494 bits (332), Expect = 8.902e-36
Identity = 87/197 (44.16%), Postives = 120/197 (60.91%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLN---LNEEKP---SEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQNK 574
            SGN+C DKK+ A NW  GRG+SV+AEC +  +++   L+T    L  L   K   GS+ AG+  G     A  V A   A TGQD AQVV SS C T +E     V  DK +L V+CT+PC+E+G +GGGT L  Q +C++ L     N+E+P   +E  A +I ATVL  E++L+A L T++LV SHM LNR++ +
Sbjct:  315 SGNLCVDKKAAAKNWTEGRGRSVVAECLIPREVVTKTLRTTPEQLAYLTTTKLHIGSSRAGAVGGSNAHAANIVAAIFIA-TGQDAAQVVSSSMCSTRME-----VTADK-NLYVSCTLPCVEVGTVGGGTILAPQRACLESLGCAGPNKEQPGQNAERLAEVIAATVLAGELSLMAALTTNELVSSHMKLNRSKQQ 504          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Fly
Match: Hmgcr (gene:FBgn0263782 transcript:FBtr0084450)

HSP 1 Score: 115.546 bits (288), Expect = 2.346e-29
Identity = 91/194 (46.91%), Postives = 124/194 (63.92%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRA 565
            SGN C DKK  AINWI GRGK V+ EC +S   + S+LKTD+ +L + C      G +    + GG NAHAAN+V A+F ATGQD AQ V SS+C T +E        +  DL +TCTMP LE+G +GGGT L  QS+C++ML +   +  +P ++    A+++CATV+  E++L+A L   DLVKSHM  NR+
Sbjct:  710 SGNFCCDKKPAAINWIKGRGKRVVTECTISAATLRSVLKTDAKTLVE-CNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQDPAQNVTSSNCSTAMECWAE----NSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGAHATRPGDNAKKLAQIVCATVMAGELSLMAALVNSDLVKSHMRHNRS 898          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Zebrafish
Match: hmgcra (3-hydroxy-3-methylglutaryl-CoA reductase a [Source:ZFIN;Acc:ZDB-GENE-040401-2])

HSP 1 Score: 128.257 bits (321), Expect = 9.195e-34
Identity = 87/195 (44.62%), Postives = 123/195 (63.08%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  ILKT + +L  + ++KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E+  +       DL ++CTMP +E+G +GGGT L  Q +C+KML +   ++E P E+    A+++CATVL  E++L++ L    LVKSHM+ NR++
Sbjct:  680 SGNYCTDKKPAAINWIEGRGKSVVCETTIPAKVVKEILKTSTEALVDVNISKNLVGSAMAGSIGGYNAHAANIVAAIYIA-CGQDPAQTVGSSNCITLMEASGAT----GEDLYISCTMPSIELGTVGGGTNLPPQQACLKMLGVLGASQECPGENARQLAKVVCATVLAGELSLMSALAAGHLVKSHMTHNRSK 869          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Zebrafish
Match: hmgcra (3-hydroxy-3-methylglutaryl-CoA reductase a [Source:ZFIN;Acc:ZDB-GENE-040401-2])

HSP 1 Score: 128.257 bits (321), Expect = 9.195e-34
Identity = 87/195 (44.62%), Postives = 123/195 (63.08%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  ILKT + +L  + ++KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E+  +       DL ++CTMP +E+G +GGGT L  Q +C+KML +   ++E P E+    A+++CATVL  E++L++ L    LVKSHM+ NR++
Sbjct:  680 SGNYCTDKKPAAINWIEGRGKSVVCETTIPAKVVKEILKTSTEALVDVNISKNLVGSAMAGSIGGYNAHAANIVAAIYIA-CGQDPAQTVGSSNCITLMEASGAT----GEDLYISCTMPSIELGTVGGGTNLPPQQACLKMLGVLGASQECPGENARQLAKVVCATVLAGELSLMSALAAGHLVKSHMTHNRSK 869          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Zebrafish
Match: hmgcra (3-hydroxy-3-methylglutaryl-CoA reductase a [Source:ZFIN;Acc:ZDB-GENE-040401-2])

HSP 1 Score: 128.257 bits (321), Expect = 9.284e-34
Identity = 87/195 (44.62%), Postives = 123/195 (63.08%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  ILKT + +L  + ++KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E+  +       DL ++CTMP +E+G +GGGT L  Q +C+KML +   ++E P E+    A+++CATVL  E++L++ L    LVKSHM+ NR++
Sbjct:  680 SGNYCTDKKPAAINWIEGRGKSVVCETTIPAKVVKEILKTSTEALVDVNISKNLVGSAMAGSIGGYNAHAANIVAAIYIA-CGQDPAQTVGSSNCITLMEASGAT----GEDLYISCTMPSIELGTVGGGTNLPPQQACLKMLGVLGASQECPGENARQLAKVVCATVLAGELSLMSALAAGHLVKSHMTHNRSK 869          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Zebrafish
Match: hmgcra (3-hydroxy-3-methylglutaryl-CoA reductase a [Source:ZFIN;Acc:ZDB-GENE-040401-2])

HSP 1 Score: 128.257 bits (321), Expect = 1.112e-33
Identity = 87/195 (44.62%), Postives = 123/195 (63.08%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  ILKT + +L  + ++KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E+  +       DL ++CTMP +E+G +GGGT L  Q +C+KML +   ++E P E+    A+++CATVL  E++L++ L    LVKSHM+ NR++
Sbjct:  708 SGNYCTDKKPAAINWIEGRGKSVVCETTIPAKVVKEILKTSTEALVDVNISKNLVGSAMAGSIGGYNAHAANIVAAIYIA-CGQDPAQTVGSSNCITLMEASGAT----GEDLYISCTMPSIELGTVGGGTNLPPQQACLKMLGVLGASQECPGENARQLAKVVCATVLAGELSLMSALAAGHLVKSHMTHNRSK 897          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Zebrafish
Match: hmgcrb (3-hydroxy-3-methylglutaryl-CoA reductase b [Source:ZFIN;Acc:ZDB-GENE-051108-1])

