Deubiquitinase DESI2

Overview
NameDeubiquitinase DESI2
Smed IDSMED30015136
Length (bp)1071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Deubiquitinase DESI2 (SMED30015136) t-SNE clustered cells

Violin plots show distribution of expression levels for Deubiquitinase DESI2 (SMED30015136) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Deubiquitinase DESI2 (SMED30015136) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Deubiquitinase DESI2 (SMED30015136) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015136

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30015136SMESG000071271.1 dd_Smed_v4_3397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Deubiquitinase DESI2 vs. Ensembl Human
Match: DESI2 (desumoylating isopeptidase 2 [Source:HGNC Symbol;Acc:HGNC:24264])

HSP 1 Score: 166.777 bits (421), Expect = 9.259e-50
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV++VYD++  N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    7 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 152          
BLAST of Deubiquitinase DESI2 vs. Ensembl Human
Match: DESI2 (desumoylating isopeptidase 2 [Source:HGNC Symbol;Acc:HGNC:24264])

HSP 1 Score: 115.161 bits (287), Expect = 2.037e-30
Identity = 56/146 (38.36%), Postives = 83/146 (56.85%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV++VYD++  N Y   +G GV+H+G+EVYG                                  ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    7 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGR---------------------------------AVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 119          
BLAST of Deubiquitinase DESI2 vs. Ensembl Human
Match: DESI2 (desumoylating isopeptidase 2 [Source:HGNC Symbol;Acc:HGNC:24264])

HSP 1 Score: 80.1073 bits (196), Expect = 4.378e-18
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 2
Query:  119 NNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTEND 319
            N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D
Sbjct:   35 NEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDD 101          
BLAST of Deubiquitinase DESI2 vs. Ensembl Human
Match: DESI1 (desumoylating isopeptidase 1 [Source:HGNC Symbol;Acc:HGNC:24577])

HSP 1 Score: 55.4546 bits (132), Expect = 1.072e-8
Identity = 45/150 (30.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGF--------GVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQ-FCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIP 505
            PV ++VYD+ K      RL          G++HT + V+  E+ +G      SG     P    +LG   +    +++G+T+ TE    + L +LG   F G  YNL + NCN FS    Q L  + +P +I  L     S PF + + P
Sbjct:    8 PVKLYVYDLSK--GLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFG------SGGISSCPPGGTLLGPPDSV---VDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRP 146          
BLAST of Deubiquitinase DESI2 vs. Ensembl Celegans
Match: F36D4.5 (pep chromosome:WBcel235:V:9419295:9423891:-1 gene:WBGene00018090.1 transcript:F36D4.5b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F36D4.5)

HSP 1 Score: 164.081 bits (414), Expect = 1.281e-47
Identity = 70/157 (44.59%), Postives = 107/157 (68.15%), Query Frame = 2
Query:   53 DSLFNACETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            D +  A   + V ++VYD++  N+Y   +G G++H+G+EV+G EY YGGHP +FSG+F   P++ E LG+ + FK S+ +G T+ + +D+R+++ +LG  F G  Y+L+ +NCNHFS    + L  + +P WINRLA  S SIPF+EK IP+EWL P
Sbjct:    2 DVMGTARRKTVVRLNVYDMYWLNDYASNIGVGIFHSGIEVFGVEYAYGGHPYQFSGVFENSPQDAEELGETFKFKESIVVGETERSTSDIRKLIKSLGEDFRGDRYHLISRNCNHFSAVLARELTGKDIPGWINRLANLSGSIPFLEKCIPQEWLTP 158          
BLAST of Deubiquitinase DESI2 vs. Ensembl Celegans
Match: F36D4.5 (pep chromosome:WBcel235:V:9419292:9421502:-1 gene:WBGene00018090.1 transcript:F36D4.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F36D4.5)

HSP 1 Score: 164.081 bits (414), Expect = 1.281e-47
Identity = 70/157 (44.59%), Postives = 107/157 (68.15%), Query Frame = 2
Query:   53 DSLFNACETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            D +  A   + V ++VYD++  N+Y   +G G++H+G+EV+G EY YGGHP +FSG+F   P++ E LG+ + FK S+ +G T+ + +D+R+++ +LG  F G  Y+L+ +NCNHFS    + L  + +P WINRLA  S SIPF+EK IP+EWL P
Sbjct:    2 DVMGTARRKTVVRLNVYDMYWLNDYASNIGVGIFHSGIEVFGVEYAYGGHPYQFSGVFENSPQDAEELGETFKFKESIVVGETERSTSDIRKLIKSLGEDFRGDRYHLISRNCNHFSAVLARELTGKDIPGWINRLANLSGSIPFLEKCIPQEWLTP 158          
BLAST of Deubiquitinase DESI2 vs. Ensembl Celegans
Match: F36D4.5 (pep chromosome:WBcel235:V:9419295:9425762:-1 gene:WBGene00018090.1 transcript:F36D4.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F36D4.5)

HSP 1 Score: 163.696 bits (413), Expect = 2.832e-47
Identity = 70/157 (44.59%), Postives = 107/157 (68.15%), Query Frame = 2
Query:   53 DSLFNACETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            D +  A   + V ++VYD++  N+Y   +G G++H+G+EV+G EY YGGHP +FSG+F   P++ E LG+ + FK S+ +G T+ + +D+R+++ +LG  F G  Y+L+ +NCNHFS    + L  + +P WINRLA  S SIPF+EK IP+EWL P
Sbjct:   21 DVMGTARRKTVVRLNVYDMYWLNDYASNIGVGIFHSGIEVFGVEYAYGGHPYQFSGVFENSPQDAEELGETFKFKESIVVGETERSTSDIRKLIKSLGEDFRGDRYHLISRNCNHFSAVLARELTGKDIPGWINRLANLSGSIPFLEKCIPQEWLTP 177          
BLAST of Deubiquitinase DESI2 vs. Ensembl Fly
Match: CG7222 (gene:FBgn0033551 transcript:FBtr0345945)

