WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30015127
Length (bp)5779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30015127) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30015127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30015127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30015127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015127SMESG000064089.1 Contig1389newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015127SMESG000064089.1 Contig1389uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015127SMESG000023212.1 Contig1389newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015127SMESG000023212.1 Contig1389uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermal cellSMED30015127SMESG000064089.1 dd_Smed_v4_9023_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015127SMESG000064089.1 dd_Smed_v4_9023_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30015127SMESG000064089.1 dd_Smed_v4_9023_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30015127SMESG000064089.1 dd_Smed_v4_9023_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30015127SMESG000064089.1 dd_Smed_v4_9023_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 77.7962 bits (190), Expect = 2.501e-13
Identity = 155/790 (19.62%), Postives = 297/790 (37.59%), Query Frame = 3
Query: 1320 EQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHK---SGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSM-----------FNWLPLKMNNC--KVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLGTFYDE---SGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLH----IVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSII------TNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILG 3578
            EQ  T+F +EI+ L   I+E   L +     D  +  + Q   + L  HI + +     L+ H+   S  L   + + H  Y+ ++           +L  ++  +    EL  + L + I       L++   + Q +   +++L             + +H  S  + P+  L   P  GKT LMC L  A Q  +L    +  + + RLLG S  ++D   +L+S+C Q+     + L  P  ++     + Q      F  ++      N +      ++M             WLPL   NC  +V       +     L    +  LD  + + +  LS    + +I+  ++  R   +    ++L +++ +C   G +  +   AR W S +    L    E        RLE   G+ ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG +       G  L+   H         RYL   ++A  +  L  ++    +     L         L   PL+    +  Q ++F           +  N R++ +LP+HL+ S   + LK   + +  WI    I  G+  +++   L A      ++ P +          L+   LQ  C+    +  + R    T  + +       + +++        +W      P L+P    ++ P   + + +      +T +        L I T  G++ +WD  +  +  ++ G
Sbjct:  182 EQGATVFLREIQDLHKHILEDCALRMVDRLADGCLDADAQNLLSSLKSHITDMHP--GVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRELDTAGQEL--AWLYQEIRHH----LWQSSEVIQTFCGRQELLAR--------LGQQLRHDDSKQHTPL-VLFGPPGIGKTALMCKL--AEQMPRLLG--HKTVTVLRLLGTSQMSSDARGLLKSICFQVCLAYGLPLP-PAQVLDAHTRVVQF-----FHTLLHTVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPL---NCPPRVHLILSACSGALGVLDTLQRVLLDPEAYWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYR-----DWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLIT-----LPLVGKPLNLDRKVAPQPLWF---------SHTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCA----PHLDSPEV---------GLVREALQL-CRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTG 908          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 77.411 bits (189), Expect = 3.247e-13
Identity = 155/790 (19.62%), Postives = 297/790 (37.59%), Query Frame = 3
Query: 1320 EQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHK---SGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSM-----------FNWLPLKMNNC--KVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLGTFYDE---SGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLH----IVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSII------TNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILG 3578