HSP 1 Score: 108.612 bits (270), Expect = 6.717e-27
Identity = 87/195 (44.62%), Postives = 122/195 (62.56%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEK---PSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  A+NWI GRGKS + E  +   ++  +LK+ + +L +L ++KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E V +       DL V+CTMP LE+G IGGGT L AQ +C++ML ++      P E+    AR++CA+VL  E++L+A L    LV+SHM+ NR++
Sbjct:  641 SGNYCTDKKPAAVNWIHGRGKSTVCEAVIPARVVKEVLKSSTAALVELNISKNLVGSAMAGSIGGFNAHAANIVTAIYIA-CGQDPAQTVGSSNCITLMECVGT----SGEDLYVSCTMPSLELGTIGGGTGLPAQHACLQMLGVDGASVQCPGENSRTLARIVCASVLAGELSLMAALAAGHLVQSHMTHNRSK 830          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Xenopus
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:NCBI gene;Acc:100380121])

HSP 1 Score: 120.553 bits (301), Expect = 6.273e-31
Identity = 83/195 (42.56%), Postives = 119/195 (61.03%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LK+ + +L ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E+          DL ++CTMP +EIG +GGGT L  Q +C++ML +   + E P ++    A+++C TV+  E++L+A L    LVKSHM  NR++
Sbjct:  679 SGNYCTDKKPAAINWIEGRGKSVVCEAIIPARVVREVLKSSTEALVEVNINKNLIGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITIMEATGPM----NEDLYISCTMPSIEIGTVGGGTNLAPQQACLQMLGVQGASTEAPGKNACQLAQIVCGTVMAGELSLMAALAAGHLVKSHMVHNRSK 868          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Xenopus
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:NCBI gene;Acc:100380121])

HSP 1 Score: 120.168 bits (300), Expect = 8.951e-31
Identity = 83/193 (43.01%), Postives = 117/193 (60.62%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNR 562
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LK+ + +L ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E+          DL ++CTMP +EIG +GGGT L  Q +C++ML +   + E P ++    A+++C TV+  E++L+A L    LVKSHM  NR
Sbjct:  658 SGNYCTDKKPAAINWIEGRGKSVVCEAIIPARVVREVLKSSTEALVEVNINKNLIGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITIMEATGPM----NEDLYISCTMPSIEIGTVGGGTNLAPQQACLQMLGVQGASTEAPGKNACQLAQIVCGTVMAGELSLMAALAAGHLVKSHMVHNR 845          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Xenopus
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:NCBI gene;Acc:100380121])

HSP 1 Score: 120.168 bits (300), Expect = 1.068e-30
Identity = 83/193 (43.01%), Postives = 117/193 (60.62%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNR 562
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LK+ + +L ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E+          DL ++CTMP +EIG +GGGT L  Q +C++ML +   + E P ++    A+++C TV+  E++L+A L    LVKSHM  NR
Sbjct:  612 SGNYCTDKKPAAINWIEGRGKSVVCEAIIPARVVREVLKSSTEALVEVNINKNLIGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITIMEATGPM----NEDLYISCTMPSIEIGTVGGGTNLAPQQACLQMLGVQGASTEAPGKNACQLAQIVCGTVMAGELSLMAALAAGHLVKSHMVHNR 799          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Mouse
Match: Hmgcr (3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Source:MGI Symbol;Acc:MGI:96159])

HSP 1 Score: 122.479 bits (306), Expect = 1.248e-31
Identity = 84/196 (42.86%), Postives = 120/196 (61.22%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELE-SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN---EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGK+V+ E  +   ++  +LKT + ++  + + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E S P+       DL ++CTMP +EIG +GGGT L  Q +C++ML +    ++ P E+    AR++C TV+  E++L+A L    LV+SHM  NR++
Sbjct:  683 SGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITLMEASGPTN-----EDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVRSHMVHNRSK 872          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Mouse
Match: Hmgcr (3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Source:MGI Symbol;Acc:MGI:96159])

HSP 1 Score: 87.4261 bits (215), Expect = 1.547e-19
Identity = 64/143 (44.76%), Postives = 88/143 (61.54%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELE-SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKM 427
            SGN C+DKK  AINWI GRGK+V+ E  +   ++  +LKT + ++  + + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E S P+       DL ++CTMP +EIG +GGGT L  Q +C+++
Sbjct:  683 SGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA-CGQDAAQNVGSSNCITLMEASGPTN-----EDLYISCTMPSIEIGTVGGGTNLLPQQACLQV 819          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Mouse
Match: Hmgcr (3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Source:MGI Symbol;Acc:MGI:96159])

HSP 1 Score: 50.0618 bits (118), Expect = 1.934e-7
Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISL 136
            SGN C+DKK  AINWI GRGK+V+ E  +   ++  +LKT + ++
Sbjct:   14 SGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVLKTTTEAM 58          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Mouse
Match: Hmgcr (3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Source:MGI Symbol;Acc:MGI:96159])