HSP 1 Score: 176.022 bits (445), Expect = 1.359e-53
Identity = 74/147 (50.34%), Postives = 108/147 (73.47%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N Y   +G GV+H+GVE +GTE+ YGGHP  F+G+F + P++ + LGD++ F+ S+ +G TDFT  +VR+I+  LGNQF G  Y+L+  NCNHFSG+  QIL  Q +P W+NRLA  SS +PF+++ +PKEWL P
Sbjct:   38 PVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILCGQEIPSWVNRLAHFSSCVPFLQRCLPKEWLTP 184          
BLAST of Deubiquitinase DESI2 vs. Ensembl Fly
Match: CG7222 (gene:FBgn0033551 transcript:FBtr0088223)

HSP 1 Score: 176.022 bits (445), Expect = 1.359e-53
Identity = 74/147 (50.34%), Postives = 108/147 (73.47%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N Y   +G GV+H+GVE +GTE+ YGGHP  F+G+F + P++ + LGD++ F+ S+ +G TDFT  +VR+I+  LGNQF G  Y+L+  NCNHFSG+  QIL  Q +P W+NRLA  SS +PF+++ +PKEWL P
Sbjct:   38 PVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILCGQEIPSWVNRLAHFSSCVPFLQRCLPKEWLTP 184          
BLAST of Deubiquitinase DESI2 vs. Ensembl Fly
Match: CG12231 (gene:FBgn0031026 transcript:FBtr0074779)

HSP 1 Score: 124.02 bits (310), Expect = 6.725e-34
Identity = 57/144 (39.58%), Postives = 92/144 (63.89%), Query Frame = 2
Query:   74 ETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKN-MEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKII 502
            +  PV++++YD+   NNY   LG GV+H+GV++YG EY +       SGIF + P N  E LG+ + F+ S+ +G TDFT  +V++++  LG +F G  Y+L  KNCNHFS     ++  + +P+W+NRLA   + +PF+E+ +
Sbjct:   25 QREPVMLNIYDLSTSNNYTFPLGLGVFHSGVQLYGREYAFLALNLSISGIFEIHPCNGQEELGEHFRFRKSILLGYTDFTCAEVKRVINLLGFEFRGTSYHLTSKNCNHFSNCLAHLVCGRKIPRWVNRLAYLITCVPFLERFV 168          
BLAST of Deubiquitinase DESI2 vs. Ensembl Zebrafish
Match: FP103009.1 (desumoylating isopeptidase 2-like [Source:NCBI gene;Acc:794838])

HSP 1 Score: 171.014 bits (432), Expect = 1.311e-51
Identity = 78/176 (44.32%), Postives = 114/176 (64.77%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRPQDYMDDESDVNMMCAKSFYYPEQSGSSSE 610
            PV+++VYD++  N Y   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +GTTDF E D+ +I+  LG +F G  Y+L+ KNCNHFS +  ++L  + +P+W+NRLA  SS IPF++  +PKEWL P      +S ++M   K   +     SS E
Sbjct:    5 PVILNVYDMYWINEYTSTLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEINPGNASELGETFKFKEAIALGTTDFAEEDIDKIMEELGKEFKGNAYHLMHKNCNHFSSSLSELLCGREIPRWVNRLAYFSSCIPFLQSCLPKEWLTPAAL---QSHISMGLRKENTHSHTHESSDE 177          
BLAST of Deubiquitinase DESI2 vs. Ensembl Zebrafish
Match: desi2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:445138])

HSP 1 Score: 166.392 bits (420), Expect = 9.014e-50
Identity = 70/147 (47.62%), Postives = 105/147 (71.43%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N +   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P +   LG+ + FK ++ +G+TDFTE DV +I+  +G ++ G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:    5 PVILNVYDMYWINEFTSSLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPGDATELGETFKFKEAIVLGSTDFTEEDVERIVEEMGKEYKGNAYHLMHKNCNHFSSALSEILCGREIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Zebrafish
Match: desi1a (desumoylating isopeptidase 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1657])

HSP 1 Score: 53.9138 bits (128), Expect = 2.624e-8
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  146 GVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLG-NQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIP 505
            G++HT + +YG E+ YGG     +GI    P    +LG   T    + +G T+ TE      L +LG   + G  Y L + NCN F+    Q L    +P +I  L     S PF + + P
Sbjct:   36 GIWHTSIVIYGEEFFYGG-----AGISSCPPGGT-MLGPPDTV---VELGNTEVTEEIFMDYLSSLGETTYSGDKYRLFEHNCNTFTNEVAQFLTGNKIPTYITDLPSEVLSTPFGQVLRP 147          
BLAST of Deubiquitinase DESI2 vs. Ensembl Xenopus
Match: DESI2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:100379811])