            EQ  T+F +EI+ L   I+E   L +     D  +  + Q   + L  HI + +     L+ H+   S  L   + + H  Y+ ++           +L  ++  +    EL  + L + I       L++   + Q +   +++L             + +H  S  + P+  L   P  GKT LMC L  A Q  +L    +  + + RLLG S  ++D   +L+S+C Q+     + L  P  ++     + Q      F  ++      N +      ++M             WLPL   NC  +V       +     L    +  LD  + + +  LS    + +I+  ++  R   +    ++L +++ +C   G +  +   AR W S +    L    E        RLE   G+ ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG +       G  L+   H         RYL   ++A  +  L  ++    +     L         L   PL+    +  Q ++F           +  N R++ +LP+HL+ S   + LK   + +  WI    I  G+  +++   L A      ++ P +          L+   LQ  C+    +  + R    T  + +       + +++        +W      P L+P    ++ P   + + +      +T +        L I T  G++ +WD  +  +  ++ G
Sbjct:  182 EQGATVFLREIQDLHKHILEDCALRMVDRLADGCLDADAQNLLSSLKSHITDMHP--GVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRELDTAGQEL--AWLYQEIRHH----LWQSSEVIQTFCGRQELLAR--------LGQQLRHDDSKQHTPL-VLFGPPGIGKTALMCKL--AEQMPRLLG--HKTVTVLRLLGTSQMSSDARGLLKSICFQVCLAYGLPLP-PAQVLDAHTRVVQF-----FHTLLHTVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPL---NCPPRVHLILSACSGALGVLDTLQRVLLDPEAYWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYR-----DWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLIT-----LPLVGKPLNLDRKVAPQPLWF---------SHTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCA----PHLDSPEV---------GLVREALQL-CRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTG 908          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 77.411 bits (189), Expect = 3.247e-13
Identity = 155/790 (19.62%), Postives = 297/790 (37.59%), Query Frame = 3
Query: 1320 EQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHK---SGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSM-----------FNWLPLKMNNC--KVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLGTFYDE---SGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLH----IVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSII------TNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILG 3578
            EQ  T+F +EI+ L   I+E   L +     D  +  + Q   + L  HI + +     L+ H+   S  L   + + H  Y+ ++           +L  ++  +    EL  + L + I       L++   + Q +   +++L             + +H  S  + P+  L   P  GKT LMC L  A Q  +L    +  + + RLLG S  ++D   +L+S+C Q+     + L  P  ++     + Q      F  ++      N +      ++M             WLPL   NC  +V       +     L    +  LD  + + +  LS    + +I+  ++  R   +    ++L +++ +C   G +  +   AR W S +    L    E        RLE   G+ ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG +       G  L+   H         RYL   ++A  +  L  ++    +     L         L   PL+    +  Q ++F           +  N R++ +LP+HL+ S   + LK   + +  WI    I  G+  +++   L A      ++ P +          L+   LQ  C+    +  + R    T  + +       + +++        +W      P L+P    ++ P   + + +      +T +        L I T  G++ +WD  +  +  ++ G
Sbjct:  182 EQGATVFLREIQDLHKHILEDCALRMVDRLADGCLDADAQNLLSSLKSHITDMHP--GVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRELDTAGQEL--AWLYQEIRHH----LWQSSEVIQTFCGRQELLAR--------LGQQLRHDDSKQHTPL-VLFGPPGIGKTALMCKL--AEQMPRLLG--HKTVTVLRLLGTSQMSSDARGLLKSICFQVCLAYGLPLP-PAQVLDAHTRVVQF-----FHTLLHTVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPL---NCPPRVHLILSACSGALGVLDTLQRVLLDPEAYWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYR-----DWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLIT-----LPLVGKPLNLDRKVAPQPLWF---------SHTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCA----PHLDSPEV---------GLVREALQL-CRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTG 908          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 77.411 bits (189), Expect = 3.247e-13
Identity = 155/790 (19.62%), Postives = 297/790 (37.59%), Query Frame = 3
Query: 1320 EQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHK---SGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSM-----------FNWLPLKMNNC--KVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLGTFYDE---SGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLH----IVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSII------TNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILG 3578