HSP 1 Score: 50.8322 bits (120), Expect = 2.146e-7
Identity = 21/40 (52.50%), Postives = 28/40 (70.00%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKT 121
            SGN C+DKK  AINWI GRGK+V+ E  +   ++  +LKT
Sbjct:  145 SGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVLKT 184          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. UniProt/SwissProt
Match: sp|P16237|HMDH_SCHMA (3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.120e-46
Identity = 99/190 (52.11%), Postives = 134/190 (70.53%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGNMC+DKK   IN ILGRGKSVIAE  LS D++  +L T++  L +L  +KN    +        G NAHAAN++A +FAATGQDLAQVV SSSC+T+LE     V +    L+ + TMPCLE+G +GGGT+L  Q +C+ +L+L+ ++P+EH +R+I  TVL AE++L+A L TDDLVK+HM  NRA+
Sbjct:  692 SGNMCTDKKPATINTILGRGKSVIAEAHLSADVLAQVLHTNAQRLARLTHSKNWIGSAMAGCPGMMGCNAHAANIIAGMFAATGQDLAQVVDSSSCLTQLE-----VDLSDDSLVASVTMPCLEVGTVGGGTRLSGQRACLDLLDLSVDRPTEHLSRIIAGTVLAAELSLMAALDTDDLVKAHMHFNRAK 876          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. UniProt/SwissProt
Match: sp|P34136|HMDH2_DICDI (3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Dictyostelium discoideum OX=44689 GN=hmgB PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 3.849e-35
Identity = 88/193 (45.60%), Postives = 124/193 (64.25%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKP---SEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNR 562
            SGN+C+DKK ++INW+ GRGKSV+AE  +S DI+  +LKT   +L  L + KN  GSA+AGS  G     +  V A   A TGQD AQ V+SS+CIT +ES+        +DL ++ TMP +E+G +GGGT L AQS+C+ +L +   N E+P   SE  AR++ A VL  E++L++ L    LV+SH+  NR
Sbjct:  318 SGNVCTDKKPSSINWLEGRGKSVVAEAVISGDIVRDVLKTTVEALVSLNIDKNLIGSAMAGSIGGFNAHASNIVTALYIA-TGQDPAQNVESSNCITLMESINGG-----KDLYISVTMPSIEVGTVGGGTHLPAQSACLDLLKIRGANLERPGANSEQLARVVAAAVLSGELSLMSALAAGHLVRSHLKHNR 504          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. UniProt/SwissProt
Match: sp|O76819|HMDH_AGRIP (3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Agrotis ipsilon OX=56364 GN=HMGR PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.637e-35
Identity = 92/193 (47.67%), Postives = 122/193 (63.21%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN--EEKPSEHFAR---LICATVLCAEINLLATLQTDDLVKSHMSLNRA 565
            SGN CSDKK+ AINW+ GRGK V+ E  ++ D + +I KTD+ +L + C        +    + GG NAHAAN+V AI+ ATGQD AQ V SS+C T +E        +  DL VTCTMP LE+G +GGGT L  Q +C+ +L +     +P+E+ AR   LICATVL  E++L+A L   DLVKSHM  NR+
Sbjct:  628 SGNYCSDKKAAAINWVKGRGKRVVCETTITSDSLRTIFKTDAKTLAR-CNKIKNLSGSALAGSIGGNNAHAANMVTAIYIATGQDPAQNVTSSNCSTNMEVCGE----NGEDLYVTCTMPSLEVGTVGGGTILTGQGACLDILGVKGAGARPAENSARLASLICATVLAGELSLMAALVNSDLVKSHMRHNRS 815          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. UniProt/SwissProt
Match: sp|Q9XHL5|HMDH3_ORYSJ (3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=HMG3 PE=2 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 8.361e-35
Identity = 87/194 (44.85%), Postives = 121/194 (62.37%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRA 565
            SGN CSDKK  A+NWI GRGKSV+ E  +  D++  +LKT+  SL +L + KN +GSA+AG+  G     +  V A   A TGQD AQ V+SS CIT LE+V      D RDL ++ TMP +E+G +GGGT+L +Q++C+ +L +   N E P  +    A ++   VL  E++LL+ L    LVKSHM  NR+
Sbjct:  365 SGNFCSDKKPAAVNWIEGRGKSVVCEAVIKEDVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIA-TGQDPAQNVESSHCITMLEAVN-----DGRDLHISVTMPSIEVGTVGGGTQLASQAACLDLLGVKGANRESPGSNARLLATVVAGGVLAGELSLLSALAAGQLVKSHMKYNRS 552          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. UniProt/SwissProt
Match: sp|P29058|HMDH2_HEVBR (3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (Fragment) OS=Hevea brasiliensis OX=3981 GN=HMGR2 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.037e-34
Identity = 81/194 (41.75%), Postives = 120/194 (61.86%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN---EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRA 565