HSP 1 Score: 172.94 bits (437), Expect = 3.061e-52
Identity = 74/147 (50.34%), Postives = 106/147 (72.11%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N Y   LG GV+H+G++VYG E+ YGGHP  FSGIF + P +   LGD + FK ++ +G+TDFTEND+ +I+  LG +F G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:    5 PVILNVYDMYWINEYTSSLGIGVFHSGIQVYGREFAYGGHPYPFSGIFEISPGDSSELGDTFKFKEAIALGSTDFTENDIEKIIEELGKEFKGNAYHLMHKNCNHFSSALSEILCGKEIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Xenopus
Match: ENSXETT00000040132.1 (desumoylating isopeptidase 2 like [Source:NCBI gene;Acc:100489116])

HSP 1 Score: 169.859 bits (429), Expect = 5.229e-51
Identity = 72/147 (48.98%), Postives = 103/147 (70.07%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N Y   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +GTTDFTE D+  I+  LG ++ G  Y+L+ KNCNHFS    ++L  + +P+W+NRLA  SS IPF++  +PKEWL P
Sbjct:    5 PVILNVYDMYWINEYTSTLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPGNAAELGETFKFKEAIALGTTDFTEEDIDNIMEELGKEYKGNAYHLMHKNCNHFSAVLAEMLCGKEIPRWVNRLAYFSSCIPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Xenopus
Match: DESI2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:100379811])

HSP 1 Score: 160.999 bits (406), Expect = 1.061e-47
Identity = 69/139 (49.64%), Postives = 98/139 (70.50%), Query Frame = 2
Query:  107 IFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            ++  N Y   LG GV+H+G++VYG E+ YGGHP  FSGIF + P +   LGD + FK ++ +G+TDFTEND+ +I+  LG +F G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:    9 VYWINEYTSSLGIGVFHSGIQVYGREFAYGGHPYPFSGIFEISPGDSSELGDTFKFKEAIALGSTDFTENDIEKIIEELGKEFKGNAYHLMHKNCNHFSSALSEILCGKEIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 147          
BLAST of Deubiquitinase DESI2 vs. Ensembl Xenopus
Match: DESI2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:100379811])

HSP 1 Score: 160.229 bits (404), Expect = 2.356e-47
Identity = 69/135 (51.11%), Postives = 96/135 (71.11%), Query Frame = 2
Query:  119 NNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            N Y   LG GV+H+G++VYG E+ YGGHP  FSGIF + P +   LGD + FK ++ +G+TDFTEND+ +I+  LG +F G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:   10 NEYTSSLGIGVFHSGIQVYGREFAYGGHPYPFSGIFEISPGDSSELGDTFKFKEAIALGSTDFTENDIEKIIEELGKEFKGNAYHLMHKNCNHFSSALSEILCGKEIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 144          
BLAST of Deubiquitinase DESI2 vs. Ensembl Xenopus
Match: ENSXETT00000012778.1 (desumoylating isopeptidase 2-like [Source:NCBI gene;Acc:101731896])

HSP 1 Score: 95.9005 bits (237), Expect = 1.516e-23
Identity = 39/86 (45.35%), Postives = 60/86 (69.77%), Query Frame = 2
Query:  266 YTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            ++ + ++ +GTTDFTE D+  I+  LG ++ G  Y+L+ KNCNHFS    ++L  + +P+W+NRLA  SS IPF++  +PKEWL P
Sbjct:    6 FSCREAIALGTTDFTEEDIDNIMEELGKEYKGDAYHLMHKNCNHFSAVLAEMLCGKEIPRWVNRLAYFSSCIPFLQSCLPKEWLIP 91          
BLAST of Deubiquitinase DESI2 vs. Ensembl Mouse
Match: Desi2 (desumoylating isopeptidase 2 [Source:MGI Symbol;Acc:MGI:1926075])

HSP 1 Score: 166.777 bits (421), Expect = 5.354e-50
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV++VYD++  N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    7 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 152          
BLAST of Deubiquitinase DESI2 vs. Ensembl Mouse
Match: Desi2 (desumoylating isopeptidase 2 [Source:MGI Symbol;Acc:MGI:1926075])

HSP 1 Score: 166.777 bits (421), Expect = 5.354e-50
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV++VYD++  N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    7 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 152          
BLAST of Deubiquitinase DESI2 vs. Ensembl Mouse
Match: Desi2 (desumoylating isopeptidase 2 [Source:MGI Symbol;Acc:MGI:1926075])

HSP 1 Score: 156.377 bits (394), Expect = 3.629e-46
Identity = 68/135 (50.37%), Postives = 95/135 (70.37%), Query Frame = 2
Query:  119 NNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    2 NEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 136          
BLAST of Deubiquitinase DESI2 vs. Ensembl Mouse
Match: Desi2 (desumoylating isopeptidase 2 [Source:MGI Symbol;Acc:MGI:1926075])

HSP 1 Score: 156.377 bits (394), Expect = 3.629e-46
Identity = 68/135 (50.37%), Postives = 95/135 (70.37%), Query Frame = 2
Query:  119 NNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    2 NEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 136          
BLAST of Deubiquitinase DESI2 vs. Ensembl Mouse
Match: Desi2 (desumoylating isopeptidase 2 [Source:MGI Symbol;Acc:MGI:1926075])

