Phosphatidylinositol transfer protein alpha isoform

Overview
NamePhosphatidylinositol transfer protein alpha isoform
Smed IDSMED30015151
Length (bp)1319
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol transfer protein alpha isoform (SMED30015151) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol transfer protein alpha isoform (SMED30015151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol transfer protein alpha isoform (SMED30015151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol transfer protein alpha isoform (SMED30015151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015151SMESG000014949.1 Contig3802GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30015151SMESG000014949.1 Contig49173newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015151SMESG000014949.1 Contig49173uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30015151SMESG000080104.1 SMESG000075783.1 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015151SMESG000080104.1 SMESG000075783.1 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015151SMESG000080104.1 SMESG000075783.1 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015151SMESG000080104.1 SMESG000075783.1 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30015151SMESG000080104.1 SMESG000075783.1 dd_Smed_v4_2926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015151SMESG000014949.1 dd_Smed_v4_580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015151SMESG000014949.1 dd_Smed_v4_580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015151SMESG000014949.1 dd_Smed_v4_580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015151SMESG000014949.1 dd_Smed_v4_580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015151SMESG000014949.1 dd_Smed_v4_580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015151SMESG000014949.1 dd_Smed_v4_580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015151SMESG000014949.1 dd_Smed_v4_580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015151SMESG000080104.1 SMESG000075783.1 Contig38786newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015151SMESG000080104.1 SMESG000075783.1 Contig38786uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30015151SMESG000080104.1 SMESG000075783.1 dd_Smed_v6_2926_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30015151SMESG000080104.1 SMESG000075783.1 dd_Smed_v6_2926_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Human
Match: PITPNA (phosphatidylinositol transfer protein alpha [Source:HGNC Symbol;Acc:HGNC:9001])

HSP 1 Score: 315.849 bits (808), Expect = 8.681e-106
Identity = 160/286 (55.94%), Postives = 200/286 (69.93%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +                KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  EN H+L P+     E V IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQERR+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Human
Match: PITPNA (phosphatidylinositol transfer protein alpha [Source:HGNC Symbol;Acc:HGNC:9001])

HSP 1 Score: 314.309 bits (804), Expect = 3.605e-105
Identity = 160/286 (55.94%), Postives = 199/286 (69.58%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +                KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTVL N  YMK+ F+IKIE+ H  D G  EN H+L P+     E V IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQERR+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVLPNE-YMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Human
Match: PITPNB (phosphatidylinositol transfer protein beta [Source:HGNC Symbol;Acc:HGNC:9002])

HSP 1 Score: 312.768 bits (800), Expect = 1.301e-104
Identity = 162/286 (56.64%), Postives = 197/286 (68.88%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +LIKEFRV+LP SV+EYQV QL+SVAEASKNETG GEGIEVL NEP++ +                KGQYT+KIYHL +KVP  VR IAP+ +L   EKAWNAYPYCRT++TN  YMKD F IKIE+ H  D G  EN H L P+     E+V IDIA+      ADYK D+DP LF+S+K  RGPL   P WK +++     P MCAYKLV   FKW+GLQ ++E  I KQE+RIFTNFHR  FCW+DKW  LTMEDIR +E++T+KEL+   +   VRGT+  D
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNE-YMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLG--PNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAAD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Human
Match: PITPNB (phosphatidylinositol transfer protein beta [Source:HGNC Symbol;Acc:HGNC:9002])

HSP 1 Score: 311.612 bits (797), Expect = 4.539e-104
Identity = 162/286 (56.64%), Postives = 196/286 (68.53%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +LIKEFRV+LP SV+EYQV QL+SVAEASKNETG GEGIEVL NEP++ +                KGQYT+KIYHL +KVP  VR IAP+ +L   EKAWNAYPYCRT+L N  YMKD F IKIE+ H  D G  EN H L P+     E+V IDIA+      ADYK D+DP LF+S+K  RGPL   P WK +++     P MCAYKLV   FKW+GLQ ++E  I KQE+RIFTNFHR  FCW+DKW  LTMEDIR +E++T+KEL+   +   VRGT+  D
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTILQNE-YMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLG--PNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAAD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Human
Match: PITPNB (phosphatidylinositol transfer protein beta [Source:HGNC Symbol;Acc:HGNC:9002])

HSP 1 Score: 309.301 bits (791), Expect = 2.944e-103
Identity = 161/283 (56.89%), Postives = 195/283 (68.90%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTT 926
            +LIKEFRV+LP SV+EYQV QL+SVAEASKNETG GEGIEVL NEP++ +                KGQYT+KIYHL +KVP  VR IAP+ +L   EKAWNAYPYCRT++TN  YMKD F IKIE+ H  D G  EN H L P+     E+V IDIA+      ADYK D+DP LF+S+K  RGPL   P WK +++     P MCAYKLV   FKW+GLQ ++E  I KQE+RIFTNFHR  FCW+DKW  LTMEDIR +E++T+KEL+       VRGT+
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNE-YMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLG--PNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETLRNQGQVRGTS 267          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Celegans
Match: Y54F10AR.1 (pep chromosome:WBcel235:III:2572031:2575723:-1 gene:WBGene00021854.1 transcript:Y54F10AR.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54F10AR.1)

HSP 1 Score: 335.109 bits (858), Expect = 7.807e-114
Identity = 169/277 (61.01%), Postives = 200/277 (72.20%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELY-TYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRG 920
            M+IKE+RV+LPMSVEEYQV QLWSVAEASK ETG GEG+EVL NEPFD   +VP   LLNG  +FTKGQYT+KIYHL +KVP I+R IAPK +L + E+AWNAYPYC+TV+TNP YMK+ F +KIE++H+ D G  ENAH L  D L+KREVV I+IAND  Y    D   D  P  F+S K GRGPL+    WK  + PVMCAYKLV   FKWFG Q  +E     Q  R+F+ FHR  FCW+DKW GLTM DIR IE K +KEL+EQ +   VRG
Sbjct:    1 MIIKEYRVVLPMSVEEYQVGQLWSVAEASKAETGGGEGVEVLKNEPFD---NVP---LLNG--QFTKGQYTHKIYHLQSKVPAILRKIAPKGSLAIHEEAWNAYPYCKTVVTNPDYMKENFYVKIETIHLPDNGTTENAHGLKGDELAKREVVNINIANDHEYLNSGDLHPDSTPSKFQSTKTGRGPLSGN--WKDSVQPVMCAYKLVTVYFKWFGFQKIVENYAHTQYPRLFSKFHREVFCWIDKWHGLTMVDIREIEAKAQKELEEQRKSGQVRG 267          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Celegans
Match: Y71G12B.17 (pep chromosome:WBcel235:I:1667501:1669792:1 gene:WBGene00022155.1 transcript:Y71G12B.17.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71G12B.17)

HSP 1 Score: 239.195 bits (609), Expect = 2.701e-76
Identity = 123/286 (43.01%), Postives = 181/286 (63.29%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD*IYSN 950
            M++KE+R+ LP++V+E++   L++V+  S+NETG GEG+E L+ E F +NT  P  ++         G YT KIY L +K P +++ + P EA  + E++WNAYPYC+TVLTNPGYMKD F   IE++H+ D G +EN      D   KRE+V IDIA+++++   +Y++++D +LF++    RGPL +   W  +  PVMC YKLV C FKW GLQ  +EK + KQ  R+F   HR A+  +D WF ++ME IR  E  T   L +QL +   RGT   D + +N
Sbjct:    1 MIVKEYRIPLPLTVDEFERGLLYAVSACSRNETGGGEGVEFLVQEDFTSNTLRPGQTV--------SGTYTKKIYRLRSKAPWVLQKLLPPEAFVIYEESWNAYPYCKTVLTNPGYMKDNFHQIIETIHLDDNGSSENPL----DGPEKREIVFIDIADNDIFGTKNYEKEKDARLFEAETVERGPLDED--WIDEHDPVMCCYKLVSCHFKWTGLQRMVEKTVHKQYPRVFGLMHRDAYVLLDNWFNMSMESIREYERATGDILRKQLAEPEKRGTKCDDDVNNN 272          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Celegans
Match: pitp-1 (PhosphatidylInositol Transfer Protein family [Source:UniProtKB/TrEMBL;Acc:G5EED9])

HSP 1 Score: 179.489 bits (454), Expect = 6.302e-49
Identity = 98/272 (36.03%), Postives = 158/272 (58.09%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASK-NETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS---PVMCAYKLVVCDFKWFGLQGQIEKMIMKQE-RRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDE 893
            MLIKE+R++LPM+V+EY++AQL+ + + S+ +  G   G+E++ N+P+   T  P  S          GQYT+KIYH+ +++P  +R + P  AL+  E++WNAYP  +T  + P  M D+F +++E+++  D G  EN   L+    S R +  +D   D + ++ DY  ++DPKL++S    RGPL    W    +    P+MCAYKL   +F+++G+Q + E+ I     R      HR A+ W D+W GLTM DIR +E +    L +
Sbjct:    1 MLIKEYRILLPMTVQEYRIAQLYMIQKKSRLDSHGQDSGVEIISNKPY---TDGPGGS----------GQYTFKIYHIGSRIPAWIRTVLPTNALEAHEESWNAYPVTKTRYSTP--MMDRFSLEVETLYFDDHGQQENVFNLNEKDKSTRIIDYMDFVKDPISSH-DYCAEEDPKLYRSETTNRGPLNDD-WVAEHLKKGLPIMCAYKLCKVEFRYWGMQTRAERWIHDLALRNTMMRAHRQAWAWQDEWTGLTMNDIRKLEAEAALHLSK 255          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Fly
Match: vib (gene:FBgn0267975 transcript:FBtr0083745)