            SGN CSDKK  A+NWI GRGKSV+ E  +  +++  +LKTD   L +L + KN +GSA+AG+  G        V A   A TGQD AQ V+SS CIT +E+V      D +DL ++ T+P +E+G +GGGT+L +QS+C+ +L +    +E P  +    A ++  +VL  E++L++ +    LVKSHM  NR+
Sbjct:   14 SGNFCSDKKPAAVNWIEGRGKSVVCEAIIKEEVVKKVLKTDVALLVELNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIA-TGQDPAQNVESSHCITMMEAVN-----DGKDLHISVTLPSIEVGTVGGGTQLASQSACLNLLGVMGACKESPGSYSRLLATIVAGSVLAGELSLMSAIAAGQLVKSHMKYNRS 201          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. TrEMBL
Match: A0A158QGE4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS10510 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 3.306e-47
Identity = 103/188 (54.79%), Postives = 136/188 (72.34%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNR 562
            SGNMCSDKK  AIN ++GRGKSV+AE ++   ++  IL+TD+  L +L   KN +GSA+AGS         AAN+VAA+FAATGQDLAQVV SS+C+T+LE+      +D   L V+ TMPC+E+G +GGGT+L AQ  C++ML+L  E+P+EH ARLI   VL  EI+LLA L T+DLV++HM LNR
Sbjct:  168 SGNMCSDKKPAAINQVMGRGKSVLAEARIPGRVVAKILRTDAKQLSRLTQIKNGTGSAMAGSLGMASANAHAANLVAAVFAATGQDLAQVVDSSACMTQLEA-----ELDG-GLYVSVTMPCIEVGTVGGGTRLQAQRGCLEMLDLQVERPAEHLARLIAGMVLAGEISLLAALATNDLVQAHMRLNR 349          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. TrEMBL
Match: A0A5K4ENF8 (3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.888e-46
Identity = 103/190 (54.21%), Postives = 139/190 (73.16%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGNMC+DKK   IN ILGRGKSVIAE  LS D++  +L T++  L +L  +KN+ GSA+AG       NAHAAN++A +FAATGQDLAQVV SSSC+T+LE     V +    L+ + TMPCLE+G +GGGT+L  Q +C+ +L+L+ ++P+EH +R+I  TVL AE++L+A L TDDLVK+HM  NRA+
Sbjct:  151 SGNMCTDKKPATINTILGRGKSVIAEAHLSADVLAQVLHTNAQRLARLTHSKNWIGSAMAGCPGMMGCNAHAANIIAGMFAATGQDLAQVVDSSSCLTQLE-----VDLSDDSLVASVTMPCLEVGTVGGGTRLSGQRACLDLLDLSVDRPTEHLSRIIAGTVLAAELSLMAALDTDDLVKAHMHFNRAK 335          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. TrEMBL
Match: A0A3P8F2B5 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3747 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 5.574e-46
Identity = 106/189 (56.08%), Postives = 137/189 (72.49%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRA 565
            SGNMC+DKK  AIN ILGRGKSVIAE QL   ++  +L T +  L +L  AKN++GSA+AG     G NAHAAN+VA IFAATGQDLAQVV +S+C+T+ E        D   L+ T TMPC+E+G IGGGT+L AQ SC+ +L+L+ ++P+EH AR+I  TVL  E++L+A L TDDLV +H+ LNRA
Sbjct:  154 SGNMCTDKKPAAINSILGRGKSVIAEAQLPATVLAQVLHTTATRLTRLAHAKNWTGSAMAGCPGMMGSNAHAANIVAGIFAATGQDLAQVVDASACLTQFEIG------DNNSLVATVTMPCMEVGTIGGGTRLPAQRSCLDLLDLSVDRPTEHLARIIAGTVLAGELSLMAALDTDDLVNAHLRLNRA 336          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. TrEMBL
Match: A0A183A9W2 (Uncharacterized protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 6.401e-46
Identity = 106/189 (56.08%), Postives = 137/189 (72.49%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRA 565
            SGNMC+DKK  AIN ILGRGKSVIAE QL   ++  +L T +  L +L  AKN++GSA+AG     G NAHAAN+VA IFAATGQDLAQVV +S+C+T+ E        D   L+ T TMPC+E+G IGGGT+L AQ SC+ +L+L+ ++P+EH AR+I  TVL  E++L+A L TDDLV +H+ LNRA
Sbjct:  154 SGNMCTDKKPAAINSILGRGKSVIAEAQLPATVLAQVLHTTATRLTRLAHAKNWTGSAMAGCPGMMGSNAHAANIVAGIFAATGQDLAQVVDASACLTQFEIG------DNNSLVATVTMPCMEVGTIGGGTRLPAQRSCLDLLDLSVDRPTEHLARIIAGTVLAGELSLMAALDTDDLVNAHLRLNRA 336          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. TrEMBL
Match: A0A183R6Q7 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.908e-45
Identity = 102/190 (53.68%), Postives = 138/190 (72.63%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGNMC+DKK   IN ILGRGKSVIAE  LS D++  +L T++  L +L  +KN+ GSA+AG       NAHAAN++A +FAATGQDLAQVV SSSC+T+LE     V +    L+ + TMPCLE+G +GGGT+L  Q +C+ +L+L+ ++P+EH +R+I  TVL AE++L+A L T DLVK+HM  NRA+
Sbjct:  151 SGNMCTDKKPATINTILGRGKSVIAEAHLSADVLAQVLHTNAQRLARLTHSKNWIGSAMAGCPGMMGCNAHAANIIAGMFAATGQDLAQVVDSSSCLTQLE-----VDLSDDSLVASVTMPCLEVGTVGGGTRLSGQRACLDLLDLSVDRPTEHLSRIIAGTVLAAELSLMAALDTHDLVKAHMHFNRAK 335          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Cavefish
Match: hmgcrb (3-hydroxy-3-methylglutaryl-coenzyme A reductase-like [Source:NCBI gene;Acc:103037085])