HSP 1 Score: 152.91 bits (385), Expect = 1.975e-45
Identity = 67/133 (50.38%), Postives = 94/133 (70.68%), Query Frame = 2
Query:  119 NNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWL 517
            N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL
Sbjct:    2 NEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWL 134          
BLAST of Deubiquitinase DESI2 vs. UniProt/SwissProt
Match: sp|Q5PQ09|DESI2_XENLA (Deubiquitinase DESI2 OS=Xenopus laevis OX=8355 GN=desi2 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 3.360e-50
Identity = 70/147 (47.62%), Postives = 106/147 (72.11%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            P++++VYD++  N Y   LG GV+H+G++VYG E+ YGGHP  FSG+F + P +   LGD + FK ++ +G+TDFTEND+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  S+ +PF++  +PKEWL P
Sbjct:    5 PIILNVYDMYWINEYTSSLGIGVFHSGIQVYGREFAYGGHPYPFSGVFEISPGDSTELGDTFKFKEAIALGSTDFTENDIEKIIEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWVNRLAYFSTCVPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. UniProt/SwissProt
Match: sp|Q5ZIV7|DESI2_CHICK (Deubiquitinase DESI2 OS=Gallus gallus OX=9031 GN=DESI2 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.035e-49
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            V+++VYD++  N Y   LG GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG +F G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS IPF++  +PKEWL P
Sbjct:    6 VILNVYDMYWMNEYTSSLGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFMEDDIEKIVEELGKEFKGNAYHLMHKNCNHFSSALSEILCGKEIPRWVNRLAYFSSCIPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. UniProt/SwissProt
Match: sp|Q9D291|DESI2_MOUSE (Deubiquitinase DESI2 OS=Mus musculus OX=10090 GN=Desi2 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.745e-49
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV++VYD++  N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    7 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 152          
BLAST of Deubiquitinase DESI2 vs. UniProt/SwissProt
Match: sp|Q5R456|DESI2_PONAB (Deubiquitinase DESI2 OS=Pongo abelii OX=9601 GN=DESI2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 4.446e-49
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV++VYD++  N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    7 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 152          
BLAST of Deubiquitinase DESI2 vs. UniProt/SwissProt
Match: sp|A3QRX8|DESI2_PIG (Deubiquitinase DESI2 OS=Sus scrofa OX=9823 GN=DESI2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 4.446e-49
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV++VYD++  N Y   +G GV+H+G+EVYG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +G+TDF E+D+ +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+WINRLA  SS IPF++  +PKEWL P
Sbjct:    7 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTP 152          
BLAST of Deubiquitinase DESI2 vs. TrEMBL
Match: W6UAE4 (PPPDE peptidase domain-containing protein OS=Echinococcus granulosus OX=6210 GN=EGR_06775 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 9.776e-57
Identity = 105/211 (49.76%), Postives = 129/211 (61.14%), Query Frame = 2
Query:   50 SDSLFNA-CETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRPQDYMDDESDVNMMCAKSF---YYPEQSGSSSEWIVIDPRKENENDASCCSHK 670
            S +  NA  E+SPV V+VYD+   N YI  +G GVYHTGVEVY  EYCYGGH    SGIF M P++ E LG  Y+FK S+ +G TDFT  DV  I+  +   F G  Y+LL+KNCNHFS AF++IL   TLPKWINRLA  S+ +PFIEK IPKEWL P    + E   +     S    + P     SS  + I PR EN+ D    SH+
Sbjct:    6 SPTFSNAMAESSPVTVNVYDMSWLNEYIGNIGLGVYHTGVEVYEREYCYGGHQFGSSGIFEMTPRDTESLGPNYSFKTSIVVGFTDFTYRDVCTIISNMERDFRGAHYHLLRKNCNHFSSAFVEILCGATLPKWINRLAVVSTKLPFIEKSIPKEWLTPPQQTETEPRSSRSLRPSVCDAFLPATRDDSS--MAISPRSENDEDTVESSHR 214          
BLAST of Deubiquitinase DESI2 vs. TrEMBL
Match: A0A158QDF3 (DUF862 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2912 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 4.665e-56
Identity = 93/156 (59.62%), Postives = 111/156 (71.15%), Query Frame = 2
Query:   77 TSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRPQDYMDDE 544
            +SPV+V+VYD+   N YI  +G GVYHTGVEVY  EYCYGGH    SGIF M P++ E LG  YTFK S+ +G TDFT  DV  IL T+  +F G  Y+LL+KNCNHFS AF++IL   TLPKWINRLA  S+ +PFIEK IPKEWL P    D+E
Sbjct:    6 SSPVIVNVYDMSSLNEYISNIGLGVYHTGVEVYEREYCYGGHQFGGSGIFEMVPRDTENLGPNYTFKTSIIIGCTDFTYRDVCTILNTMEKEFLGDQYHLLRKNCNHFSSAFVEILCGATLPKWINRLASVSTKLPFIEKSIPKEWLTPLQQSDEE 161          
BLAST of Deubiquitinase DESI2 vs. TrEMBL
Match: A0A564YBS8 (DUF862 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4332 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.714e-55
Identity = 93/156 (59.62%), Postives = 111/156 (71.15%), Query Frame = 2
Query:   77 TSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRPQDYMDDE 544
            +SPV+V+VYD+   N YI  +G GVYHTGVEVY  EYCYGGH    SGIF M P++ E LG  YTFK S+ +G TDFT  DV  IL T+  +F G  Y+LL+KNCNHFS AF++IL   TLPKWINRLA  S+ +PFIEK IPKEWL P    D+E
Sbjct:   53 SSPVIVNVYDMSSLNEYISNIGLGVYHTGVEVYEREYCYGGHQFGGSGIFEMVPRDTENLGPNYTFKTSIIIGCTDFTYRDVCTILNTMEKEFRGDQYHLLRKNCNHFSSAFVEILCGATLPKWINRLASVSTKLPFIEKSIPKEWLTPLQQSDEE 208          
BLAST of Deubiquitinase DESI2 vs. TrEMBL
Match: A0A1S3IZ85 (desumoylating isopeptidase 2 OS=Lingula unguis OX=7574 GN=LOC106168684 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.305e-55
Identity = 83/146 (56.85%), Postives = 110/146 (75.34%), Query Frame = 2
Query:   86 VVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            VV+++YD++  N Y   LG GVYH+G+EVYGTEY YGGHP  FSGIF + PK+ E LG+ + FK ++ +G+TDFT+ D+++I+  LGN++ G  Y+LL KNCNHFS A +QIL  + +P W+NRLA  SS IPFIEK IPKEWL P
Sbjct:    6 VVINIYDMYWINEYTSTLGIGVYHSGIEVYGTEYAYGGHPFPFSGIFDITPKDAEELGEHFKFKETIRLGSTDFTQEDIQKIVEQLGNEYKGDQYHLLNKNCNHFSSALVQILCGKDIPSWVNRLAYVSSCIPFIEKAIPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. TrEMBL
Match: A0A2T7NW57 (DUF862 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13064 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 6.755e-55
Identity = 83/147 (56.46%), Postives = 109/147 (74.15%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+V++YD++  N Y   LG GV+H+GVEVYGTEY YGGHP  FSGIF +EP++ E LGD++ FK ++++G TDF+  D+R+I   LG +F G  Y+LL KNCNHFS A  Q+L  + LP W+NRLA  SS IPFIE+ IP+EWL P
Sbjct:    5 PVLVNIYDMYWINEYTSSLGLGVFHSGVEVYGTEYAYGGHPFPFSGIFEIEPRDAEDLGDQFKFKQTIHLGYTDFSAEDIRRITEQLGKEFRGDQYHLLNKNCNHFSSALTQVLCGKDLPSWVNRLAYVSSCIPFIERAIPREWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Cavefish
Match: ENSAMXT00000022166.2 (desumoylating isopeptidase 2-like [Source:NCBI gene;Acc:103035102])