            EQ  T+F +EI+ L   I+E   L +     D  +  + Q   + L  HI + +     L+ H+   S  L   + + H  Y+ ++           +L  ++  +    EL  + L + I       L++   + Q +   +++L             + +H  S  + P+  L   P  GKT LMC L  A Q  +L    +  + + RLLG S  ++D   +L+S+C Q+     + L  P  ++     + Q      F  ++      N +      ++M             WLPL   NC  +V       +     L    +  LD  + + +  LS    + +I+  ++  R   +    ++L +++ +C   G +  +   AR W S +    L    E        RLE   G+ ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG +       G  L+   H         RYL   ++A  +  L  ++    +     L         L   PL+    +  Q ++F           +  N R++ +LP+HL+ S   + LK   + +  WI    I  G+  +++   L A      ++ P +          L+   LQ  C+    +  + R    T  + +       + +++        +W      P L+P    ++ P   + + +      +T +        L I T  G++ +WD  +  +  ++ G
Sbjct:  182 EQGATVFLREIQDLHKHILEDCALRMVDRLADGCLDADAQNLLSSLKSHITDMHP--GVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRELDTAGQEL--AWLYQEIRHH----LWQSSEVIQTFCGRQELLAR--------LGQQLRHDDSKQHTPL-VLFGPPGIGKTALMCKL--AEQMPRLLG--HKTVTVLRLLGTSQMSSDARGLLKSICFQVCLAYGLPLP-PAQVLDAHTRVVQF-----FHTLLHTVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPL---NCPPRVHLILSACSGALGVLDTLQRVLLDPEAYWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYR-----DWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLIT-----LPLVGKPLNLDRKVAPQPLWF---------SHTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCA----PHLDSPEV---------GLVREALQL-CRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTG 908          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 77.0258 bits (188), Expect = 3.713e-13
Identity = 155/790 (19.62%), Postives = 297/790 (37.59%), Query Frame = 3
Query: 1320 EQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHK---SGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSM-----------FNWLPLKMNNC--KVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLGTFYDE---SGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLH----IVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSII------TNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILG 3578
            EQ  T+F +EI+ L   I+E   L +     D  +  + Q   + L  HI + +     L+ H+   S  L   + + H  Y+ ++           +L  ++  +    EL  + L + I       L++   + Q +   +++L             + +H  S  + P+  L   P  GKT LMC L  A Q  +L    +  + + RLLG S  ++D   +L+S+C Q+     + L  P  ++     + Q      F  ++      N +      ++M             WLPL   NC  +V       +     L    +  LD  + + +  LS    + +I+  ++  R   +    ++L +++ +C   G +  +   AR W S +    L    E        RLE   G+ ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG +       G  L+   H         RYL   ++A  +  L  ++    +     L         L   PL+    +  Q ++F           +  N R++ +LP+HL+ S   + LK   + +  WI    I  G+  +++   L A      ++ P +          L+   LQ  C+    +  + R    T  + +       + +++        +W      P L+P    ++ P   + + +      +T +        L I T  G++ +WD  +  +  ++ G
Sbjct:  182 EQGATVFLREIQDLHKHILEDCALRMVDRLADGCLDADAQNLLSSLKSHITDMHP--GVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRELDTAGQEL--AWLYQEIRHH----LWQSSEVIQTFCGRQELLAR--------LGQQLRHDDSKQHTPL-VLFGPPGIGKTALMCKL--AEQMPRLLG--HKTVTVLRLLGTSQMSSDARGLLKSICFQVCLAYGLPLP-PAQVLDAHTRVVQF-----FHTLLHTVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPL---NCPPRVHLILSACSGALGVLDTLQRVLLDPEAYWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYR-----DWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLIT-----LPLVGKPLNLDRKVAPQPLWF---------SHTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCA----PHLDSPEV---------GLVREALQL-CRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTG 908          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: T05C3.2 (pep chromosome:WBcel235:V:5493747:5503010:1 gene:WBGene00020254.1 transcript:T05C3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05C3.2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.452e-16