HSP 1 Score: 132.109 bits (331), Expect = 4.454e-35
Identity = 87/195 (44.62%), Postives = 121/195 (62.05%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEK---PSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  A+NWI GRGKS + E  +   +I  +LKT + +L +L ++KN  GSA+AGS  G     A  V A   A  GQD  Q V SS+CIT +E+V S    +  DL ++CTMP +E+G +GGGT L  Q +C++ML +       P E+    AR++CA VL  E++L+A L    LVKSHM+LNR++
Sbjct:  603 SGNYCTDKKPAAVNWIHGRGKSTVCEATIPARVIREVLKTSTAALVELNISKNLVGSAMAGSIGGFNAQAANIVAAIYIA-CGQDPGQTVGSSNCITLMEAVGS----EGEDLCISCTMPSIELGTVGGGTNLPPQQACLQMLGVQGASVDCPGENARMLARVVCAAVLAGELSLMAALAAGHLVKSHMTLNRSK 792          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Cavefish
Match: hmgcrb (3-hydroxy-3-methylglutaryl-coenzyme A reductase-like [Source:NCBI gene;Acc:103037085])

HSP 1 Score: 131.724 bits (330), Expect = 6.072e-35
Identity = 87/195 (44.62%), Postives = 121/195 (62.05%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEK---PSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  A+NWI GRGKS + E  +   +I  +LKT + +L +L ++KN  GSA+AGS  G     A  V A   A  GQD  Q V SS+CIT +E+V S    +  DL ++CTMP +E+G +GGGT L  Q +C++ML +       P E+    AR++CA VL  E++L+A L    LVKSHM+LNR++
Sbjct:  685 SGNYCTDKKPAAVNWIHGRGKSTVCEATIPARVIREVLKTSTAALVELNISKNLVGSAMAGSIGGFNAQAANIVAAIYIA-CGQDPGQTVGSSNCITLMEAVGS----EGEDLCISCTMPSIELGTVGGGTNLPPQQACLQMLGVQGASVDCPGENARMLARVVCAAVLAGELSLMAALAAGHLVKSHMTLNRSK 874          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Cavefish
Match: hmgcrb (3-hydroxy-3-methylglutaryl-coenzyme A reductase-like [Source:NCBI gene;Acc:103037085])

HSP 1 Score: 131.339 bits (329), Expect = 6.651e-35
Identity = 87/195 (44.62%), Postives = 121/195 (62.05%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEK---PSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  A+NWI GRGKS + E  +   +I  +LKT + +L +L ++KN  GSA+AGS  G     A  V A   A  GQD  Q V SS+CIT +E+V S    +  DL ++CTMP +E+G +GGGT L  Q +C++ML +       P E+    AR++CA VL  E++L+A L    LVKSHM+LNR++
Sbjct:  669 SGNYCTDKKPAAVNWIHGRGKSTVCEATIPARVIREVLKTSTAALVELNISKNLVGSAMAGSIGGFNAQAANIVAAIYIA-CGQDPGQTVGSSNCITLMEAVGS----EGEDLCISCTMPSIELGTVGGGTNLPPQQACLQMLGVQGASVDCPGENARMLARVVCAAVLAGELSLMAALAAGHLVKSHMTLNRSK 858          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Cavefish
Match: hmgcra (3-hydroxy-3-methylglutaryl-coenzyme A reductase [Source:NCBI gene;Acc:103033046])

HSP 1 Score: 127.102 bits (318), Expect = 2.104e-33
Identity = 88/196 (44.90%), Postives = 121/196 (61.73%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELE-SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LKT + +L  + + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E S P+       DL ++CTMP +E+G +GGGT L  Q +C++ML +   +E  P E+    AR++C TVL  E++L+A L    LVKSHM+ NR++
Sbjct:  684 SGNYCTDKKPAAINWIEGRGKSVVCEATIPAKVVKEVLKTSTEALVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA-CGQDPAQTVGSSNCITLMEASGPTG-----EDLYISCTMPSIELGTVGGGTNLAPQQACLQMLGVQGASEAHPGENARQLARVVCTTVLAGELSLMAALAAGHLVKSHMTHNRSK 873          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Cavefish
Match: hmgcra (3-hydroxy-3-methylglutaryl-coenzyme A reductase [Source:NCBI gene;Acc:103033046])

HSP 1 Score: 127.102 bits (318), Expect = 2.104e-33
Identity = 88/196 (44.90%), Postives = 121/196 (61.73%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELE-SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKSV+ E  +   ++  +LKT + +L  + + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E S P+       DL ++CTMP +E+G +GGGT L  Q +C++ML +   +E  P E+    AR++C TVL  E++L+A L    LVKSHM+ NR++
Sbjct:  684 SGNYCTDKKPAAINWIEGRGKSVVCEATIPAKVVKEVLKTSTEALVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIA-CGQDPAQTVGSSNCITLMEASGPTG-----EDLYISCTMPSIELGTVGGGTNLAPQQACLQMLGVQGASEAHPGENARQLARVVCTTVLAGELSLMAALAAGHLVKSHMTHNRSK 873          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Sea Lamprey
Match: HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase [Source:HGNC Symbol;Acc:HGNC:5006])

HSP 1 Score: 123.635 bits (309), Expect = 7.684e-33
Identity = 82/195 (42.05%), Postives = 122/195 (62.56%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINW+LGRGK+V++E  +   ++  +LKT + +L ++ ++KN  GSA+AG+  G     A  V A   A  GQD AQ V SS+C+T +E+          DL ++CTMP +EIG +GGGT L  Q +C+KML +   +++ P  +    AR++C TVL  E++L++ L    LVKSHM  NR++
Sbjct:  692 SGNYCTDKKPAAINWLLGRGKTVVSEAVIPAKVVHEVLKTTTEALVEVNISKNLIGSAMAGTIGGYNAHAANIVTAIFIA-CGQDPAQNVGSSNCMTLMEATGPY----GDDLHISCTMPSIEIGTVGGGTNLAPQQACLKMLGILGASKDDPGSNACTLARVVCGTVLAGELSLMSALAAGHLVKSHMIHNRSK 881          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Yeast
Match: HMG2 (HMG-CoA reductase; converts HMG-CoA to mevalonate, a rate-limiting step in sterol biosynthesis; one of two isozymes; overproduction induces assembly of peripheral ER membrane arrays and short nuclear-associated membrane stacks; forms foci at nuclear periphery upon DNA replication stress; HMG2 has a paralog, HMG1, that arose from the whole genome duplication; human homolog HMGCR can complement yeast hmg2 mutant [Source:SGD;Acc:S000004442])