HSP 1 Score: 169.859 bits (429), Expect = 2.687e-51
Identity = 72/149 (48.32%), Postives = 106/149 (71.14%), Query Frame = 2
Query:   77 TSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            + PV+++VYD++  N Y   LG GV+H+G+++YG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +GTTDFTE D+ +I+  LG +F G  Y+L+ KNCNHFS +  ++L  + +P+W+NRLA  SS IPF++  +PKEWL P
Sbjct:    3 SEPVILNVYDMYWINEYTSTLGIGVFHSGIQIYGREFAYGGHPYPFSGIFEISPGNATELGETFKFKEAVALGTTDFTEEDIDKIMEELGKEFKGNAYHLMHKNCNHFSSSLSELLCGREIPRWVNRLAYFSSCIPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Cavefish
Match: ENSAMXT00000047218.1 (desumoylating isopeptidase 2-like [Source:NCBI gene;Acc:103035102])

HSP 1 Score: 169.859 bits (429), Expect = 3.548e-51
Identity = 72/149 (48.32%), Postives = 106/149 (71.14%), Query Frame = 2
Query:   77 TSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            + PV+++VYD++  N Y   LG GV+H+G+++YG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +GTTDFTE D+ +I+  LG +F G  Y+L+ KNCNHFS +  ++L  + +P+W+NRLA  SS IPF++  +PKEWL P
Sbjct:    3 SEPVILNVYDMYWINEYTSTLGIGVFHSGIQIYGREFAYGGHPYPFSGIFEISPGNATELGETFKFKEAVALGTTDFTEEDIDKIMEELGKEFKGNAYHLMHKNCNHFSSSLSELLCGREIPRWVNRLAYFSSCIPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Cavefish
Match: desi2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:103022086])

HSP 1 Score: 167.162 bits (422), Expect = 4.044e-50
Identity = 71/147 (48.30%), Postives = 105/147 (71.43%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N +   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P +   LG+ + FK ++ +G+TDFTE DV +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:    5 PVILNVYDMYWINEFTTSLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPGDATELGETFKFKEAIVLGSTDFTEEDVERIMEELGKEYKGNAYHLMHKNCNHFSSALSEILCGREIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Cavefish
Match: desi2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:103022086])

HSP 1 Score: 167.162 bits (422), Expect = 4.044e-50
Identity = 71/147 (48.30%), Postives = 105/147 (71.43%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N +   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P +   LG+ + FK ++ +G+TDFTE DV +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:    5 PVILNVYDMYWINEFTTSLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPGDATELGETFKFKEAIVLGSTDFTEEDVERIMEELGKEYKGNAYHLMHKNCNHFSSALSEILCGREIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Cavefish
Match: desi2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:103022086])

HSP 1 Score: 167.162 bits (422), Expect = 4.044e-50
Identity = 71/147 (48.30%), Postives = 105/147 (71.43%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PV+++VYD++  N +   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P +   LG+ + FK ++ +G+TDFTE DV +I+  LG ++ G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:    5 PVILNVYDMYWINEFTTSLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPGDATELGETFKFKEAIVLGSTDFTEEDVERIMEELGKEYKGNAYHLMHKNCNHFSSALSEILCGREIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Sea Lamprey
Match: desi2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:445138])