HSP 1 Score: 335.88 bits (860), Expect = 6.295e-114
Identity = 165/276 (59.78%), Postives = 206/276 (74.64%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRG 920
            M IKEFRV LP++VEEYQVAQL+SVAEASK  TG GEGIEVL NEPF+      D  LL G  ++  GQYTYKIYHL +KVP  +R +APK +L++ E+AWNAYPYCRT++TNP +MKD F I I+++H+ D G +EN H+L+PD L  RE+V IDIAND +   ADYK D+DP  ++S K GRGPL     WK  ++PVM  YKLV C+FKWFGLQ ++E  I K ERR+FTNFHR  FC  D+W+GLTMEDIRAIE++TK+ELD+  +   VRG
Sbjct:    1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFE------DFPLLGG--KYNSGQYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPKFMKDAFKIIIDTLHVGDAGDSENVHELTPDKLKVREIVHIDIANDPVLP-ADYKPDEDPTTYQSKKTGRGPLVGSD-WKKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDKARQVGEVRG 266          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Fly
Match: vib (gene:FBgn0267975 transcript:FBtr0344554)

HSP 1 Score: 335.88 bits (860), Expect = 6.295e-114
Identity = 165/276 (59.78%), Postives = 206/276 (74.64%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRG 920
            M IKEFRV LP++VEEYQVAQL+SVAEASK  TG GEGIEVL NEPF+      D  LL G  ++  GQYTYKIYHL +KVP  +R +APK +L++ E+AWNAYPYCRT++TNP +MKD F I I+++H+ D G +EN H+L+PD L  RE+V IDIAND +   ADYK D+DP  ++S K GRGPL     WK  ++PVM  YKLV C+FKWFGLQ ++E  I K ERR+FTNFHR  FC  D+W+GLTMEDIRAIE++TK+ELD+  +   VRG
Sbjct:    1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFE------DFPLLGG--KYNSGQYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPKFMKDAFKIIIDTLHVGDAGDSENVHELTPDKLKVREIVHIDIANDPVLP-ADYKPDEDPTTYQSKKTGRGPLVGSD-WKKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDKARQVGEVRG 266          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Fly
Match: vib (gene:FBgn0267975 transcript:FBtr0310064)

HSP 1 Score: 328.946 bits (842), Expect = 2.883e-111
Identity = 165/277 (59.57%), Postives = 203/277 (73.29%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQ-DPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRG 920
            M IKEFRV LP++VEEYQVAQL+SVAEASK  TG GEGIEVL NEPF+      D  LL G  ++  GQYTYKIYHL +KVP  +R +APK +L++ E+AWNAYPYCRT++TNPGYM   F I I S H++ D G  +N H+L+PD L  RE+V IDIAND +   ADYK D+DP  ++S K GRGPL    W K  ++PVM  YKLV C+FKWFGLQ ++E  I K ERR+FTNFHR  FC  D+W+GLTMEDIRAIE++TK+ELD+  +   VRG
Sbjct:    1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFE------DFPLLGG--KYNSGQYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTVDNVHELTPDKLKVREIVHIDIANDPVLP-ADYKPDEDPTTYQSKKTGRGPLVGSDW-KKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDKARQVGEVRG 267          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0331716)

HSP 1 Score: 204.527 bits (519), Expect = 3.098e-57
Identity = 121/294 (41.16%), Postives = 174/294 (59.18%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNET-GAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTK---KPWW---KGDISP------VMCAYKLVVCDFKWFGLQGQIEKMIMKQE-RRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKEL------DEQLRDDIV 914
            MLIKE+R+ LP++VEEY++AQL+ +A+ S+ E+ G G G+E++INEP+              D     GQYT KIYH+ N +P  ++ + PK AL +EE+AWNAYPY RT  T P    +KF + IE+ +  D G  +N  QLS   L  R V  IDI  D+L+   DY +++DPK F S K GRGPL +   + +W   KG   P      +M AYK+   +F+++G+Q ++EK I     R++    HR A+ W D+WFGLT+EDIR +E +T+  L       E+  DD V
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYK-------------DGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCP--FVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWG-GDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGEECSDDSV 278          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0301535)

HSP 1 Score: 204.527 bits (519), Expect = 3.136e-57
Identity = 121/294 (41.16%), Postives = 174/294 (59.18%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNET-GAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTK---KPWW---KGDISP------VMCAYKLVVCDFKWFGLQGQIEKMIMKQE-RRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKEL------DEQLRDDIV 914
            MLIKE+R+ LP++VEEY++AQL+ +A+ S+ E+ G G G+E++INEP+              D     GQYT KIYH+ N +P  ++ + PK AL +EE+AWNAYPY RT  T P    +KF + IE+ +  D G  +N  QLS   L  R V  IDI  D+L+   DY +++DPK F S K GRGPL +   + +W   KG   P      +M AYK+   +F+++G+Q ++EK I     R++    HR A+ W D+WFGLT+EDIR +E +T+  L       E+  DD V
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYK-------------DGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCP--FVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWG-GDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGEECSDDSV 278          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Zebrafish
Match: pitpnab (phosphatidylinositol transfer protein, alpha b [Source:ZFIN;Acc:ZDB-GENE-110408-51])

HSP 1 Score: 311.997 bits (798), Expect = 2.127e-104
Identity = 161/286 (56.29%), Postives = 197/286 (68.88%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKEFRVILP+SVEEYQV QL+SVAEASKNETG GEG+EVL NEP++ +                KGQYT+KIYHL +KVP  VR +AP  AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  +N H L PD   K +VV IDIA+       DYK ++DP  +KS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  L M+DIR +EE+T+KELDE    D V+G   ++
Sbjct:    1 MLIKEFRVILPISVEEYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKDGE--------------KGQYTHKIYHLQSKVPSFVRMLAPASALNIHEKAWNAYPYCRTVITNE-YMKENFLIKIETWHKPDMGQQDNVHGLDPDTWKKVDVVYIDIADRSQVEPKDYKPEEDPSKYKSVKTGRGPLG--PDWKRELPKKTDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMDDIRRMEEETRKELDEMRVKDPVKGMVALE 269          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 307.76 bits (787), Expect = 8.558e-103
Identity = 159/286 (55.59%), Postives = 197/286 (68.88%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKEFR++LP+SVEEYQV QL+SVAEASKNETG G+G+EVL NEP++           +G+    KGQYT+KIY L +KVP  VR +AP  AL + EKAWNAYPYCRTVLTN  YMKD F+I IE+ H  D G  EN H L  +   + EV+ IDIA+       DYK D+DP  FKS K GRGPL   P WK ++      P MCAYKLV  +FKWFGLQ ++E  I +QE+R+FT+FHR  FCW+D+W  LTMEDIR +EE+T+KELD+    D V+G +  D
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNETGGGDGVEVLKNEPYEKE---------DGE----KGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTNE-YMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPLG--PDWKKELPQKKDCPHMCAYKLVTVNFKWFGLQKKVEGFIHRQEKRLFTSFHRQLFCWLDRWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 307.76 bits (787), Expect = 8.558e-103
Identity = 159/286 (55.59%), Postives = 197/286 (68.88%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKEFR++LP+SVEEYQV QL+SVAEASKNETG G+G+EVL NEP++           +G+    KGQYT+KIY L +KVP  VR +AP  AL + EKAWNAYPYCRTVLTN  YMKD F+I IE+ H  D G  EN H L  +   + EV+ IDIA+       DYK D+DP  FKS K GRGPL   P WK ++      P MCAYKLV  +FKWFGLQ ++E  I +QE+R+FT+FHR  FCW+D+W  LTMEDIR +EE+T+KELD+    D V+G +  D
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNETGGGDGVEVLKNEPYEKE---------DGE----KGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTNE-YMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPLG--PDWKKELPQKKDCPHMCAYKLVTVNFKWFGLQKKVEGFIHRQEKRLFTSFHRQLFCWLDRWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 307.76 bits (787), Expect = 8.558e-103
Identity = 159/286 (55.59%), Postives = 197/286 (68.88%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKEFR++LP+SVEEYQV QL+SVAEASKNETG G+G+EVL NEP++           +G+    KGQYT+KIY L +KVP  VR +AP  AL + EKAWNAYPYCRTVLTN  YMKD F+I IE+ H  D G  EN H L  +   + EV+ IDIA+       DYK D+DP  FKS K GRGPL   P WK ++      P MCAYKLV  +FKWFGLQ ++E  I +QE+R+FT+FHR  FCW+D+W  LTMEDIR +EE+T+KELD+    D V+G +  D
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNETGGGDGVEVLKNEPYEKE---------DGE----KGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTNE-YMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPLG--PDWKKELPQKKDCPHMCAYKLVTVNFKWFGLQKKVEGFIHRQEKRLFTSFHRQLFCWLDRWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Zebrafish
Match: pitpnab (phosphatidylinositol transfer protein, alpha b [Source:ZFIN;Acc:ZDB-GENE-110408-51])

HSP 1 Score: 305.449 bits (781), Expect = 6.162e-102
Identity = 158/285 (55.44%), Postives = 194/285 (68.07%), Query Frame = 3
Query:   96 LIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
             IKE RVILP+SVEEYQV QL+SVAEASKNETG GEG+EVL NEP++ +                KGQYT+KIYHL +KVP  VR +AP  AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  +N H L PD   K +VV IDIA+       DYK ++DP  +KS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  L M+DIR +EE+T+KELDE    D V+G   ++
Sbjct:    1 FIKEHRVILPISVEEYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKDGE--------------KGQYTHKIYHLQSKVPSFVRMLAPASALNIHEKAWNAYPYCRTVITNE-YMKENFLIKIETWHKPDMGQQDNVHGLDPDTWKKVDVVYIDIADRSQVEPKDYKPEEDPSKYKSVKTGRGPLG--PDWKRELPKKTDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMDDIRRMEEETRKELDEMRVKDPVKGMVALE 268          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Xenopus
Match: pitpna (phosphatidylinositol transfer protein alpha [Source:NCBI gene;Acc:100038215])