Identity = 123/618 (19.90%), Postives = 259/618 (41.91%), Query Frame = 3
Query: 1809 LSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLL--YETKVNLRIPEDIIGLKILLNQI--LLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMNNCKVIFS--TEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQK--FLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMN--NNYDRSVLFKSMD------------PDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLI----LSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSM-FSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSII 3572
            L N+ +  ++ G    GKT+LM  +  A +  +   +  + +V+ R LG S  ++++  +L SVC Q+   Y+  +    P ++  L     +I  L   +  ++I  D ++ +     D      W P  +     +F+  T   + IY  +   ++D    L +   P L       ++++++S      ++ Q   +   +++C    FV         W S S   +  L + L+ +I   F R E Q G+ ++   L YIS   +G+S  E+ D+++ DD +    F  +L          +S +R   ++L  +L     + G+ ++ W H  +   A+ RY    +   + H  ++ Y++       +   +  M              D  +P  P      ++F  ++  H      ++N R++ +LP+HL++S     L  +C+F++ ++   +  F +  +I   + A +    D+E    + L +    LS   L  NP   + ++L R+  +V  ++   ++        L K         + +P+ +C  +P   + FSL    F      L+  +  KL ++T   ++ +WD S   ++ ++
Sbjct:  453 LGNSTLPIILQGENGCGKTSLMAKI--ATKIREWYDNSCEPVVLLRFLGTSPDSSNIAPLLTSVCDQIASNYDESLKNSSPTELSKLFQHFKKITNLATREKPLVIIFDSLDLLSRI--DGAHELLWFPPSLPPFVKLFASLTPGGSLIYSKMQRLIEDKRQYLMV---PSLGKDLGFQVVREWLSDKGRTLSERQWNTVSKALDKCTLPLFVKLIYATVARWKSYSRPQETILFSSLQESINVLFHRTESQHGKLLVSHALSYISAARSGISDSEVEDLISLDDKVLDDIFQYHLPPVRRIPPLLWSRIR---SDLPGYLSERAAD-GVIVLNWYHQQFRQVAIERYFKNVNHLETCHSAMAEYFLGVWGGVPKPYQYTEMQKQRFGVTENEGLADRKVPKQP------NVFSSKDGNH------RYNTRKLNELPYHLLRSGRVDELLTLCLFDYEFLHAKVSSFPLQSLIADYEDAIQ-NVRDVEISRQLSLAVDALRLSASILSRNPSMLAFELLGRLLPLVATNKYVSKL--------LIKCDKEGPQHNSFVPAHHCFHAPGGPLKFSLEEHQFAVFGMQLT--SDRKLLVSTSTQII-VWDVSTGDIARVV 1035          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: CG10185 (gene:FBgn0038397 transcript:FBtr0083235)

HSP 1 Score: 90.1225 bits (222), Expect = 2.007e-17
Identity = 101/467 (21.63%), Postives = 204/467 (43.68%), Query Frame = 3
Query: 1812 SNNPISCLISGPINGKTNLMCHLISAFQYNKLEH--SINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-IPEDIIGLKILLNQILLMIDF--KVMIFLDGIENIKEYKNDSNSMFNWLPLKMN-NCKVIFS--TEKSAPIYQNLLNFMKDSLDMLSIY-SIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKT---IGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTI--QKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMN---------------NNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTL 3125
            S+ P+     G   GKT+L+   +S        H   IN    + R LG +  ++ +T  L S+C Q+ Y   +    IP+D++ L     Q+L        + I+LD ++ +   + DSN + +W+P ++  +CK+I S   E + P   +  + +   +D+   +  +  L      N+IK ++        + Q  ++ + I +C     +  V + +   R++T       L N +  +I+  F R+E Q G  ++   L YI+   +G+S  EL D+++ DD +    +  +L          ++ +R    +L ++L    +  G+ ++ W H  + + A  RY    + A  +H +++ YY+                  +   +  K    D  +P  PL      +F  ++ + +     ++N R+  +LP H ++S+ +K L    +FN+ W+   L
Sbjct:  381 SDKPLVLFGDGGC-GKTSLLSKSVSLVATEWFAHVRPIN----VIRFLGTTPDSSALTATLISICQQISYNYMLPFENIPDDLVPLTAHFKQLLTYASPTQPLTIYLDSVDQLTGTQ-DSNKV-SWIPTRLPPHCKIIISCANEPANPTVSHEYHVLCKMIDVEENFIEVTALGEDLAMNVIKMWMKTACRDLNNYQWRLVANAISKCSLPIFVKLVFAEICRWRSYTRPQET-HLANTVMDSIMLLFERVEKQHGRILVFHALAYITASKSGLSESELEDLISLDDKVLDDVYQYHLPPTRRIPPLLWTRIR---NDLPNYLSE-READGVNVMNWYHRQFRDTAKERYFKNMNMAIYFHSMIADYYLGIWGGGVPKPFKFTEIQRHRFGLADKEGSADRKVPIQPL------VFSSKDGLSK-----RYNLRKFGELPFHFVRSRRFKDLFEHVLFNYDWLHAKL 824          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-212k18.6 (si:ch211-212k18.6 [Source:ZFIN;Acc:ZDB-GENE-130530-938])

HSP 1 Score: 239.58 bits (610), Expect = 7.762e-63
Identity = 249/1093 (22.78%), Postives = 490/1093 (44.83%), Query Frame = 3