HSP 1 Score: 155.221 bits (391), Expect = 9.820e-47
Identity = 64/135 (47.41%), Postives = 93/135 (68.89%), Query Frame = 2
Query:  119 NNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            N Y   +G G++H+G++VYG E+ YGGHP  FSG+F + P ++  LG+ + FK ++ +GTTDF E DV QI+  LG  F G  Y+L+ KNCNHF+    +IL  + +P+W+NRLA  SS IPF+  ++P+EWL P
Sbjct:   17 NEYTSTIGIGIFHSGIQVYGREFAYGGHPYPFSGVFEIVPGDVAELGETFKFKEAIMLGTTDFAEEDVAQIVEELGKDFKGNAYHLINKNCNHFTAGLAEILCGREIPRWVNRLAHVSSCIPFLRSLLPREWLMP 151          
BLAST of Deubiquitinase DESI2 vs. Ensembl Sea Lamprey
Match: desi2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:445138])

HSP 1 Score: 154.451 bits (389), Expect = 3.636e-46
Identity = 66/128 (51.56%), Postives = 91/128 (71.09%), Query Frame = 2
Query:  140 GFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            G GV+H+GVEVYG E+ YGGHP  FSG+F + P +   LGD + FK ++ +GTTDF E DV  I+  LG +F G  Y+L++KNCNHFS A  ++L  + +P+W+NRLA  SS IPF++  +P+EWL P
Sbjct:    9 GIGVFHSGVEVYGREFAYGGHPYPFSGVFEISPGDAGELGDAFRFKEAIVLGTTDFAEGDVESIVEELGREFRGDAYHLMRKNCNHFSSAVSEVLCGREIPRWVNRLAYVSSCIPFLQSCLPREWLTP 136          
BLAST of Deubiquitinase DESI2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010045.1 (pep scaffold:Pmarinus_7.0:GL488101:1344:7942:-1 gene:ENSPMAG00000009085.1 transcript:ENSPMAT00000010045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.416e-11
Identity = 42/121 (34.71%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  146 GVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLG-NQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIP 505
            G++HT V V+G EY YGG      GI   +P    +LG   + +    +G T  TE+   + L  LG + F G  Y+L K NCN FS    Q L  + +P  I  L +   + PF + I+P
Sbjct:    7 GIWHTAVVVFGQEYFYGG-----GGIECCQPGGT-VLGSPDSVE---ELGQTQVTEDIFLEYLSGLGEDAFNGERYHLFKHNCNTFSNEVAQFLTGRPIPAHITELPDEVLATPFGQMILP 118          
BLAST of Deubiquitinase DESI2 vs. Ensembl Nematostella
Match: EDO32262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVK1])

HSP 1 Score: 155.221 bits (391), Expect = 3.152e-46
Identity = 74/170 (43.53%), Postives = 104/170 (61.18%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQI-----------------------LLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            PVV++VYD++  NNY   +G GV+H+GV V+G EY YGGHP E+SGIF M PK  E+LG E+ F+ S+ +G TDF+  D+  I+  +G++F G  Y+L+ KNCNHF+  F Q+                       L  + +P W+NRLA   S  PF+ K +PKEW+RP
Sbjct:    5 PVVLNVYDMYWINNYTFNIGLGVFHSGVVVHGKEYAYGGHPYEWSGIFDMFPKCAEMLGPEFKFRESIVIGMTDFSSEDIDHIVNEMGSKFTGVSYHLVDKNCNHFTSEFTQVSIIHVNIVVLLSTPTPQPSLNWLLCGKAIPNWVNRLANAGSYFPFLLKCLPKEWIRP 174          
BLAST of Deubiquitinase DESI2 vs. Ensembl Medaka
Match: desi2 (desumoylating isopeptidase 2 [Source:NCBI gene;Acc:101155051])

HSP 1 Score: 166.007 bits (419), Expect = 1.591e-49
Identity = 69/147 (46.94%), Postives = 105/147 (71.43%), Query Frame = 2
Query:   83 PVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            P++++VYD++  N +   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P +   LG+ + FK ++ +G+TDFTE DV +I+  +G ++ G  Y+L+ KNCNHFS A  +IL  + +P+W+NRLA  SS +PF++  +PKEWL P
Sbjct:    8 PIILNVYDMYWINEFTSSLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPSDATELGETFKFKEAIVLGSTDFTEEDVERIVEEMGKEYKGNAYHLMHKNCNHFSSALSEILCGREIPRWVNRLAYFSSCVPFLQSCLPKEWLTP 154          
BLAST of Deubiquitinase DESI2 vs. Ensembl Medaka
Match: ENSORLT00000026921.1 (pep primary_assembly:ASM223467v1:22:1419712:1437507:1 gene:ENSORLG00000029340.1 transcript:ENSORLT00000026921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 1.716e-45
Identity = 79/178 (44.38%), Postives = 110/178 (61.80%), Query Frame = 2
Query:   11 KIFSINIID-KAMYSDSLFN--ACETSPVVVHVYDIFK----FNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
            KI SIN    + M    + N   C  + V +HV    K     N Y   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +GTTDF E D+ +I+  LG +F G  Y+L+ KNCNHFS +  ++L  + +P+W+NRLA  SS IPF++  +PKEWL P
Sbjct:   64 KILSINGTKLENMAHRQVVNIFRCAGNQVELHVLKRPKEDYWINEYTSNLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEINPGNAAELGETFKFKEAIVLGTTDFAEEDMDKIMGELGKEFKGNAYHLMHKNCNHFSSSLSELLCGREIPRWVNRLAYFSSCIPFLQSCLPKEWLTP 241          
BLAST of Deubiquitinase DESI2 vs. Ensembl Medaka
Match: ENSORLT00000035541.1 (pep primary_assembly:ASM223467v1:22:1419712:1432870:1 gene:ENSORLG00000029340.1 transcript:ENSORLT00000035541.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 9.205e-30
Identity = 53/131 (40.46%), Postives = 80/131 (61.07%), Query Frame = 2
Query:  116 FNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPK 508
             N Y   LG GV+H+G+E+YG E+ YGGHP  FSGIF + P N   LG+ + FK ++ +GTTDF E D+ +I+  LG +F G  Y+L+ KNCNHFS +  ++     +P+ + R     + +    + +PK
Sbjct:   82 INEYTSNLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEINPGNAAELGETFKFKEAIVLGTTDFAEEDMDKIMGELGKEFKGNAYHLMHKNCNHFSSSLSEV---SAVPRLLYRPERFLTGVRVSRQAVPK 209          
BLAST of Deubiquitinase DESI2 vs. Planmine SMEST
Match: SMESG000071271.1 (SMESG000071271.1)