HSP 1 Score: 312.768 bits (800), Expect = 1.232e-104
Identity = 162/285 (56.84%), Postives = 198/285 (69.47%), Query Frame = 3
Query:   99 IKEF-RVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            IK+F RVILP+SVEEYQV QL+SVAEASKNETG GEG+EVL+NEP++ +                KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRT++TN  YMKD F+IKIE+ H  D G+ EN H+L PD+    EVV IDIA+       DYK ++DP  FKS+K GRGPL   P WK  +      P MCAYKLV   FKW+GLQ +IE  I KQE+R+FTNFHR  FCW+D+W  LTMEDIR +E++TKK+LDE    D V+G    D
Sbjct:    3 IKQFHRVILPVSVEEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPMFVRMLAPEGALNIHEKAWNAYPYCRTIITNE-YMKDDFLIKIETWHKPDLGMQENVHKLEPDVWKNVEVVQIDIADRSQVLTKDYKPEEDPAKFKSVKTGRGPLC--PDWKKTLGQQKDCPHMCAYKLVTVKFKWWGLQNKIESFIQKQEKRLFTNFHRQLFCWLDRWVELTMEDIRRMEDETKKQLDEMRERDPVKGMMAAD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Xenopus
Match: rho (rhodopsin [Source:Xenbase;Acc:XB-GENE-966887])

HSP 1 Score: 303.908 bits (777), Expect = 3.655e-101
Identity = 157/283 (55.48%), Postives = 193/283 (68.20%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTT 926
            +LIKEFR++LP SVEEYQV QL+SVAEASKNETG GEGIEVL NEP++                  KGQYT+KIYHL +KVP  V+  AP+ +L   EKAWNA+PYCRT++TN  YMKD F IKIE+ H  D G  EN H L P++    +VV IDIA+      ADYKE +DP +F+SLK  RGPL   P WK +++     P MCAYKLV   FKW+GLQ ++E  I KQE+RIFTNFHR  FCW+D W  LTMEDIR +E+KT++EL+       VRGT+
Sbjct:    2 VLIKEFRIVLPCSVEEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKEGE--------------KGQYTHKIYHLKSKVPGFVKMFAPEGSLIFHEKAWNAFPYCRTIVTNE-YMKDDFFIKIETWHKPDMGTQENVHCLDPNIWKSVDVVDIDIADRSQVEPADYKEKEDPAIFQSLKTKRGPLG--PNWKKELANSEDCPHMCAYKLVTIKFKWWGLQNKVESFIQKQEKRIFTNFHRQLFCWIDDWVDLTMEDIRRMEDKTQRELEALRNQGQVRGTS 267          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Xenopus
Match: pitpnb (phosphatidylinositol transfer protein, beta [Source:NCBI gene;Acc:394727])

HSP 1 Score: 298.516 bits (763), Expect = 4.475e-99
Identity = 153/286 (53.50%), Postives = 200/286 (69.93%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +LIKE+RV+LP+SVEEYQV QL+SVAEASK+ TG GEGIEVL NEP++          L+G+    KGQYT+KIYHL +KVP  V+ +AP+ +L   EKAWNAYPYCRT++TN  YMKD F +KIE+ H  D G  EN H L  +   + EVV IDIA++      DYK ++DP  ++S K GRGPL +   WK +++     P MCAYKLV   F+W+GLQG++E+ I KQE+R+FTNFHR  FC +D+W  LTMEDIR +E++T+KELDE  +   VRG +  D
Sbjct:    2 VLIKEYRVLLPVSVEEYQVGQLFSVAEASKDNTGGGEGIEVLKNEPYE----------LDGE----KGQYTHKIYHLQSKVPGFVKMVAPEGSLVFHEKAWNAYPYCRTIVTNE-YMKDNFFVKIETWHKPDFGDQENVHGLDSNTWKEVEVVPIDIADNSQINEGDYKANEDPACYRSEKTGRGPLKQD--WKKELANNPSCPHMCAYKLVTVKFQWWGLQGKVERFIHKQEKRLFTNFHRQLFCSLDRWVELTMEDIRRMEDETQKELDEMRQKGAVRGMSAKD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Xenopus
Match: pitpna (phosphatidylinositol transfer protein alpha [Source:NCBI gene;Acc:100038215])

HSP 1 Score: 288.5 bits (737), Expect = 6.834e-95
Identity = 153/297 (51.52%), Postives = 192/297 (64.65%), Query Frame = 3
Query:   87 FRMLIKEFRVILPM--SVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRT-------VLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            F + + + R+IL +     +YQV QL+SVAEASKNETG GEG+EVL+NEP++ +                KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRT       +L    YMKD F+IKIE+ H  D G+ EN H+L PD+    EVV IDIA+       DYK ++DP  FKS+K GRGPL   P WK  +      P MCAYKLV   FKW+GLQ +IE  I KQE+R+FTNFHR  FCW+D+W  LTMEDIR +E++TKK+LDE    D V+G    D
Sbjct:    8 FHVYVTKSRLILGIWNRFCQYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPMFVRMLAPEGALNIHEKAWNAYPYCRTKLISGPYILLQNEYMKDDFLIKIETWHKPDLGMQENVHKLEPDVWKNVEVVQIDIADRSQVLTKDYKPEEDPAKFKSVKTGRGPLC--PDWKKTLGQQKDCPHMCAYKLVTVKFKWWGLQNKIESFIQKQEKRLFTNFHRQLFCWLDRWVELTMEDIRRMEDETKKQLDEMRERDPVKGMMAAD 288          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Xenopus
Match: pitpna (phosphatidylinositol transfer protein alpha [Source:NCBI gene;Acc:100038215])

HSP 1 Score: 285.804 bits (730), Expect = 3.993e-94
Identity = 149/277 (53.79%), Postives = 182/277 (65.70%), Query Frame = 3
Query:  141 YQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRT-------VLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            YQV QL+SVAEASKNETG GEG+EVL+NEP++ +                KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRT       +L    YMKD F+IKIE+ H  D G+ EN H+L PD+    EVV IDIA+       DYK ++DP  FKS+K GRGPL   P WK  +      P MCAYKLV   FKW+GLQ +IE  I KQE+R+FTNFHR  FCW+D+W  LTMEDIR +E++TKK+LDE    D V+G    D
Sbjct:    9 YQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPMFVRMLAPEGALNIHEKAWNAYPYCRTKLISGPYILLQNEYMKDDFLIKIETWHKPDLGMQENVHKLEPDVWKNVEVVQIDIADRSQVLTKDYKPEEDPAKFKSVKTGRGPLC--PDWKKTLGQQKDCPHMCAYKLVTVKFKWWGLQNKIESFIQKQEKRLFTNFHRQLFCWLDRWVELTMEDIRRMEDETKKQLDEMRERDPVKGMMAAD 269          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Mouse
Match: Pitpna (phosphatidylinositol transfer protein, alpha [Source:MGI Symbol;Acc:MGI:99887])

HSP 1 Score: 315.079 bits (806), Expect = 1.135e-105
Identity = 158/286 (55.24%), Postives = 202/286 (70.63%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +         +G+    KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+T   YMK+ F+IKIE+ H  D G  EN H+L P+     E + IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKD---------DGE----KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITKNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 272          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Mouse
Match: Pitpna (phosphatidylinositol transfer protein, alpha [Source:MGI Symbol;Acc:MGI:99887])

HSP 1 Score: 313.923 bits (803), Expect = 3.509e-105
Identity = 159/286 (55.59%), Postives = 203/286 (70.98%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +         +G+    KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  EN H+L P+     E + IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKD---------DGE----KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 271          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Mouse
Match: Pitpna (phosphatidylinositol transfer protein, alpha [Source:MGI Symbol;Acc:MGI:99887])

HSP 1 Score: 311.227 bits (796), Expect = 4.709e-104
Identity = 158/286 (55.24%), Postives = 201/286 (70.28%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +         +G+    KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV  N  YMK+ F+IKIE+ H  D G  EN H+L P+     E + IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKD---------DGE----KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVSANE-YMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 271          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Mouse
Match: Pitpnb (phosphatidylinositol transfer protein, beta [Source:MGI Symbol;Acc:MGI:1927542])

HSP 1 Score: 309.686 bits (792), Expect = 1.715e-103
Identity = 161/286 (56.29%), Postives = 195/286 (68.18%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +LIKEFRV+LP SV+EYQV QL+SVAEASKNETG GEGIEVL NEP++ +                KGQYT+KIYHL +KVP  VR IAP+ +L   EKAWNAYPYCRT++TN  YMKD F IKIE+ H  D G  EN H L P+     E+V IDIA+      ADYK D+DP LF S+K  RGPL   P WK +++     P MCAYKLV   FKW+GLQ ++E  I KQE+RIFTN HR  FCW+DKW  LTMEDIR +E++T+KEL+   +   VRGT+  D
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNE-YMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLG--PNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAAD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Mouse
Match: Pitpnb (phosphatidylinositol transfer protein, beta [Source:MGI Symbol;Acc:MGI:1927542])