HSP 1 Score: 121.709 bits (304), Expect = 1.868e-32
Identity = 85/197 (43.15%), Postives = 117/197 (59.39%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSE------HFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQNK 574
            SGN C+DKK  AINWI GRGKSV+AE  +  D++ S+LK+D  +L +L ++KN  GSA+AGS  G     A  V A   A  GQD AQ V+SS+CIT ++ V         DL ++ +MP +E+G IGGGT L  Q + + +L +    P+E        AR+I   VL  E++L + L    LV+SHM+ NR  NK
Sbjct:  837 SGNYCTDKKPAAINWIEGRGKSVVAEATIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLAL-GQDPAQNVESSNCITLMKEVDG-------DLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPTEPGANARQLARIIACAVLAGELSLCSALAAGHLVQSHMTHNRKTNK 1025          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Yeast
Match: HMG1 (HMG-CoA reductase; catalyzes conversion of HMG-CoA to mevalonate, which is a rate-limiting step in sterol biosynthesis; one of two isozymes; localizes to nuclear envelope; overproduction induces formation of karmellae; forms foci at nuclear periphery upon DNA replication stress; HMG1 has a paralog, HMG2, that arose from the whole genome duplication; human homolog HMGCR can complement yeast hmg1 mutant [Source:SGD;Acc:S000004540])

HSP 1 Score: 113.235 bits (282), Expect = 2.074e-29
Identity = 82/193 (42.49%), Postives = 114/193 (59.07%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKP---SEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNR 562
            SGN C+DKK  AINWI GRGKSV+AE  +  D++  +LK+D  +L +L +AKN  GSA+AGS  G     A  V A   A  GQD AQ V+SS+CIT ++ V         DL ++ +MP +E+G IGGGT L  Q + + +L +   +   P   +   AR++   VL  E++L A L    LV+SHM+ NR
Sbjct:  841 SGNYCTDKKPAAINWIEGRGKSVVAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGGFNAHAANLVTAVFLAL-GQDPAQNVESSNCITLMKEVDG-------DLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHATAPGTNARQLARIVACAVLAGELSLCAALAAGHLVQSHMTHNR 1025          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Medaka
Match: hmgcra (3-hydroxy-3-methylglutaryl-coenzyme A reductase [Source:NCBI gene;Acc:100125499])

HSP 1 Score: 129.798 bits (325), Expect = 1.566e-35
Identity = 86/195 (44.10%), Postives = 122/195 (62.56%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWI GRGKS + E  +   ++  +LKT + +L ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E  PS       DL ++CTMP +E+G +GGGT L  Q +C++ML +   +++ P E+    AR++CATVL  E++L++ L    LVKSHM+ NR++
Sbjct:  200 SGNFCTDKKPAAINWIEGRGKSAVCEATIPSKVVQEVLKTTTAALVEVNIQKNLVGSAMAGSIGGFNAHAANLVAAIYIA-CGQDPAQAVGSSNCITLME--PSGPM--GEDLYISCTMPSIELGTVGGGTNLPPQQACLQMLGVQGASQDHPGENARQLARVVCATVLAGELSLMSALAAGHLVKSHMTHNRSK 389          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Medaka
Match: hmgcrb (3-hydroxy-3-methylglutaryl-coenzyme A reductase [Source:NCBI gene;Acc:101166888])

HSP 1 Score: 131.339 bits (329), Expect = 6.311e-35
Identity = 88/193 (45.60%), Postives = 124/193 (64.25%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN-EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWILGRGKS + E  +   ++  +LK+ + +L +L ++KN  GSA+AGS  G     A  V A   A  GQD AQ V SSSCIT++E  PS    D +DL ++CTMP +E+G +GGGT L  Q +C++ML ++   +P E+    AR++C  VL  E++L+A L    LVKSHM+ NR++
Sbjct:  652 SGNYCTDKKPAAINWILGRGKSAVCEATIPGQVVREVLKSSAGALVELNISKNLVGSAMAGSVGGFNAHAANIVAAIFIA-CGQDPAQAVSSSSCITQME--PSGP--DGQDLYISCTMPSIELGTVGGGTNLPPQQACLQMLGVSGPNEPGENARQLARVVCGAVLAGELSLMAALAAGHLVKSHMTHNRSK 839          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Medaka
Match: hmgcrb (3-hydroxy-3-methylglutaryl-coenzyme A reductase [Source:NCBI gene;Acc:101166888])

HSP 1 Score: 131.339 bits (329), Expect = 6.311e-35
Identity = 88/193 (45.60%), Postives = 124/193 (64.25%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLN-EEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQ 568
            SGN C+DKK  AINWILGRGKS + E  +   ++  +LK+ + +L +L ++KN  GSA+AGS  G     A  V A   A  GQD AQ V SSSCIT++E  PS    D +DL ++CTMP +E+G +GGGT L  Q +C++ML ++   +P E+    AR++C  VL  E++L+A L    LVKSHM+ NR++
Sbjct:  652 SGNYCTDKKPAAINWILGRGKSAVCEATIPGQVVREVLKSSAGALVELNISKNLVGSAMAGSVGGFNAHAANIVAAIFIA-CGQDPAQAVSSSSCITQME--PSGP--DGQDLYISCTMPSIELGTVGGGTNLPPQQACLQMLGVSGPNEPGENARQLARVVCGAVLAGELSLMAALAAGHLVKSHMTHNRSK 839          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Medaka
Match: hmgcra (3-hydroxy-3-methylglutaryl-coenzyme A reductase [Source:NCBI gene;Acc:100125499])

HSP 1 Score: 125.561 bits (314), Expect = 6.535e-33
Identity = 86/193 (44.56%), Postives = 120/193 (62.18%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNL---NEEKPSEH---FARLICATVLCAEINLLATLQTDDLVKSHMSLNR 562
            SGN C+DKK  AINWI GRGKS + E  +   ++  +LKT + +L ++ + KN  GSA+AGS  G     A  V A   A  GQD AQ V SS+CIT +E  PS       DL ++CTMP +E+G +GGGT L  Q +C++ML +   +++ P E+    AR++CATVL  E++L++ L    LVKSHM+ NR
Sbjct:  678 SGNFCTDKKPAAINWIEGRGKSAVCEATIPSKVVQEVLKTTTAALVEVNIQKNLVGSAMAGSIGGFNAHAANLVAAIYIA-CGQDPAQAVGSSNCITLME--PSGPM--GEDLYISCTMPSIELGTVGGGTNLPPQQACLQMLGVQGASQDHPGENARQLARVVCATVLAGELSLMSALAAGHLVKSHMTHNR 865          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Medaka
Match: hmgcra (3-hydroxy-3-methylglutaryl-coenzyme A reductase [Source:NCBI gene;Acc:100125499])