HSP 1 Score: 439.499 bits (1129), Expect = 4.677e-157
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 2
Query:   44 MYSDSLFNACETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRPQDYMDDESDVNMMCAKSFYYPEQSGSSSEWIVIDPRKENENDASCCSHK 670
            MYSDSLFNACETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRPQDYMDDESDVNMMCAKSFYYPEQSGSSSEWIVIDPRKENENDASCCSHK
Sbjct:    1 MYSDSLFNACETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRPQDYMDDESDVNMMCAKSFYYPEQSGSSSEWIVIDPRKENENDASCCSHK 209          
BLAST of Deubiquitinase DESI2 vs. Planmine SMEST
Match: SMESG000037022.1 (SMESG000037022.1)

HSP 1 Score: 214.927 bits (546), Expect = 1.636e-67
Identity = 95/150 (63.33%), Postives = 118/150 (78.67%), Query Frame = 2
Query:   74 ETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCYGGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITLGNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIEKIIPKEWLRP 523
             +  V +HVYD+F FN Y + LG GVYH+GVE++GTEYCYGGHP ++SGIFPM PK+ + LG+ YTFK ++N+GTTDFT++D+RQ++  LG  F G  Y+LLKKNCNHFS  F++IL  Q LPKWINRLA  SS IPFIEK IPKEWL P
Sbjct:   30 RSESVKIHVYDMFWFNEYTNALGVGVYHSGVEIFGTEYCYGGHPFDYSGIFPMIPKDAQELGENYTFKTTINIGTTDFTDDDIRQLIEILGKDFKGEQYHLLKKNCNHFSSVFLEILCGQQLPKWINRLATISSHIPFIEKAIPKEWLTP 179          
The following BLAST results are available for this feature:
BLAST of Deubiquitinase DESI2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DESI29.259e-5050.00desumoylating isopeptidase 2 [Source:HGNC Symbol;A... [more]
DESI22.037e-3038.36desumoylating isopeptidase 2 [Source:HGNC Symbol;A... [more]
DESI24.378e-1850.75desumoylating isopeptidase 2 [Source:HGNC Symbol;A... [more]
DESI11.072e-830.00desumoylating isopeptidase 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F36D4.51.281e-4744.59pep chromosome:WBcel235:V:9419295:9423891:-1 gene:... [more]
F36D4.51.281e-4744.59pep chromosome:WBcel235:V:9419292:9421502:-1 gene:... [more]
F36D4.52.832e-4744.59pep chromosome:WBcel235:V:9419295:9425762:-1 gene:... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG72221.359e-5350.34gene:FBgn0033551 transcript:FBtr0345945[more]
CG72221.359e-5350.34gene:FBgn0033551 transcript:FBtr0088223[more]
CG122316.725e-3439.58gene:FBgn0031026 transcript:FBtr0074779[more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FP103009.11.311e-5144.32desumoylating isopeptidase 2-like [Source:NCBI gen... [more]
desi29.014e-5047.62desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
desi1a2.624e-831.40desumoylating isopeptidase 1a [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DESI23.061e-5250.34desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
ENSXETT00000040132.15.229e-5148.98desumoylating isopeptidase 2 like [Source:NCBI gen... [more]
DESI21.061e-4749.64desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
DESI22.356e-4751.11desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
ENSXETT00000012778.11.516e-2345.35desumoylating isopeptidase 2-like [Source:NCBI gen... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Desi25.354e-5050.00desumoylating isopeptidase 2 [Source:MGI Symbol;Ac... [more]
Desi25.354e-5050.00desumoylating isopeptidase 2 [Source:MGI Symbol;Ac... [more]
Desi23.629e-4650.37desumoylating isopeptidase 2 [Source:MGI Symbol;Ac... [more]
Desi23.629e-4650.37desumoylating isopeptidase 2 [Source:MGI Symbol;Ac... [more]
Desi21.975e-4550.38desumoylating isopeptidase 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PQ09|DESI2_XENLA3.360e-5047.62Deubiquitinase DESI2 OS=Xenopus laevis OX=8355 GN=... [more]
sp|Q5ZIV7|DESI2_CHICK1.035e-4950.00Deubiquitinase DESI2 OS=Gallus gallus OX=9031 GN=D... [more]
sp|Q9D291|DESI2_MOUSE3.745e-4950.00Deubiquitinase DESI2 OS=Mus musculus OX=10090 GN=D... [more]
sp|Q5R456|DESI2_PONAB4.446e-4950.00Deubiquitinase DESI2 OS=Pongo abelii OX=9601 GN=DE... [more]
sp|A3QRX8|DESI2_PIG4.446e-4950.00Deubiquitinase DESI2 OS=Sus scrofa OX=9823 GN=DESI... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UAE49.776e-5749.76PPPDE peptidase domain-containing protein OS=Echin... [more]
A0A158QDF34.665e-5659.62DUF862 domain-containing protein OS=Hymenolepis di... [more]
A0A564YBS81.714e-5559.62DUF862 domain-containing protein OS=Hymenolepis di... [more]
A0A1S3IZ854.305e-5556.85desumoylating isopeptidase 2 OS=Lingula unguis OX=... [more]
A0A2T7NW576.755e-5556.46DUF862 domain-containing protein OS=Pomacea canali... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000022166.22.687e-5148.32desumoylating isopeptidase 2-like [Source:NCBI gen... [more]
ENSAMXT00000047218.13.548e-5148.32desumoylating isopeptidase 2-like [Source:NCBI gen... [more]
desi24.044e-5048.30desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
desi24.044e-5048.30desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
desi24.044e-5048.30desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
desi29.820e-4747.41desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
desi23.636e-4651.56desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
ENSPMAT00000010045.11.416e-1134.71pep scaffold:Pmarinus_7.0:GL488101:1344:7942:-1 ge... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO322623.152e-4643.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
desi21.591e-4946.94desumoylating isopeptidase 2 [Source:NCBI gene;Acc... [more]
ENSORLT00000026921.11.716e-4544.38pep primary_assembly:ASM223467v1:22:1419712:143750... [more]
ENSORLT00000035541.19.205e-3040.46pep primary_assembly:ASM223467v1:22:1419712:143287... [more]
back to top
BLAST of Deubiquitinase DESI2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000071271.14.677e-157100.00SMESG000071271.1[more]
SMESG000037022.11.636e-6763.33SMESG000037022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015136 ID=SMED30015136|Name=Deubiquitinase DESI2|organism=Schmidtea mediterranea sexual|type=transcript|length=1071bp
GAAATAGTTCAAAATATTTTCAATAAATATCATTGATAAAGCAATGTATT
CTGATAGTCTGTTTAATGCATGCGAAACCAGTCCTGTTGTTGTTCATGTA
TATGACATTTTTAAATTTAACAACTATATTGATCGTCTAGGATTTGGGGT
GTATCACACAGGAGTTGAAGTTTACGGAACAGAATATTGCTATGGGGGAC
ATCCAAATGAATTTTCTGGAATTTTCCCAATGGAACCAAAAAATATGGAA
ATACTTGGCGATGAATATACATTTAAAGTATCATTAAATATGGGTACAAC
AGATTTCACGGAGAACGATGTGCGCCAGATTTTGATCACTCTTGGCAATC
AGTTCTGTGGATACGATTATAATTTATTGAAGAAAAATTGTAATCATTTC
AGCGGAGCTTTCATACAGATTCTGCTAAGCCAAACATTGCCTAAATGGAT
CAATCGGTTAGCAGAAACAAGTTCTTCAATACCATTCATTGAAAAAATTA
TCCCCAAAGAATGGTTACGTCCTCAGGATTATATGGATGATGAATCGGAT
GTTAATATGATGTGTGCCAAATCTTTCTATTATCCTGAACAATCGGGATC
GTCAAGTGAATGGATTGTCATAGATCCTCGCAAGGAAAATGAAAACGATG
CCTCTTGTTGCTCCCATAAATAACAATCACAGTCAGTATTTCGTAACCTG
CTAACAGAGACTAGTCATGATGACTTTATCACTTCTTCAGTTATCTGCAT
TCACAACTCTATTTCCGAGACCTGATTATGAATATATCCCGATAAAGATA
ATAATTATCATTATTATTTTTACTGATACTGGTACTGTTTTAATTTGTTT
TCTCTACAGAATATATCTTTTTCTATGGCAGCACTGTCTAAAAGTGCTCT
TTCGATTTACCTCATTATTTCTCTATCGAATAAATTTGTTAATTTCCCCT
TGTTGTAGATTAGATTGAATCGGAAATAGAAAGTTCGAGTAACATTTACT
GAATCTTATAAATAATCTAAAATACTGATTTCCTTAATCTTTTTATCTAT
GTATTTCCTTATGCGGTATTG
back to top