Query: 2103 VMIFLDGIENIKEYKNDSNSMFNWLP-LKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSS-----SVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVE---PGD-FSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQ--TGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIW--DNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIK---EVKILKRFNVFY-----DSYCLTVSSDKSLFTAFFYGIFWISTWSF-ETLDLVISRHLIID-TTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKH------------CSEMENIFDICEANELSRIFFASSK-SGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPN----------------PSVLSTSKSRLSXXXXXXXXXXXFISFGTANNTPVKQTSFLKASIHDLVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCK 5222
            + + LDG++N+ E   +  +  +WL  + + +  ++ S    A  +    +F++  + + S+ S+P L +  + + +   +S      T+ Q  +L  +   C +  ++  +   ++ W+S +     ++PK  N+L  N+L     LE ++G  ++RRL   IS   +G++  ELL ++  D  +++ + +L     PG  +S   ++ +  +   L  ++ T  +     +++W H+ +    + RY   +D   + H   + Y+ N +   S +F+           PL  ++++   GR       +   FN R++  LP+H + S     L   C+FN+ ++   L    + +V E +K A   + + ++   L ++L LS   L+++P Q + Q+L R+  I+ +D+   +G+ R++  L +L     +++ LP L+PS  C+  P   M +L+      VT L        L   +  G L +W  D     + ++    G  V     + + ++L + L D + V  +    +V+ +    V Y     D   +T + D  L   F+ G   +  ++   +  L+   +L ++   ++    I+ S    K   L A +   +AA+ + + G ++  L  ++    AI  V IS+ Y +L  R   P   +S I +I+ F  ES +  R I GC  D +S  ++ G GSH +          T++ IWN+ETE+HKH            CS++      C    L R++   S+ + +    N+        ++ VT ++N          +Y+   +     + I+N+ R +  G        +  ++DI L    K+ ILSD + S        V+Q + ++DL +     K   +FI PC ++++ +L  ++ +GLS+ R H++ W+L +G I+ RI+ +                PS   T      +      N         A     +Q  F +   +   ID  L+S D   ++ +YF+  L VFS+ ++ H+ TL   +SLL L  A++THNG +L+   +++      L+LW+ +
Sbjct:  760 LTLLLDGLDNLSE---EHEADLSWLSDILLPHVFIVVS----ASTHSKCAHFLQSQVKV-SVLSLPALHHEEITSALASRLSSDSRQLTENQWTLLSQSCLSCPSPLYLNLAYAESKQWSSFTPENNLNIPKDPNQLFINVL---VSLEREYGSCLVRRLALLISLSRSGIAEEELLVLLGCDGHVKREMASLHHQTLPGSKYSPVPYAFVAGLLYSLRDYM-TEVESDDTWVLRWTHMEFCCVVLQRYAPTEDSVKAVHADFADYF-NGSAPNSQVFQ-----------PLAWIRKE--RGR-------RCYVFNLRKLHCLPYHYIHSGQIIPLLTECLFNYEFLLHKLWGLSIYHVQEDLKAAVIVDKDLLDVAVLAQVLSLSHSVLLNDPCQLASQLLGRLEQIICQDKPVTSGDPRRFSFLHDLLAQCRSSS-LPVLVPSYTCLLPPGGLMHTLLSGHMSAVTALAYG--GRHLVSCSSDGKLNLWRLDEQMRPVGALPRAHGCAV-----DWAADSLTLCLDDTVLVLQMGYCLQVREVHSGKVLYVEESLDVPVVTSACDGRLLVIFYDGCHMVKVFNLVSSCSLLFCVNLTLEFEPIHKDQSIVVSRQPAKDYVLFAYRNGGEAAVFNAKCGVVSSTLK-AQHPAGAIQAVEISSQYLLLFCR--YPYKRQSEIIHIELFSAESFQYLRSILGCSQDYISQVTVAGGGSHIVAFCPAPHHGTTEIIIWNIETEDHKHIARFPGLMTHGECSDLRFCVGFCVGERLLRMWNLGSRINDQTLTYNVHKVHIDGTAEIVTMQKN---------PRYVVCRSTRPGTVRIWNVARVRLKGRPVQVEHGLFSSSDIALIRDLKIYILSDLTTSNFTD--AAVYQTLLVYDLLKKSYIKKQTGLFIVPCPQQDYHLLEGEILLGLSETRDHLILWDLDSGYIKGRIKTSYKESLLLSMDTDSHIMPSKEKTGLVMPWDRRTETQNAKRIRQEREAKRKKDEQKRFEREKFNS--IDQYLLSGDEQVVVCSYFAHHLNVFSVISEEHLHTLEDRWSLLSLRTAAITHNGEHLVVSNYSEAQHAPFLTLWDTQ 1795          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 75.0998 bits (183), Expect = 8.873e-13
Identity = 140/653 (21.44%), Postives = 269/653 (41.19%), Query Frame = 3
Query: 1809 LSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDII-----GLKILLNQILLMIDFK---VMIFLDGIENIKEYKNDSNSMFNWLP-LKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSS--SVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFD-DTIQKFLTNLVEPGD----FSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYY--YMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAE----AEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSIITN------NWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWD-NSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVW 3662