HSP 1 Score: 305.834 bits (782), Expect = 6.119e-102
Identity = 160/283 (56.54%), Postives = 193/283 (68.20%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTT 926
            +LIKEFRV+LP SV+EYQV QL+SVAEASKNETG GEGIEVL NEP++ +                KGQYT+KIYHL +KVP  VR IAP+ +L   EKAWNAYPYCRT++TN  YMKD F IKIE+ H  D G  EN H L P+     E+V IDIA+      ADYK D+DP LF S+K  RGPL   P WK +++     P MCAYKLV   FKW+GLQ ++E  I KQE+RIFTN HR  FCW+DKW  LTMEDIR +E++T+KEL+       VRGT+
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNE-YMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLG--PNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETLRSQGQVRGTS 267          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. UniProt/SwissProt
Match: sp|P48738|PIPNA_RABIT (Phosphatidylinositol transfer protein alpha isoform OS=Oryctolagus cuniculus OX=9986 GN=PITPNA PE=3 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 3.109e-105
Identity = 159/286 (55.59%), Postives = 201/286 (70.28%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +                +GQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  EN H+L P+     EV+ IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQERR+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------RGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWHKPDLGTQENVHKLEPETWKHVEVIYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. UniProt/SwissProt
Match: sp|Q00169|PIPNA_HUMAN (Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2)

HSP 1 Score: 315.849 bits (808), Expect = 4.169e-105
Identity = 160/286 (55.94%), Postives = 200/286 (69.93%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +                KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  EN H+L P+     E V IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQERR+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. UniProt/SwissProt
Match: sp|P16446|PIPNA_RAT (Phosphatidylinositol transfer protein alpha isoform OS=Rattus norvegicus OX=10116 GN=Pitpna PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 2.108e-104
Identity = 159/286 (55.59%), Postives = 203/286 (70.98%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +         +G+    KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  EN H+L P+     E + IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKD---------DGE----KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 271          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. UniProt/SwissProt
Match: sp|Q2HJ54|PIPNA_BOVIN (Phosphatidylinositol transfer protein alpha isoform OS=Bos taurus OX=9913 GN=PITPNA PE=1 SV=3)

HSP 1 Score: 313.923 bits (803), Expect = 2.296e-104
Identity = 159/286 (55.59%), Postives = 201/286 (70.28%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SVEEYQV QL+SVAEASKNETG GEG+EVL+NEP++ +                KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  EN H+L P+     EV+ IDIA+       DYK ++DP  +KS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQERR+FTNFHR  FCW+DKW  LTM+DIR +E++TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVEEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWHKPDLGTLENVHKLEPEAWKHVEVIYIDIADRSQVLSKDYKAEEDPAKYKSIKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEDETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. UniProt/SwissProt
Match: sp|P53810|PIPNA_MOUSE (Phosphatidylinositol transfer protein alpha isoform OS=Mus musculus OX=10090 GN=Pitpna PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 2.454e-104
Identity = 159/286 (55.59%), Postives = 203/286 (70.98%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +L+KE+RVILP+SV+EYQV QL+SVAEASKNETG GEG+EVL+NEP++ +         +G+    KGQYT+KIYHL +KVP  VR +AP+ AL + EKAWNAYPYCRTV+TN  YMK+ F+IKIE+ H  D G  EN H+L P+     E + IDIA+       DYK ++DP  FKS+K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  LTM+DIR +EE+TK++LDE  + D V+G T  D
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKD---------DGE----KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPLG--PNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 271          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. TrEMBL
Match: A0A267DXL9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021487g2 PE=4 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 3.636e-129
Identity = 189/283 (66.78%), Postives = 217/283 (76.68%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFD--ANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKE+RVILPM+VEEYQ+AQL+SVAEASK ETG GEGI V+ NEPFD  AN   P   LL    R T GQYTYKIY L NKVP+ +R +AP  +L++ E AWNAYPYCRTV+ NPGYMKD F IKIESMH+QD G  EN HQL P+LL KREVV IDIAND+LY+ +DYK + DPKLFKS K GRGPLT +PWW+    PVMCAYKLV C+FKWFGLQG+IE  I   ERRIFTNFHR  FC MD+W+GLTME IR  EE+TKKELD+Q+     RG  + D
Sbjct:    1 MLIKEYRVILPMTVEEYQIAQLYSVAEASKQETGGGEGIVVVHNEPFDVAANKWPPKTPLLGN--RGT-GQYTYKIYKLQNKVPKFIRMLAPSGSLEMTETAWNAYPYCRTVVENPGYMKDNFFIKIESMHVQDAGTQENVHQLPPNLLQKREVVYIDIANDKLYSNSDYKREFDPKLFKSSKTGRGPLTNRPWWENFDGPVMCAYKLVTCEFKWFGLQGRIESFIHTMERRIFTNFHRQVFCSMDQWYGLTMEQIRKWEEETKKELDDQIEKGPARGVREDD 280          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. TrEMBL
Match: A0A1I8GKU1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021487g1 PE=4 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.181e-128
Identity = 188/283 (66.43%), Postives = 216/283 (76.33%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFD--ANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKE+RVILPM+VEEYQ+AQL+SVAEASK ETG GEGI V+ NEPFD  AN   P   LL    R T GQYTYKIY L NKVP+ +R +AP  +L++ E AWNAYPYCRTV+ NPGYMKD F IKIESMH+QD G  EN HQL P+LL KREVV IDI ND+LY+ +DYK + DPKLFKS K GRGPLT +PWW+    PVMCAYKLV C+FKWFGLQG+IE  I   ERRIFTNFHR  FC MD+W+GLTME IR  EE+TKKELD+Q+     RG  + D
Sbjct:    1 MLIKEYRVILPMTVEEYQIAQLYSVAEASKQETGGGEGIVVVHNEPFDVAANKWPPKTPLLGN--RGT-GQYTYKIYKLQNKVPKFIRMLAPSGSLEMTETAWNAYPYCRTVVENPGYMKDNFFIKIESMHVQDAGTQENVHQLPPNLLQKREVVYIDIGNDKLYSNSDYKREFDPKLFKSSKTGRGPLTNRPWWENFDGPVMCAYKLVTCEFKWFGLQGRIESFIHTMERRIFTNFHRQVFCSMDQWYGLTMEQIRKWEEETKKELDDQIEKGPARGVREDD 280          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. TrEMBL
Match: A0A267EBF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008177g1 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 4.316e-127
Identity = 183/283 (64.66%), Postives = 211/283 (74.56%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFD--ANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKE+RVILPM+VEEY  AQL+SVAEASK ETG GEGI V+ NEPFD  AN   P   LL        GQYTYKIY L NKVP+ +R +AP  +L++ E AWNAYPYCRTV+ NPGYMK+ F IKIESMH+QD G  +N HQL PDLLSKREVV IDIAND+LY+ +DYK + DPKLFKS K  RGPL   PWW+    PVMCAYKLV C+FKWFGLQ ++E  I   ERRIFTNFHR  FC  D+WFGLTMEDIR +EE+TK++LD Q+    VRGT   D
Sbjct:    1 MLIKEYRVILPMTVEEYHCAQLFSVAEASKQETGGGEGIMVVHNEPFDVKANKWPPKTPLLGNR---ANGQYTYKIYKLQNKVPKFIRLLAPSGSLEMTETAWNAYPYCRTVVENPGYMKENFFIKIESMHVQDAGTQQNVHQLPPDLLSKREVVYIDIANDKLYSNSDYKREFDPKLFKSEKTDRGPLVNNPWWQNYNGPVMCAYKLVTCEFKWFGLQTRVESFIHTMERRIFTNFHRQVFCLTDQWFGLTMEDIRQLEERTKRDLDSQIASGQVRGTKAED 280          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. TrEMBL
Match: A0A0X3NHZ5 (Phosphatidylinositol transfer protein alpha isoform OS=Schistocephalus solidus OX=70667 GN=PIPNA PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 1.982e-125
Identity = 170/277 (61.37%), Postives = 209/277 (75.45%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGT 923
            MLIKE+RVILPM+VE+YQVAQLW+V E+SKNETG GEG+E+L+NEPFD   H P+  L+     F  GQ+T+KIYHL NKVP  +R I+P  A+++EE AWNAYPYCRTVL NP YMK  F IK+E+MH+QD    EN HQLSP+LL +REVV IDIAND LY  +DYK + DPK+F+S   G GPL    WW+    P+MCAYKLV C+FKWFGLQ   E+ I   ERRIF NFHR  FC +D W GL+MEDIR +EE+TK+ELD+QL++  +RGT
Sbjct:    1 MLIKEYRVILPMTVEQYQVAQLWTVIESSKNETGGGEGVEILVNEPFDGTKHPPEAHLVAAGQTFAAGQFTHKIYHLANKVPAFIRAISPSGAMEIEEVAWNAYPYCRTVLKNPAYMKSDFHIKVETMHVQDKVDLENVHQLSPELLEQREVVVIDIANDALYAQSDYKSEWDPKIFQSKATGLGPLLGPKWWENTDMPIMCAYKLVTCEFKWFGLQTITERFIQNVERRIFLNFHRQLFCSIDSWHGLSMEDIRVLEERTKEELDKQLKEGTLRGT 277          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. TrEMBL
Match: D3PIG7 (Phosphatidylinositol transfer protein beta isoform OS=Lepeophtheirus salmonis OX=72036 GN=PIPNB PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 3.708e-123
Identity = 180/277 (64.98%), Postives = 217/277 (78.34%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGT 923
            MLIKEFRV LPM+V+EYQVAQL+SVAEASKNETG GEG+EV+ NEP+D   +VP   LL G  +FTKGQYTYKIYH+ +KVP I+RYI PK AL++ E+AWNAYPYC+TVLTNPGYM+DKF IK+E+ H+ D G +EN H+L  D L  REVV IDIAND++ +  DYKED+DP  +KS K GRGPL+  P W   + PVM AYKLV   FKWFG+QG++E  I + ERR+F NFHR  FCW DKW GLTMEDIRAIE+KTK+EL+EQ +   VRGT
Sbjct:    1 MLIKEFRVTLPMTVDEYQVAQLYSVAEASKNETGGGEGVEVIKNEPYD---NVP---LLGG--KFTKGQYTYKIYHMASKVPSIIRYIVPKGALEIHEEAWNAYPYCKTVLTNPGYMEDKFYIKVETYHIADRGDSENVHELEADKLKMREVVKIDIANDDV-SRGDYKEDEDPVKYKSQKTGRGPLS-DPQWIKSVEPVMTAYKLVTVQFKWFGIQGKVENFIQQTERRLFLNFHRQVFCWTDKWHGLTMEDIRAIEDKTKEELEEQRKHGEVRGT 267          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Cavefish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 283.108 bits (723), Expect = 2.871e-93
Identity = 149/286 (52.10%), Postives = 185/286 (64.69%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            +     RV+LP+SVEEYQV QL+SVAEASKNETG GEG+EVL NEP++           +G+    KGQYT+KIYHL +KVP  VR +AP  AL + EKAWN             YMKD F++ IE+ H  D G  EN H+L P+   K EVV IDIA+       DYK+D+DP  FKS+K GRGPL   P W+ ++      P MCAYKLV   FKWFGLQ ++E  I KQE+R+FTNFHR  FCW+DKW  LTMEDIR +EE+T+KELD+    D V+G +  D
Sbjct:    9 LFFSSSRVVLPISVEEYQVGQLFSVAEASKNETGGGEGVEVLKNEPYEKE---------DGE----KGQYTHKIYHLQSKVPTFVRMLAPSSALNIHEKAWNN-----------EYMKDNFMVMIETWHKPDFGDQENVHKLDPETWKKVEVVYIDIADKSQIDAKDYKQDEDPATFKSVKTGRGPLG--PEWRKELPQKTDCPHMCAYKLVTVKFKWFGLQNKVEGFIHKQEKRLFTNFHRQLFCWLDKWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 268          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Cavefish
Match: pitpnb (phosphatidylinositol transfer protein, beta [Source:ZFIN;Acc:ZDB-GENE-040426-895])