protein sequence of SMED30015136-orf-1

>SMED30015136-orf-1 ID=SMED30015136-orf-1|Name=SMED30015136-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MYSDSLFNACETSPVVVHVYDIFKFNNYIDRLGFGVYHTGVEVYGTEYCY
GGHPNEFSGIFPMEPKNMEILGDEYTFKVSLNMGTTDFTENDVRQILITL
GNQFCGYDYNLLKKNCNHFSGAFIQILLSQTLPKWINRLAETSSSIPFIE
KIIPKEWLRPQDYMDDESDVNMMCAKSFYYPEQSGSSSEWIVIDPRKENE
NDASCCSHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042266PPPDE_sf
IPR008580PPPDE_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008580PPPDE putative peptidase domainSMARTSM01179DUF862_2acoord: 13..158
e-value: 1.6E-40
score: 150.6
IPR008580PPPDE putative peptidase domainPFAMPF05903Peptidase_C97coord: 14..156
e-value: 2.7E-37
score: 127.9
IPR008580PPPDE putative peptidase domainPANTHERPTHR12378UNCHARACTERIZEDcoord: 11..162
IPR042266PPPDE putative peptidase domain superfamilyGENE3DG3DSA:3.90.1720.30coord: 8..168
e-value: 8.7E-35
score: 121.6
NoneNo IPR availablePANTHERPTHR12378:SF10IP06716Pcoord: 11..162
NoneNo IPR availablePROSITEPS51858PPPDEcoord: 13..157
score: 46.298