HSP 1 Score: 52.7582 bits (125), Expect = 8.017e-8
Identity = 23/52 (44.23%), Postives = 34/52 (65.38%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAK 157
            SGN C+DKK  AINWI GRGKS + E  +   ++  +LKT + +L ++ + K
Sbjct:  678 SGNFCTDKKPAAINWIEGRGKSAVCEATIPSKVVQEVLKTTTAALVEVNIQK 729          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Planmine SMEST
Match: SMESG000062639.1 (SMESG000062639.1)

HSP 1 Score: 322.013 bits (824), Expect = 6.453e-110
Identity = 192/192 (100.00%), Postives = 192/192 (100.00%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQNKC 577
            SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKNFSGSALAGSASGGFNAHAANVVAAIFAATGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQNKC
Sbjct:  235 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKNFSGSALAGSASGGFNAHAANVVAAIFAATGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQNKC 426          
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Planmine SMEST
Match: SMESG000062633.1 (SMESG000062633.1)

HSP 1 Score: 233.417 bits (594), Expect = 3.928e-75
Identity = 141/191 (73.82%), Postives = 172/191 (90.05%), Query Frame = 2
Query:    2 SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGQDLAQVVQSSSCITELESVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKPSEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQNK 574
            SGNMCSDKK+TAINWILGRGKSVIAECQLSH+I+  ILKTD++SLEKLC+AKNFSGSALAGSA+GG+NAHAANVVAAIFAATGQDLAQVV+SSSCITE+E++PS     K+DL++TCTMP LE+G IGGGTKL  Q +C+ +++L+++  SEHF+R+ICATVLCAE++L+A LQT+DLV SH+ LNRAQ K
Sbjct:  239 SGNMCSDKKATAINWILGRGKSVIAECQLSHEIVEGILKTDAVSLEKLCIAKNFSGSALAGSAAGGYNAHAANVVAAIFAATGQDLAQVVESSSCITEIEALPSASDPCKQDLLITCTMPSLEVGTIGGGTKLEEQRACLNLIDLHKDNSSEHFSRIICATVLCAELSLMAALQTNDLVSSHLLLNRAQVK 429          
The following BLAST results are available for this feature:
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMGCR5.460e-3243.883-hydroxy-3-methylglutaryl-CoA reductase [Source:H... [more]
HMGCR5.460e-3243.883-hydroxy-3-methylglutaryl-CoA reductase [Source:H... [more]
HMGCR5.640e-3243.883-hydroxy-3-methylglutaryl-CoA reductase [Source:H... [more]
HMGCR1.166e-748.893-hydroxy-3-methylglutaryl-CoA reductase [Source:H... [more]
HMGCR1.795e-652.633-hydroxy-3-methylglutaryl-CoA reductase [Source:H... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hmgr-18.902e-3644.163-hydroxy-3-methylglutaryl coenzyme A reductase [... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hmgcr2.346e-2946.91gene:FBgn0263782 transcript:FBtr0084450[more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcra9.195e-3444.623-hydroxy-3-methylglutaryl-CoA reductase a [Source... [more]
hmgcra9.195e-3444.623-hydroxy-3-methylglutaryl-CoA reductase a [Source... [more]
hmgcra9.284e-3444.623-hydroxy-3-methylglutaryl-CoA reductase a [Source... [more]
hmgcra1.112e-3344.623-hydroxy-3-methylglutaryl-CoA reductase a [Source... [more]
hmgcrb6.717e-2744.623-hydroxy-3-methylglutaryl-CoA reductase b [Source... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
HMGCR6.273e-3142.563-hydroxy-3-methylglutaryl-CoA reductase [Source:N... [more]
HMGCR8.951e-3143.013-hydroxy-3-methylglutaryl-CoA reductase [Source:N... [more]
HMGCR1.068e-3043.013-hydroxy-3-methylglutaryl-CoA reductase [Source:N... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hmgcr1.248e-3142.863-hydroxy-3-methylglutaryl-Coenzyme A reductase [S... [more]
Hmgcr1.547e-1944.763-hydroxy-3-methylglutaryl-Coenzyme A reductase [S... [more]
Hmgcr1.934e-746.673-hydroxy-3-methylglutaryl-Coenzyme A reductase [S... [more]
Hmgcr2.146e-752.503-hydroxy-3-methylglutaryl-Coenzyme A reductase [S... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16237|HMDH_SCHMA3.120e-4652.113-hydroxy-3-methylglutaryl-coenzyme A reductase OS... [more]
sp|P34136|HMDH2_DICDI3.849e-3545.603-hydroxy-3-methylglutaryl-coenzyme A reductase 2 ... [more]
sp|O76819|HMDH_AGRIP4.637e-3547.673-hydroxy-3-methylglutaryl-coenzyme A reductase OS... [more]
sp|Q9XHL5|HMDH3_ORYSJ8.361e-3544.853-hydroxy-3-methylglutaryl-coenzyme A reductase 3 ... [more]
sp|P29058|HMDH2_HEVBR1.037e-3441.753-hydroxy-3-methylglutaryl-coenzyme A reductase 2 ... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QGE43.306e-4754.79Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K4ENF82.888e-4654.213-hydroxy-3-methylglutaryl-coenzyme A reductase OS... [more]
A0A3P8F2B55.574e-4656.08Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A183A9W26.401e-4656.08Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A183R6Q73.908e-4553.68Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcrb4.454e-3544.623-hydroxy-3-methylglutaryl-coenzyme A reductase-li... [more]
hmgcrb6.072e-3544.623-hydroxy-3-methylglutaryl-coenzyme A reductase-li... [more]
hmgcrb6.651e-3544.623-hydroxy-3-methylglutaryl-coenzyme A reductase-li... [more]
hmgcra2.104e-3344.903-hydroxy-3-methylglutaryl-coenzyme A reductase [S... [more]
hmgcra2.104e-3344.903-hydroxy-3-methylglutaryl-coenzyme A reductase [S... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
HMGCR7.684e-3342.053-hydroxy-3-methylglutaryl-CoA reductase [Source:H... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HMG21.868e-3243.15HMG-CoA reductase; converts HMG-CoA to mevalonate,... [more]
HMG12.074e-2942.49HMG-CoA reductase; catalyzes conversion of HMG-CoA... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcra1.566e-3544.103-hydroxy-3-methylglutaryl-coenzyme A reductase [S... [more]
hmgcrb6.311e-3545.603-hydroxy-3-methylglutaryl-coenzyme A reductase [S... [more]
hmgcrb6.311e-3545.603-hydroxy-3-methylglutaryl-coenzyme A reductase [S... [more]
hmgcra6.535e-3344.563-hydroxy-3-methylglutaryl-coenzyme A reductase [S... [more]
hmgcra8.017e-844.233-hydroxy-3-methylglutaryl-coenzyme A reductase [S... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl-coenzyme A reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000062639.16.453e-110100.00SMESG000062639.1[more]
SMESG000062633.13.928e-7573.82SMESG000062633.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015159 ID=SMED30015159|Name=3-hydroxy-3-methylglutaryl-coenzyme A reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=646bp
CAGTGGCAACATGTGCAGTGATAAAAAGTCAACGGCAATTAATTGGATAT
TAGGTAGGGGTAAATCGGTTATCGCAGAATGTCAACTCTCCCATGATATT
ATCGGCAGCATACTGAAAACAGACTCAATCAGCCTAGAAAAATTATGCCT
TGCTAAGAACTTTTCCGGATCCGCATTGGCAGGTTCAGCTTCTGGTGGAT
TTAATGCTCATGCTGCCAATGTAGTTGCTGCAATATTCGCTGCAACAGGA
CAAGATTTGGCCCAGGTGGTACAATCAAGTTCATGTATCACTGAATTGGA
ATCTGTTCCATCCAAGGTGCACATTGACAAGAGGGATTTAATTGTCACTT
GTACGATGCCGTGTCTTGAAATCGGAGTTATAGGCGGAGGAACTAAGCTT
CATGCTCAAAGCTCTTGTATTAAAATGCTAAACTTGAATGAGGAGAAACC
TTCTGAACATTTTGCAAGATTAATTTGTGCAACTGTGCTATGTGCTGAAA
TCAATCTTTTGGCAACATTACAAACAGATGATTTGGTCAAGTCACATATG
TCACTGAATAGGGCACAAAATAAATGTTGAATTGTATACCAGTTTACTAA
TATGATTTCGTTTTTTCATTTATAACAATAAATCCTTTCAGACTTC
back to top