HSP 1 Score: 279.256 bits (713), Expect = 4.837e-92
Identity = 147/266 (55.26%), Postives = 173/266 (65.04%), Query Frame = 3
Query:  153 QLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            QL+SVAEASKNETG GEGIEVL NEP++                  KGQYT+KIYHL +KVP  V+ IAP+ AL   EKAWNAYPYC T   N  YMKD F+IKIE+ H  D G  EN H L P+     EVV IDIA+       DYK+++DP +F S K GRGPL   P WK ++     +P MCAYKLV   FKW+GLQ +IE  I KQE+RIFTNFHR  FCWMD W GLTMEDIR +E +T+KEL+E      VRGTT  +
Sbjct:    1 QLFSVAEASKNETGGGEGIEVLTNEPYEKEGE--------------KGQYTHKIYHLKSKVPGFVKMIAPEGALVFHEKAWNAYPYCCTSKFNNEYMKDDFMIKIETWHKPDMGSLENVHDLDPETWKTVEVVPIDIADRSQVEPGDYKQEEDPAVFHSEKTGRGPLG--PEWKSELAANENAPRMCAYKLVTVKFKWWGLQSKIEHFIHKQEKRIFTNFHRQLFCWMDSWVGLTMEDIRRMEAETQKELEEMRSSGTVRGTTAAE 250          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Cavefish
Match: ENSAMXT00000052719.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6116017:6136613:-1 gene:ENSAMXG00000030401.1 transcript:ENSAMXT00000052719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 277.33 bits (708), Expect = 5.932e-91
Identity = 145/266 (54.51%), Postives = 176/266 (66.17%), Query Frame = 3
Query:  111 RVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDE 893
            RV+LP SVEEYQV QL+SVAEASKNETG GEGIEVL NEP++ +                KGQYT+KIYHL +KVP  V+  AP+ +L   EKAWNAYPYCRT         + F I IE+ H  D G  EN H+L        EV+ IDIA+ +   Y+DYK D+DP LFKS K GRGPL   P W+ ++     SP MCAYKLV   FKW+GLQ ++E  I KQE+RIFTNFHR  FCW+D+W  LTMEDIR +E +T+KEL+E
Sbjct:    8 RVVLPCSVEEYQVGQLFSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPGFVKMFAPEGSLVFHEKAWNAYPYCRT---------NDFFIMIETWHKPDLGTIENVHKLDSSTWKSVEVMPIDIADRDQVAYSDYKADEDPALFKSTKTGRGPLG--PNWRKELVSNPESPRMCAYKLVTVKFKWWGLQNKVESFIHKQEKRIFTNFHRQLFCWIDRWVDLTMEDIRRMEAETQKELEE 248          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Cavefish
Match: pitpnbl (phosphatidylinositol transfer protein, beta, like [Source:ZFIN;Acc:ZDB-GENE-040426-2791])

HSP 1 Score: 273.092 bits (697), Expect = 2.037e-89
Identity = 143/279 (51.25%), Postives = 178/279 (63.80%), Query Frame = 3
Query:   96 LIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRG 920
            L    +V+LP SVEEYQV QL+SVAEASKN TG GEGIEVL NEP++                  KGQYT+KIYH+ +KVP  ++  AP+ AL   EKAWNAYPYCRT         + F IKIE+ H  D G  +N H L P+   + EVV IDIA+       DYK D+DP LF S K GRGPL   P WK ++     P M AYKLV   F+W+GLQG++E  I KQE+R+FTNFHR  FCW+D+W  LTM+DIR +EE+T++ELD+   +  VRG
Sbjct:    3 LFSYSQVVLPCSVEEYQVGQLYSVAEASKNNTGGGEGIEVLRNEPYEKEG--------------EKGQYTHKIYHIHSKVPSFIQMFAPEGALVFHEKAWNAYPYCRT---------NDFFIKIETWHKPDLGTTDNPHGLPPEEWEETEVVPIDIADRSQVDDVDYKPDEDPALFHSEKTGRGPLG--PGWKKELHNSNCPYMTAYKLVTVHFRWWGLQGRVESFIHKQEKRLFTNFHRQLFCWLDRWVDLTMDDIRRMEEETQRELDQMRNEGSVRG 256          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Cavefish
Match: pitpnab (phosphatidylinositol transfer protein, alpha b [Source:ZFIN;Acc:ZDB-GENE-110408-51])

HSP 1 Score: 261.536 bits (667), Expect = 3.876e-85
Identity = 141/268 (52.61%), Postives = 170/268 (63.43%), Query Frame = 3
Query:  108 FRVILPMSVEE-YQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDE 893
            FRV+L       YQV QL+SVAEASKNETG GEG+EVL NEP++ +                KGQYT+KIYHL +KVP  VR +AP  AL + EKAWNAYPYCRT         + F+IKIE+ H  D G  EN H L PD   K +VV IDI +       DYK ++DP  FKS K GRGPL     WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  L M+DIR +EE+T+KELDE
Sbjct:    7 FRVLLECGCCFIYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKDGE--------------KGQYTHKIYHLQSKVPSFVRMLAPSSALNIHEKAWNAYPYCRT---------ENFLIKIETWHKPDMGHQENVHGLDPDTWKKVDVVYIDIGDRTQVEPKDYKPEEDPARFKSAKTGRGPLGHD--WKKELPKKTDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMDDIRRMEEETRKELDE 249          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004160.1 (pep scaffold:Pmarinus_7.0:GL481899:12693:18585:1 gene:ENSPMAG00000003779.1 transcript:ENSPMAT00000004160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.1 bits (710), Expect = 6.300e-92
Identity = 154/287 (53.66%), Postives = 186/287 (64.81%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYP----YCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS-----PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTT 926
            +L+KEFRV+LP SVEEYQV QL+SVAEASKNETG GEGIEVL NEP++            G+    KGQYT+KIYH+ +KVP  VR  AP+ +L   EKA   +P        V+TN  YMKD F +KIE+ H  D G  EN H L      + EV+ IDI +      +DYK ++DP LFKS K  RGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQERRIFTNFHR  FCW+D+W GLTMEDIR +EE+TK+ELDE      VRGTT
Sbjct:    2 VLVKEFRVLLPCSVEEYQVGQLFSVAEASKNETGGGEGIEVLRNEPYEKE---------GGE----KGQYTHKIYHVHSKVPNFVRLFAPEGSLVFHEKA--LFPTLINITSQVVTNE-YMKDDFFVKIETWHKPDMGTQENVHGLDELTWKQVEVMHIDIGDRNQVLSSDYKTEEDPALFKSTKTSRGPLG--PNWKAELENREDCPHMCAYKLVTVKFKWWGLQTKMESFIQKQERRIFTNFHRQLFCWIDRWVGLTMEDIRRMEEETKRELDELREKGNVRGTT 270          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003232.1 (pep scaffold:Pmarinus_7.0:GL486150:7644:10272:1 gene:ENSPMAG00000002952.1 transcript:ENSPMAT00000003232.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 3.604e-49
Identity = 96/233 (41.20%), Postives = 139/233 (59.66%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNET-GAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVV--------TIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMI 764
            MLIKE+R+ LPMSVEEY++AQL+ + + S++ET G G G+E+L N P++             D     GQYT+K+YH+   +P   R I PK AL++EE++WNAYPY RT  T P    +KF I IE+ + QD G   N   L      KR+          TIDI  D +  + +Y  D+DP++++S + GRGPL    W   + SP+MCAYKL   +F+++G+Q +IE+ I
Sbjct:    1 MLIKEYRIPLPMSVEEYRIAQLYMIQKKSRDETSGEGSGVEILENRPYE-------------DGPGGTGQYTHKLYHIGMHIPGWFRAILPKAALRVEEQSWNAYPYTRTRYTCP--FVEKFSIDIETHYQQDGGDQLNVFNLG--AAEKRQCSVGAGPVADTIDIVRDPMAPH-EYVVDEDPRVYRSERTGRGPLGDD-WASLNPSPIMCAYKLCKVEFRYWGMQSKIERFI 214          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002979.1 (pep scaffold:Pmarinus_7.0:GL478233:8948:23532:1 gene:ENSPMAG00000002717.1 transcript:ENSPMAT00000002979.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 7.770e-32
Identity = 69/195 (35.38%), Postives = 112/195 (57.44%), Query Frame = 3
Query:  315 YHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQL 899
            + L +K+P   + + P+    + EKAWN YPY  T  T       KF I I++ +  + G N++      +   K EV ++DIA DE+     +KE +D + F S +  RGPL +   W+ D +PVMC+YKLV   F+ +GLQ ++E+ + K  R +    HR AF W+D+W+G+TME++R  E  T++  +++L
Sbjct:   20 FSLHSKLPSWAKVVVPR-IFYITEKAWNYYPYTITEYT--CSFLPKFSIYIKTKYEDNNGSNDHIFSDEQNNADK-EVCSLDIAYDEIPERY-FKESEDLRGFMSTRTARGPLLEG--WRDDTTPVMCSYKLVTVKFEVWGLQTRVEQFVHKAIRDVLLTGHRQAFAWVDEWYGMTMEEVREYERNTQEATNKKL 207          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Sea Lamprey
Match: PITPNC1 (phosphatidylinositol transfer protein cytoplasmic 1 [Source:HGNC Symbol;Acc:HGNC:21045])