            +S+ P+  L+ GP   GKT L+C L    +        N  +V+ RLLG S  ++D+  +LR VC Q+     + L+ P   I     GL    + +L  +  +   +++ LD +E + E   +     +W+P +   N +++FST          L   ++     +I+ +  L+     ++I  Y+S      T EQ++ ++   EQ      +   L  A+ W+S +  S   L    E  +  +   LE   G+ ++   L +I     G+S  EL D+++ D D + +     + P      F  F +S LR    +L + L   + E+G+ L+ + H  +      RYL +  KA  +  L  Y+    +    R +L  S+   F+  N    +  Q ++F  E           N R+I +LP+HL  +  +  L+   + +  W+    ++ GV+ VI+ + L  +     E + ++  FL+    L F +   +P     +I +R+                  L + Y S+I        +W      P L+P  +   +P   + S +  F   V  ++       L   ++ G++ +W  N+   L ++       +   + ++++N L   L   +  W
Sbjct:  392 VSHGPL--LVHGPPGVGKTALLCKLAKEMRAV----VDNRGVVLLRLLGTSLLSSDVDSVLRGVCLQVC--GALGLQSPYSHIAYTHEGLVRFFHSMLEDVSKQGDTLLLILDSLEQLLE--TNKLHKLDWIPKIIPPNVQIVFSTSNECLDKCKSLVSAEE-----NIFKLELLTKDQGRDVIDAYMSAAERKLTAEQQDAILRYFEQSGNPLHLKLMLDTAKLWSSYTPMSSVHLDKSAEEVMTQFVESLEVNHGKKLVSHALSFILLSRYGLSEAELQDVLSLDNDVLAEIYKCWLPPSHTLMRFPRFHWSRLR---HDLSAHLTERW-EAGVLLLGFTHRQFAELVRRRYLSRDVKADMHTILAEYFSGQWSKGQLRPILLPSLSA-FL--NADRKVSPQPLWFSEELA---------NLRKIHELPYHLAHAGKWDELRQSVLGSLDWLCCKTLQCGVSCVIQDLTLCTDLTDCPEIQLLKETFLLLKPSLDFSDGRVDPSLLVTEIFARLQ----------------GLADHYPSMIGQLCSQCMDWFESYSDPLLVPKCSFFEAPGGPLKSTLRGFTKGVKAVVLCSKRKLLLAGSEDGLIIVWSLNNLQPLHTLSGHKAGVLSLKLTDKTNNCLSTGLDGTLRKW 997          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-161213-1])

HSP 1 Score: 66.6254 bits (161), Expect = 3.358e-10
Identity = 119/541 (22.00%), Postives = 216/541 (39.93%), Query Frame = 3
Query: 1839 SGPINGKTNLMCHLIS-AFQYNKLEHSI-NDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-----IPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSV--PKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFL---TNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYM--------------NNNYDRSVLFKSMDP-------------------DFILPNYPL----HIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFG-VNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIV 3299
             GP  GKT L+  +   A+ + + E     D +VI R +G +  +TD+  +L+S+C Q+     +N R     +P  I  ++ LL  +L    F   ++I LD +E + +   D      WLP+ +    +++ ST      I Q L   + D    + +    Q         +K  +   +   T  Q+  +   + +C    FV    R    W S   V    L + +  +I   F  +E++ G   + R LGYI+    G++ +EL DI++ D+++   +   +NL  P      S+  +  +  EL+ +L        + L+ W +   +  A   YL  ++     H L++ Y++              NN++    + +  +P                   D   P  P     ++++ DIFF              N R++ +L +HL +S     L    I NF W+  T+I+ G  +  +  + LA     E  E  FL   L      +  NP   S ++  R+  +V
Sbjct:  418 GGPCTGKTLLLAEVAKQAYSWIQKEMGPETDPVVIVRFIGSTDFSTDLRTLLQSICEQI----AINYRCLIHFLPNKIQEMRELLVNLLGESSFHRPLVIILDALEQLSD--ADEARKLWWLPVHLPRTVRIVVSTLPNKHGILQKLRCLIHDEEAYVELM---QRDRKACSQTLKQQLLGVKRKVTSGQQIYVNEAMAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGSRFVFRALGYITMARAGLTELELEDILSLDNSVLGDIMVSSNLKSP---LRISYDFIARLKEELEGYL-VERQVHNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCDNNHFASLNISQHRNPHNQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLEPDIFF-------------VNHRKMTELTYHLTRSGRTDDLMYGVIMNFSWLY-TMIKIGQFDKALSDIDLAYSYTQEK-ELKFLATTLRSIKLKVTKNPASLSAELQQRLLPVV 930          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000003639.1 (uncharacterized LOC101730828 [Source:NCBI gene;Acc:101730828])

HSP 1 Score: 245.358 bits (625), Expect = 5.994e-65
Identity = 302/1354 (22.30%), Postives = 561/1354 (41.43%), Query Frame = 3
Query: 1779 FLNETQHSISLSNNPISCLISGPINGKTNLMCHLIS-AFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFK-----VMIFLDGIENIKEYKNDSNSMFNWLPLKMNNCK---VIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSS------VPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLL-RCVCTELDSFLGTFYDESGIQ---LIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQT--GEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLDLVISRHLIIDTTV--------NNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKH------------CSEMENIFDICEANELSRIF-FASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRP-----NPSVLSTSKSRLSXXXXXXXXXXXFISFGTANNTPVKQTSFLKASI----------------HDL-----VIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASY-FEKNQGLFLWKINNRIHHKLENSE-ANCCAEEFQDYRLEFLQEDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQ 5630