protein sequence of SMED30015159-orf-1

>SMED30015159-orf-1 ID=SMED30015159-orf-1|Name=SMED30015159-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
SGNMCSDKKSTAINWILGRGKSVIAECQLSHDIIGSILKTDSISLEKLCL
AKNFSGSALAGSASGGFNAHAANVVAAIFAATGQDLAQVVQSSSCITELE
SVPSKVHIDKRDLIVTCTMPCLEIGVIGGGTKLHAQSSCIKMLNLNEEKP
SEHFARLICATVLCAEINLLATLQTDDLVKSHMSLNRAQNKC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002202HMG_CoA_Rdtase
IPR023074HMG_CoA_Rdtase_cat_sf
IPR009023HMG_CoA_Rdtase_NAD(P)-bd_sf
IPR023076HMG_CoA_Rdtase_CS
IPR009029HMG_CoA_Rdtase_sub-bd_dom_sf
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0015936coenzyme A metabolic process
GO:0006629lipid metabolic process
GO:0006694steroid biosynthetic process
GO:0006695cholesterol biosynthetic process
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
GO:0008299isoprenoid biosynthetic process
GO:0016126sterol biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004420hydroxymethylglutaryl-CoA reductase (NADPH) activity
GO:0050662coenzyme binding
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016491oxidoreductase activity
GO:0050661NADP binding
Vocabulary: cellular component
TermDefinition
GO:0005777peroxisome
GO:0005778peroxisomal membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPRINTSPR00071HMGCOARDTASEcoord: 1..26
score: 71.79
coord: 112..133
score: 56.16
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPFAMPF00368HMG-CoA_redcoord: 1..187
e-value: 3.7E-58
score: 197.3
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPANTHERPTHR105723-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASEcoord: 1..190
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPROSITEPS50065HMG_COA_REDUCTASE_4coord: 1..187
score: 45.44
IPR023074Hydroxymethylglutaryl-CoA reductase, class I/II, catalytic domain superfamilyGENE3DG3DSA:3.90.770.10coord: 21..173
e-value: 1.6E-58
score: 200.2
IPR009023Hydroxymethylglutaryl-CoA reductase, class I/II, NAD/NADP-binding domain superfamilyGENE3DG3DSA:3.30.70.420coord: 1..20
e-value: 1.6E-58
score: 200.2
NoneNo IPR availablePANTHERPTHR10572:SF23-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASEcoord: 1..190
IPR023076Hydroxymethylglutaryl-CoA reductase, class I/II, conserved sitePROSITEPS00318HMG_COA_REDUCTASE_2coord: 124..131
IPR009029Hydroxymethylglutaryl-CoA reductase, class I/II, substrate-binding domain superfamilySUPERFAMILYSSF56542Substrate-binding domain of HMG-CoA reductasecoord: 14..176