HSP 1 Score: 84.7297 bits (208), Expect = 2.910e-19
Identity = 54/157 (34.39%), Postives = 85/157 (54.14%), Query Frame = 3
Query:  450 KFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNF------HRMAFCWMDKWFG-LTMEDIRAIEEKTKKELDEQL 899
            KF I IE+ +  + G N++      + + +RE   +DIA DEL     YKE +D + FKSLK GRGPL +   W+  + P+MC+YKLV   F+ +GLQ ++E+ + K    +  NF      H     W   W+  ++MED+R  E  T+   + ++
Sbjct:    6 KFSIYIETKYEDNNGCNDHVFDSETNNV-ERETCKVDIAYDELPERY-YKESEDVRQFKSLKTGRGPLAEG--WRDTLGPIMCSYKLVTVKFEVWGLQTRVEQFVHK----VLHNFLTISMGHCQCLEWAPLWWWYMSMEDVREYERTTQAATNRKI 154          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Nematostella
Match: EDO43279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ09])

HSP 1 Score: 269.24 bits (687), Expect = 4.245e-88
Identity = 145/288 (50.35%), Postives = 191/288 (66.32%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINE---NAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDIS---------PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRG 920
            ++IKE+R+ LP+SVEEYQ+AQL++VAEASKNETG GEGIEVL+NEP+ A       ++    P    GQYT+K+ HL +KVP  VR +AP  +L++ EKAWNAYP+CRT  +N  YMK+ F + I++ H   PG  +   N H L    L KRE+V IDI ND++  + +YK D+DP    S KA RGPL KK W + +           P+M  YKL   +FKW+GLQ ++E +IMK   R+  NFHR  FCWMD+WFG+TM+DIR IE+KTKKELDE      V+G
Sbjct:    2 VVIKEYRIPLPISVEEYQIAQLYAVAEASKNETGGGEGIEVLVNEPYTAGEGGHGKNM----PPGMDGQYTHKLIHLHSKVPSFVRMLAPSGSLEVHEKAWNAYPFCRTEYSNT-YMKEHFSVIIDTWH--KPGHKDEFHNVHNLGNPELQKREIVNIDIVNDKVDPH-EYKADEDPSKVGSEKAKRGPL-KKDWQQKNEEDPSKSKEGYPMMTCYKLYRVEFKWWGLQTKVESIIMKAVHRLLRNFHRQMFCWMDRWFGMTMDDIRRIEDKTKKELDEMRHKGEVKG 280          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Nematostella
Match: EDO43322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ10])

HSP 1 Score: 241.891 bits (616), Expect = 2.267e-77
Identity = 137/287 (47.74%), Postives = 184/287 (64.11%), Query Frame = 3
Query:   99 IKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPF-----DANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGI-NENAHQLSPDLLSKREVVTIDIANDE-LYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKG------DISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRG 920
            +KE+RV LP+SVE Y++AQL++V EAS NETG GEGIEV+ NEP+     +    V +P           GQYT KI HL +KVP+ +  +AP+ AL++ E+AWNAYPYC+TV TNP YM + F + I++ H + P   + N H+L+   L+KREV+ IDIA ++ L    DYKED+DP L +S KA  GPLT   W KG      D  P+M  YKL    FKW  LQ  +E  I K   R+  NFHR  FCWMD+W+GLT++DIR IE++TK +LD+   +  V+G
Sbjct:    4 LKEYRVELPISVENYRIAQLYTVTEASMNETGGGEGIEVVKNEPYVEGKGEFGNDVTEP-----------GQYTLKIMHLKSKVPQWIVKLAPEGALEVHEEAWNAYPYCKTVYTNP-YMGENFHVIIKTWHKEGPSSRHSNVHELNESELAKREVIDIDIAAEKKLVGPHDYKEDEDPLLVRSEKANCGPLTPD-WNKGASDTTKDGYPMMTCYKLYDVRFKWCLLQTVVESEIGKAVYRLLRNFHRQMFCWMDRWYGLTLDDIRRIEDETKDKLDKMRNEGEVKG 277          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Nematostella
Match: EDO41887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S326])

HSP 1 Score: 202.216 bits (513), Expect = 6.761e-57
Identity = 114/276 (41.30%), Postives = 169/276 (61.23%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNET-GAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTID-IANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKG-----DISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQL 899
            MLIKE+R+ LPMSV+EY++AQL+ + + S+ E+ G G G+E+L N P+           +N D     GQ+T KIYH+ + +P  ++ I PK AL++EE+AWNAYPY +   T P    +KF + +E+ ++ D G   N   L+P  L+ REV  ID IA  E+    DY  ++DP +++S K GRGP+ K  W +        +PVMCAYKL+  +F+++G+Q +IE  I    RR     HR A+ W D+W+GLTM DIR +EE+TK  L + +
Sbjct:    1 MLIKEYRIPLPMSVDEYRIAQLYMIQKKSRLESVGEGSGVEILENRPY-----------MNKDG--GSGQFTKKIYHIGSHLPGWLKAILPKSALRVEEEAWNAYPYTKMRTTCP--FVEKFFVDVETHYLPDAGQTANVFNLTPAELNSREVDFIDPIA--EVVASGDYLAEEDPLIYQSKKTGRGPM-KADWLEAYQTDNPPTPVMCAYKLIKVEFRYWGMQSKIEHFIHSGLRRPMLMGHRQAWVWQDEWYGLTMGDIRRLEEETKAILSQTM 258          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Nematostella
Match: EDO47917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ2])

HSP 1 Score: 169.859 bits (429), Expect = 5.064e-50
Identity = 95/269 (35.32%), Postives = 150/269 (55.76%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQL 899
            M++KE+R+ +P+SV+EY+V QL+ +   S +++  GEG+ V+ NE  +   H               GQ+T K  +L +++P  VR   PK    + EKAWN YP+    +T       +F IKIE+ ++ D G  EN   LSP+ L  REV+ +DIA DEL     Y  ++D + FKS   GRGPL  +P W+    P+MC+YKLV   F  +GL  ++E  + K  + I    HR AF W+D W+ + + D+R  E+  +++ + ++
Sbjct:    1 MMLKEYRICMPLSVDEYRVGQLYMINRHSHDQSETGEGVHVVKNEACEDKEH-------------GNGQFTEKRVYLSSRLPSWVRSYIPK-IFYIVEKAWNFYPF---TITGICSFLPRFSIKIETRYLNDKGCTENCFNLSPEELESREVIPVDIAFDEL-PEKYYVAEEDCRTFKSAVTGRGPL--EPGWRDTSDPIMCSYKLVNVSFDVWGLSQRVEAYVHKVVQDILLVGHRQAFAWIDLWYEMDINDVREYEKTMQEKTNNKV 249          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Nematostella
Match: EDO47918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ5])

HSP 1 Score: 56.6102 bits (135), Expect = 1.696e-10
Identity = 27/81 (33.33%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  687 PVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQ 929
            P+MC+YKLV   F  +GL  ++E  + K  + I    HR AF W+D W+ + + D+R  E    KE+ E+  + +  G  +
Sbjct:    6 PIMCSYKLVNVSFDVWGLSQRVEAYVHKVVQDILLVGHRQAFAWIDLWYEMDINDVREYE----KEMQEKTNNKVAVGVEE 82          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Medaka
Match: pitpnab (phosphatidylinositol transfer protein alpha isoform [Source:NCBI gene;Acc:101174122])

HSP 1 Score: 287.345 bits (734), Expect = 6.921e-95
Identity = 154/277 (55.60%), Postives = 182/277 (65.70%), Query Frame = 3
Query:  111 RVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTT 926
            RVILP+SVEEYQV QL+SVAEASKNETG GEG+EVL NEP++                  KGQYT+KIYHL +KVP  VR +AP  AL + EKAWNAYPYCRT      YMKD F+IKIE+ H  D G  EN H L  +   K +VV IDIA+       DYK ++DP  FKS K  RGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I KQE+R+FTNFHR  FCW+DKW  L MEDIR +EE+T+KELDE  R   +RGT 
Sbjct:    8 RVILPISVEEYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKEGE--------------KGQYTHKIYHLQSKVPSFVRMLAPSSALNIHEKAWNAYPYCRT---GNEYMKDNFLIKIETWHKPDMGHQENVHGLDAETWKKVDVVYIDIADRSQVEPKDYKPEEDPCKFKSTKTARGPLG--PDWKKELPNKKDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMEDIRRMEEETRKELDE-ARQRGIRGTV 264          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Medaka
Match: ENSORLT00000012124.2 (phosphatidylinositol transfer protein alpha isoform [Source:NCBI gene;Acc:101157147])