            FL E Q  I+ +N  +  +     +GK++++  + + A Q+        D  V+ R +G + ++ +   +L S+C Q+     + +   ED+ GL   +N+   +++F      +M+ +DGI+ +  +++      +W+P  +       V  STE +   ++ L           +++ IP L +  + N+I+ ++       T  QK++L      C    +V+SS   +  WTS SS       P L +KL + +L    RLE   GE +++ +  YIS    GV++ ELLD+++ D  + +      E   +   + S+    +  +L + +GT   E       +I W H  +    ++RYL  K+   S H   + YY+ +        +   P+ +    PL      ++ G        +K  FN R+IL + HHL+ S  +  L   C+FN+ ++   +    V  + E +K A   E    +   L + L LS   L+ +P Q + Q+  R+  I   D+    G       + EL       N L  +  SK+                                      G L +WD S       + G+G  +  + +   +  + +      ++WD+   K++   N   D   LT + D  L  AFF G   +     +  DL  S  L+    +         N   ++S NS  +++ L A +   +A +++ R G I    L +++  +++  V ++  Y+++  R   P+     I +I+ F + +    R + GC  D +   ++N  GSH +  +    TN T++ +WNLETE+HKH            C ++      C+     R +   +  + +   +NI    +    + +   +N+         +Y    +    +I ++N+++ K  G        +V++ DI+L    KL IL+D+  +      + +FQ +  +D+ + +   K   ++I PC + E+ VL   L +GLS+NR H V WN+  G I+ R+RP     N + L        E              GT   TP ++ +  K +                 H L      ID  L+S+D   ++ +Y++  LCVFSL    H+ TL    S+L L  A+LT NG +L    + D    + ++LW+ +       L    NV  + L + A    +       L +W+   R H  +   E  N       D +L+ ++  S  +  +G    +WN+ D   + V  F PD  I   +L  +   I   +  +  + +LK+   ++
Sbjct:    6 FLQELQDCITSANKQLVVVHGESGSGKSSIIAKIATLASQWIG-----RDIRVVTRFIGRTGESRNPRMLLYSLCFQIAEIYNITMDFSEDLKGL---INEFSTLLEFANKCRPLMVAVDGIDELSVHEDS----LSWIPRVLPRHVYFIVCASTESACSSFRTLQKLTMQQ----NVHQIPPLDSEEIRNMIEVWMERDNRRLTGRQKKVLFDACAACPLPLYVVSSYMESCLWTSYSSESDSYLQPNL-HKLYSAVL---GRLEKSHGEQVMKMVASYISLSKNGVTLEELLDLLSLDLGVMQ------EVKQYQNITVSVFPEALWIKLQNDIGTHLVEQRTDNTYVINWAHALFRVVCINRYLKSKELQLSVHSAFANYYLESKS------RHNHPEKVSLMMPL------MWTGTH------RKPVFNLRKILGISHHLIHSNQFPRLITECLFNYEYLLHKVWATSVVGLQEDIKAAINPERPAPDLNLLSEALQLSTKVLLRDPTQLASQLKGRLHQIEMLDKPVAPGHTEAITAVAEL------QNGLQAVTASKD--------------------------------------GTLKVWDLSTGKFIYTLHGVGKNIDSITVCMQNQIVALTEDHSFQIWDLTSRKVIYCDNDTLDIPILTSAMDGQLLLAFFDGSHLV-----KVFDLADSCRLVCQVAIPADEAPVHKNHSILVSRNSVKEYV-LFAYRSGKEAMVLNARKG-IVVAKLTAQDPVASVQGVAVTNEYFLVICR--YPSLKMHDIVHIELFSVNTFAYIRTVKGCSNDFICQIAVNRQGSHVVAFSQIPNTNTTEIVLWNLETEDHKHIVTFPSIPRGGICCDLRYCLAFCDGENYLRSWNLVNRINDQTLSMNINRLKRTDGIQEIITMKNFP--------RYAICRSMKPGLITVWNIVKSKCKGSAVRVERGLVESTDIVLVRDMKLFILTDRGMASFTETPRPIFQTLLTYDMLKKKYVRKQSGLYIIPCPKHEYRVLDGGLLLGLSENRDHFVIWNMDTGFIKERLRPKYKERNATDLLPEPDGCKEKLNKEELHQQKKQKGTVLLTPWERRNETKTAKRRRLDVEMKQEVEKMQHLLNEKNNAIDQYLLSEDEKVIVCSYYAHHLCVFSLETMTHLSTLEDTESMLFLHSAALTSNGSFLALSNYCDAEKISYVTLWDLQRGRVKKRLKNEPNVCCMALTDEADRIVFGIALENKLKVWEPFRRKHKIIPGYENLNLSV----DSKLQVIEGGSKAILLSG-EVSMWNLDD--GTLVSVFTPDSKICCLSLAADRTTILIGMSDTPSLINLKIASRDR 1247          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: ppp1r3c.1 (protein phosphatase 1, regulatory (inhibitor) subunit 3C, gene 1 [Source:Xenbase;Acc:XB-GENE-969181])

HSP 1 Score: 95.9005 bits (237), Expect = 6.622e-19
Identity = 139/643 (21.62%), Postives = 267/643 (41.52%), Query Frame = 3
Query: 1725 YLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIG-----LKILLNQILLMIDFK----VMIFLDGIENIKEYKNDSNSMFNWLP--LKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIY-SIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKL----GNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGD-----FSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNN---NYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIE----IVKLAAEAEPEDIEYPFLIKLLILSFDNLI----DNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSIITNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWD 3542