HSP 1 Score: 283.108 bits (723), Expect = 2.444e-93
Identity = 145/280 (51.79%), Postives = 187/280 (66.79%), Query Frame = 3
Query:  111 RVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            R++LP+SVEEYQV QL++VAEASK+ETG GEG+EVL+NEP++ N                KGQ+T+K+YHL +KVP  ++ +APK +L++ EKAWNAYPYCRT  ++      KF+IKIE+ H  D G  EN H L        EVV IDIA+    +  DYK DQDP +FKS K GRGPL   P WK ++      P MCAYKLV  +FKW GLQ +IE  I K E+R+FT+FHR  FC +DKW  LTM+DIR +EE+TK+ELDE  ++D V+G    D
Sbjct:    8 RIVLPVSVEEYQVGQLYAVAEASKSETGGGEGVEVLVNEPYEENGE--------------KGQFTHKVYHLQSKVPAFIKTVAPKGSLEIHEKAWNAYPYCRTSESH------KFLIKIETWHKPDMGNQENVHGLDEKTWGNVEVVNIDIADKNSISSKDYKADQDPSIFKSEKTGRGPLG--PDWKSELPNNPNCPHMCAYKLVTVEFKWLGLQNRIENYIQKVEKRLFTHFHRQLFCSIDKWIELTMDDIRRMEEETKRELDEMRKNDEVKGMGADD 265          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Medaka
Match: ENSORLT00000014894.2 (phosphatidylinositol transfer protein beta [Source:NCBI gene;Acc:101173068])

HSP 1 Score: 280.026 bits (715), Expect = 4.084e-92
Identity = 149/280 (53.21%), Postives = 178/280 (63.57%), Query Frame = 3
Query:  111 RVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI-----SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            RV+LP SVEEYQV QL+SVAEASKNETG GEGIEVL NEP++ +                KGQYT+KIYH+ +KVP  VR  AP+ +L   EKAWNAYPYCRT         + F IKIE+ H  D G  EN H L         VV IDIA+    + ADYK D+DP  FKS K GRGPL   P WK ++      P MCAYKLV   FKW+GLQ ++E  I +QE+RIF NFHR  FCW+DKW  LTM+DIR +E +T+KEL+E  R   VRGT+  D
Sbjct:    8 RVVLPCSVEEYQVGQLFSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHIQSKVPAFVRLFAPEGSLVFHEKAWNAYPYCRT---------NNFFIKIETWHKPDMGTQENVHNLDASTWKNVTVVPIDIADRSQVSNADYKPDEDPAKFKSAKTGRGPLG--PDWKKELVSNAECPRMCAYKLVTVKFKWWGLQTKVENFIQEQEKRIFNNFHRQLFCWIDKWVELTMDDIRRMEAETQKELEELRRRGEVRGTSAAD 262          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Medaka
Match: PITPNB (phosphatidylinositol transfer protein beta isoform [Source:NCBI gene;Acc:101162302])

HSP 1 Score: 260.766 bits (665), Expect = 1.580e-84
Identity = 152/292 (52.05%), Postives = 187/292 (64.04%), Query Frame = 3
Query:   90 RMLIKEFRVI--LP-----MSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDI---SPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            ++LI+EF +I  LP      S  +YQV QL+SVAEASKNETG GEGIEVL NEP++                  KGQYT+KIYHL +KVP  V+ IAP+ AL   EKAWNAYPYCRT         + F+IKIE+ H  D G  EN H L        EVV IDIA+ +     DYK ++DP LF+S K GRGPL   P WK ++    P MCAYKLV   F+W+GLQ ++E  I +QE+RIFTNFHR  FCW+DKW GLTMEDIR +EE+T+KEL+E  +   VRGT+  D
Sbjct:    1 QLLIQEFNIIKMLPAHSVCFSALQYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKEGE--------------KGQYTHKIYHLKSKVPGYVKMIAPEGALVFHEKAWNAYPYCRT---------NDFMIKIETWHKPDMGTVENVHDLDEQTWRTVEVVPIDIASRDEVAPGDYKPEEDPALFQSSKTGRGPLG--PEWKNELKTDCPYMCAYKLVTVKFRWWGLQTKVENFIHRQEKRIFTNFHRQLFCWIDKWVGLTMEDIRRMEEETQKELEEMRQKGDVRGTSATD 267          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Medaka
Match: PITPNM2 (membrane-associated phosphatidylinositol transfer protein 2 [Source:NCBI gene;Acc:101172908])

HSP 1 Score: 200.675 bits (509), Expect = 6.182e-56
Identity = 110/272 (40.44%), Postives = 165/272 (60.66%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNET-GAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWK-----GDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQE-RRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKEL 887
            MLIKE+R+ +PMSVEEY++AQL+ + + S+ ET G G G+E+L N+P+              D     GQYT+K+YH+   +P   R I PK AL++EE++WNAYPY RT  T P    +KF I IE+ +  D G   +   LS     +R +  IDI  D +  + +YK ++DP+ +KS+K  RGPL +  W +        +P+MCAYKL   +F+++G+Q +IE+ I     R++    HR A+CW D+W+GLT+EDIR +E +T+  L
Sbjct:    1 MLIKEYRIPMPMSVEEYRIAQLYMIQKKSREETCGEGSGVEILENKPYT-------------DGPGGTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCP--FVEKFSIDIETYYKSDTGNQPDVFNLSAADKRQRTIDPIDIVTDPIAPH-EYKAEEDPRFYKSVKTQRGPL-RDDWIEEYNNNPGKTPIMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTIEDIRQLELETQLAL 255          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Planmine SMEST
Match: SMESG000014949.1 (SMESG000014949.1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 281/281 (100.00%), Postives = 281/281 (100.00%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 935
            MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD
Sbjct:    1 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGTTQMD 281          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Planmine SMEST
Match: SMESG000064206.1 (SMESG000064206.1)

HSP 1 Score: 398.667 bits (1023), Expect = 1.252e-138
Identity = 185/277 (66.79%), Postives = 217/277 (78.34%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGT 923
            M++KEFR+ILPMSV+EYQ+AQLWS AEASKNETG GEGIEV IN+PFD +   P P LLNGDPRFT GQYT+KIYHL  KVP ++R  APK ALQLEE AWN+YPYCRT+L NP +MKDKF IKIESMH+   G  EN H L  DLL +RE+V IDIAND L   +DYKE+ DPK F S+K GRGPL    WWK    PVMCAYKLV+C+FKW+GLQ +IEKMI +QE+RIFTNFHRM FCWMD+W GLT+ +IR IE +T+++L EQL     RGT
Sbjct:    1 MIVKEFRIILPMSVDEYQIAQLWSTAEASKNETGGGEGIEVRINDPFDQHKFPPTPKLLNGDPRFTSGQYTFKIYHLDRKVPSLIRVFAPKGALQLEETAWNSYPYCRTILQNPSFMKDKFFIKIESMHVSGMGTEENVHCLPLDLLQQREIVFIDIANDPLDPSSDYKEEHDPKKFHSIKTGRGPLNTTQWWKNLNCPVMCAYKLVICEFKWWGLQTKIEKMIQRQEKRIFTNFHRMVFCWMDQWHGLTLHNIRIIESETQQQLSEQLNVGEKRGT 277          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Planmine SMEST
Match: SMESG000062807.1 (SMESG000062807.1)

HSP 1 Score: 370.933 bits (951), Expect = 1.235e-127
Identity = 173/277 (62.45%), Postives = 211/277 (76.17%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGT 923
            M+IKEFR+ILPM+VEEY +AQLWSVAE SKNETG GEGIEV+ NEPFD+ T+ P+  L     ++ KGQ+TYKIY+L  KVP  +RY+APK +L++ E+AWNAYPYCRT+L NP YM DKF IKIESMH+Q+    EN H+LS +LL++REVV IDIAND +    DY ++ DPKLF+S K GRGPL    WW+    P+MCAYKLV CDFKW+GLQ ++E +IM QE RIF NFHR  FCWMDKW GLTM  +R +EE TK+ELDEQ     VRGT
Sbjct:    1 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDN-VDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGT 276          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 191.045 bits (484), Expect = 8.030e-55
Identity = 106/267 (39.70%), Postives = 162/267 (60.67%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNE-TGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISP-----------VMCAYKLVVCDFKWFGLQGQIEKMIMK-QERRIFTNFHRMAFCWMDKWFGLTMEDI 854
            MLIKE+R+ +P++VEEY++AQL+ + + SK+E TG G G+E++ NEP++           NG      GQYT+KIYH+ + +P   R I PK AL +EE+AWNAYPY +T    P  + DKF ++IE+ +  D G  +N   L+ + + +R +  +DI ND + + +DY++++DPK++ S K  RGPLT    W  +              +MCAYKL   +FK++G+Q +IEK I     R+     HR A+CW D+W GL++ DI
Sbjct:    1 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYE-----------NGPGGI--GQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVP--IIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPI-SSSDYRKEEDPKIYVSSKTNRGPLTDS--WATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 249          
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 190.66 bits (483), Expect = 1.223e-52
Identity = 106/267 (39.70%), Postives = 162/267 (60.67%), Query Frame = 3
Query:   93 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNE-TGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISP-----------VMCAYKLVVCDFKWFGLQGQIEKMIMK-QERRIFTNFHRMAFCWMDKWFGLTMEDI 854
            MLIKE+R+ +P++VEEY++AQL+ + + SK+E TG G G+E++ NEP++           NG      GQYT+KIYH+ + +P   R I PK AL +EE+AWNAYPY +T    P  + DKF ++IE+ +  D G  +N   L+ + + +R +  +DI ND + + +DY++++DPK++ S K  RGPLT    W  +              +MCAYKL   +FK++G+Q +IEK I     R+     HR A+CW D+W GL++ DI
Sbjct:    1 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYE-----------NGPGGI--GQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVP--IIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPI-SSSDYRKEEDPKIYVSSKTNRGPLTDS--WATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 249          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PITPNA8.681e-10655.94phosphatidylinositol transfer protein alpha [Sourc... [more]
PITPNA3.605e-10555.94phosphatidylinositol transfer protein alpha [Sourc... [more]
PITPNB1.301e-10456.64phosphatidylinositol transfer protein beta [Source... [more]
PITPNB4.539e-10456.64phosphatidylinositol transfer protein beta [Source... [more]
PITPNB2.944e-10356.89phosphatidylinositol transfer protein beta [Source... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y54F10AR.17.807e-11461.01pep chromosome:WBcel235:III:2572031:2575723:-1 gen... [more]
Y71G12B.172.701e-7643.01pep chromosome:WBcel235:I:1667501:1669792:1 gene:W... [more]
pitp-16.302e-4936.03PhosphatidylInositol Transfer Protein family [Sou... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vib6.295e-11459.78gene:FBgn0267975 transcript:FBtr0083745[more]
vib6.295e-11459.78gene:FBgn0267975 transcript:FBtr0344554[more]
vib2.883e-11159.57gene:FBgn0267975 transcript:FBtr0310064[more]
rdgB3.098e-5741.16gene:FBgn0003218 transcript:FBtr0331716[more]
rdgB3.136e-5741.16gene:FBgn0003218 transcript:FBtr0301535[more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnab2.127e-10456.29phosphatidylinositol transfer protein, alpha b [So... [more]
pitpnaa8.558e-10355.59phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnaa8.558e-10355.59phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnaa8.558e-10355.59phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnab6.162e-10255.44phosphatidylinositol transfer protein, alpha b [So... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpna1.232e-10456.84phosphatidylinositol transfer protein alpha [Sourc... [more]
rho3.655e-10155.48rhodopsin [Source:Xenbase;Acc:XB-GENE-966887][more]
pitpnb4.475e-9953.50phosphatidylinositol transfer protein, beta [Sourc... [more]
pitpna6.834e-9551.52phosphatidylinositol transfer protein alpha [Sourc... [more]
pitpna3.993e-9453.79phosphatidylinositol transfer protein alpha [Sourc... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pitpna1.135e-10555.24phosphatidylinositol transfer protein, alpha [Sour... [more]
Pitpna3.509e-10555.59phosphatidylinositol transfer protein, alpha [Sour... [more]
Pitpna4.709e-10455.24phosphatidylinositol transfer protein, alpha [Sour... [more]
Pitpnb1.715e-10356.29phosphatidylinositol transfer protein, beta [Sourc... [more]
Pitpnb6.119e-10256.54phosphatidylinositol transfer protein, beta [Sourc... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48738|PIPNA_RABIT3.109e-10555.59Phosphatidylinositol transfer protein alpha isofor... [more]
sp|Q00169|PIPNA_HUMAN4.169e-10555.94Phosphatidylinositol transfer protein alpha isofor... [more]
sp|P16446|PIPNA_RAT2.108e-10455.59Phosphatidylinositol transfer protein alpha isofor... [more]
sp|Q2HJ54|PIPNA_BOVIN2.296e-10455.59Phosphatidylinositol transfer protein alpha isofor... [more]
sp|P53810|PIPNA_MOUSE2.454e-10455.59Phosphatidylinositol transfer protein alpha isofor... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DXL93.636e-12966.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GKU11.181e-12866.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EBF74.316e-12764.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0X3NHZ51.982e-12561.37Phosphatidylinositol transfer protein alpha isofor... [more]
D3PIG73.708e-12364.98Phosphatidylinositol transfer protein beta isoform... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnaa2.871e-9352.10phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnb4.837e-9255.26phosphatidylinositol transfer protein, beta [Sourc... [more]
ENSAMXT00000052719.15.932e-9154.51pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
pitpnbl2.037e-8951.25phosphatidylinositol transfer protein, beta, like ... [more]
pitpnab3.876e-8552.61phosphatidylinositol transfer protein, alpha b [So... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004160.16.300e-9253.66pep scaffold:Pmarinus_7.0:GL481899:12693:18585:1 g... [more]
ENSPMAT00000003232.13.604e-4941.20pep scaffold:Pmarinus_7.0:GL486150:7644:10272:1 ge... [more]
ENSPMAT00000002979.17.770e-3235.38pep scaffold:Pmarinus_7.0:GL478233:8948:23532:1 ge... [more]
PITPNC12.910e-1934.39phosphatidylinositol transfer protein cytoplasmic ... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432794.245e-8850.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433222.267e-7747.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418876.761e-5741.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479175.064e-5035.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479181.696e-1033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnab6.921e-9555.60phosphatidylinositol transfer protein alpha isofor... [more]
ENSORLT00000012124.22.444e-9351.79phosphatidylinositol transfer protein alpha isofor... [more]
ENSORLT00000014894.24.084e-9253.21phosphatidylinositol transfer protein beta [Source... [more]
PITPNB1.580e-8452.05phosphatidylinositol transfer protein beta isoform... [more]
PITPNM26.182e-5640.44membrane-associated phosphatidylinositol transfer ... [more]
back to top
BLAST of Phosphatidylinositol transfer protein alpha isoform vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014949.10.000e+0100.00SMESG000014949.1[more]
SMESG000064206.11.252e-13866.79SMESG000064206.1[more]
SMESG000062807.11.235e-12762.45SMESG000062807.1[more]
SMESG000004877.18.030e-5539.70SMESG000004877.1[more]
SMESG000004877.11.223e-5239.70SMESG000004877.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015151 ID=SMED30015151|Name=Phosphatidylinositol transfer protein alpha isoform|organism=Schmidtea mediterranea sexual|type=transcript|length=1319bp
TTTCACTTTATATCACTTATAAATTAAAACGTGAAAGGAACTATAAATTT
TTATTTTAGGTACACATACTTGTTCACTTTTAATAATTCAGAATGCTTAT
CAAAGAATTTCGGGTTATTCTTCCAATGTCTGTTGAAGAGTATCAGGTAG
CACAATTATGGTCAGTAGCTGAAGCATCTAAGAATGAAACTGGTGCTGGA
GAAGGGATTGAAGTTTTAATCAATGAACCATTTGATGCGAATACCCATGT
GCCAGATCCTTCTTTATTAAATGGTGATCCTCGATTTACCAAAGGCCAAT
ATACATATAAAATATATCATTTAATCAACAAGGTGCCTCGAATTGTAAGA
TATATTGCACCAAAAGAAGCTTTGCAATTAGAAGAAAAAGCTTGGAATGC
ATATCCCTATTGTCGAACCGTATTAACGAATCCTGGTTATATGAAAGATA
AATTTATAATTAAAATCGAAAGTATGCACATGCAAGACCCTGGAATAAAT
GAAAATGCACATCAATTATCTCCTGATCTCTTATCAAAACGAGAAGTTGT
GACTATAGATATAGCAAACGATGAACTGTATACATATGCCGACTACAAAG
AAGATCAGGATCCGAAATTATTTAAATCATTGAAAGCTGGGCGAGGCCCG
TTGACGAAAAAACCATGGTGGAAGGGTGACATAAGTCCAGTGATGTGTGC
TTATAAATTGGTTGTATGTGACTTCAAATGGTTCGGCTTGCAGGGCCAAA
TCGAAAAAATGATCATGAAGCAAGAAAGACGCATTTTTACCAACTTTCAT
AGAATGGCATTTTGTTGGATGGATAAATGGTTTGGTTTGACTATGGAAGA
TATCCGTGCTATCGAAGAAAAAACTAAAAAAGAATTAGACGAACAATTAC
GCGATGATATTGTCAGAGGAACGACTCAAATGGATTAGATTTATTCCAAT
TTATGTCGAAAGACAGAATGTGTTTCTGTGAATTCACTTTCTTATTGTTG
TCAATTGTCAGAATAGAATGTGTCGTATGCTTTTGTGAATGATTGCAATA
ATTGTTACCATTAAATATATTTGTGGTTTTATATATATATATATATATAT
ATAAATATATTTCTGTTGATCTTGATGTTCAGTAAATAATGATAAATGTA
AAAAACAGATCCTATATATTTGTCATCAAGTGTAAATTATTCTATTGGCT
GATTTAATATTAAACAGTTGGGAATTTTTTAAGTGGGATTTTTTATTTCA
GTTTTGAGCAGTTAGAAATATCATGGGATTTTAAATGATTTGTAATTAGT
TTCAAATTTTTGGATTTAT
back to top

protein sequence of SMED30015151-orf-1

>SMED30015151-orf-1 ID=SMED30015151-orf-1|Name=SMED30015151-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDAN
THVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKA
WNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKR
EVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPV
MCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLT
MEDIRAIEEKTKKELDEQLRDDIVRGTTQMD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005548phospholipid transporter activity
Vocabulary: biological process
TermDefinition
GO:0015914phospholipid transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001666PI_transfer
IPR023393START-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001666Phosphatidylinositol transfer proteinPRINTSPR00391PITRANSFERcoord: 231..250
score: 60.0
coord: 211..226
score: 47.92
coord: 16..35
score: 66.25
IPR001666Phosphatidylinositol transfer proteinPFAMPF02121IP_transcoord: 1..263
e-value: 2.8E-110
score: 367.7
IPR001666Phosphatidylinositol transfer proteinPANTHERPTHR10658PHOSPHATIDYLINOSITOL TRANSFER PROTEINcoord: 1..279
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 1..281
e-value: 5.5E-116
score: 388.7
NoneNo IPR availablePANTHERPTHR10658:SF58VIBRATOR, ISOFORM Bcoord: 1..279
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 1..276