            Y++ER   + +++P +++      H +S S             GKT LMC    AF+  K  ++    L++ RLLG S Q++++  +L+S+C QL     + L+ P   I           +Q+L  +  +    +++F D ++ +    ++     +WLP     N C V+     + P    +L  +KDS+     Y  +  LS      +I+  ++      T++Q+E+++ +  +C     +  +   A+ W+S + + +L      K   ++LY    LE   G+ ++   LGYI    +G+S  EL DI++ DD +   +     P       F    ++ LR    +L+ +L       G  ++   H  +   A   YL   +K+ + H  ++ Y+M        R +L   ++      N    +  Q ++F              N+R++ +LP+HL+ +     L+   + N  WI   ++  G+  VI+     VKL +  E         I LL  +   L      +P+    ++L+R+               Y  +DEL +      WL     PT IP+    + P   + + V  F   VT +   P    L + ++ G++ +W+
Sbjct:  317 YIQER---HSQVYPPLII------HGVSGS-------------GKTALMC---KAFEMLKQTNN-GSSLMVLRLLGTSPQSSEIHDVLKSICYQLC--IALELQPPSSQITNIYNETVRFFHQLLTTVSERKVENLVLFFDSLDQLS--PSEGAHRLHWLPKECPANVCIVV----STLPEEGGILKTLKDSVTDPECYIEVKPLSAEQGSQMIEMLMASAGRRLTNDQQEIVLGSFRKCGQPLLLKLAFDEAKRWSSYTPITELMIATSTKEAVSLLYQC--LEQLHGKLLVSHALGYIVASRSGLSEAELKDILSLDDEVLADIYQYWAPPSNDLIRFPTLPWTRLR---NDLEGYL-VERQADGSTVLGLYHRQFIEVARDTYLTNTEKS-NRHGTLADYFMGKWSMGTKRPILLPLINKSL---NADRKVASQPLWFSDNMP---------NRRKMSELPYHLLNAGCIDELQGEILGNMDWISSKIVSCGIQSVIKDFEMSVKLISSRE---------IMLLRDTLSTLCLPSNTDPVIVFTEMLARMHFF---------QLSYRLIDELCQQC--TGWLHQYPHPTFIPTCGFFQPPGGPLQTTVTGFKKGVTVMELCPDHDLLVVGSEDGIMIVWN 886          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: hsp90ab1 (heat shock protein 90kDa alpha family class B member 1 [Source:Xenbase;Acc:XB-GENE-495311])

HSP 1 Score: 78.5666 bits (192), Expect = 1.280e-13
Identity = 111/476 (23.32%), Postives = 198/476 (41.60%), Query Frame = 3
Query: 1839 SGPINGKTNLMCHLIS-AFQYNKLEHSIN-DYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRI-PEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSV--PKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYM--------------------------------NNNYDRSVLFKSMDPD--FILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFG 3137
             GP  GKT L+  +   A  + + E   + D +VI R LG +  ++ +  +L+S+C QL    +  L+  P+ I+ L  L   +L    F   ++I LDG+E + +  +D+  ++ WLP+ +    ++I ST      I Q L   + +    + +  IP+   +  + ++K  +   +   T  Q+  +     +C    FV  + R  R W S   V    L   +  NI   F  LE++ G   + R LGYI+  +TG+S VEL DI+  D+T+   + + ++P       + ++  +  +L  +L        + L+ W +      A   YL   D     H  ++ Y++                                N +Y+    F    P+  +     PL   + DIFF              N R++ +L HHL +S + + L      NF W+  T+I+ G
Sbjct:  415 GGPCTGKTLLLAEVAKKACSWLQEEMGPDSDPVVIVRFLGSTDMSSALNCLLQSICEQLAVNYRCLLQSRPKKILNLHELFLNLLNESSFHRPLVIILDGVEQLSD-SDDARKLW-WLPVHLPRTVRIIISTLPNKHGILQKLRCLIHNEDSYIEL--IPRDKKMCSQ-ILKHQLLRVKRKVTSGQQIYVNEAFSKCTLPMFVNLTFREVRNWRSHKDVDGSTLCVTVHRNIEQLFWSLENKCGPRFVSRALGYITMATTGLSEVELEDILALDNTVMSEVLSNMKPYIPLRIPYIMIAQLKEDLTGYL-VERQVRNVTLLVWANRHLQLVAQKFYLQNADDLQEMHSNMAEYFLGVWAGGIKKPFYNEPQYFENCIRKETRSILDENKHYNEQTSFDRQPPEQPWAFQCNPL---EPDIFF-------------VNHRKMTELLHHLTRSGMMEELMTGITMNFSWLY-TMIKIG 867          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 71.2478 bits (173), Expect = 1.531e-11
Identity = 104/475 (21.89%), Postives = 188/475 (39.58%), Query Frame = 3
Query: 1806 SLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDS-----------NSMFNWLPLKMN-NCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLG---TFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILP-NYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAA 3173
            S ++ P+  L   P  GKT+LMC L  A Q  +L    +  +V+ RLLG S  + D   +LRS+  Q+     + L  P  ++     +        F  ++      N +                 +   +WLPLK      +I ST     +  NL   +KD     + + +  LS    +  I+  ++  +   +  Q+++L +++ +C   G +  +   AR W S +    L    E        RLE+  G  ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG         G  L+   H   +     RYL   ++A  +  L  ++  +  + + +      P    P N    +  Q ++F           +  N R++ +LP HL+ +   + LK   + N  WI    I  G+  +++   + A
Sbjct:  332 SRTHTPL-VLFGPPGIGKTSLMCKL--AQQVPELLG--HKTVVVLRLLGTSKLSLDARSLLRSLSFQVCLAYGLPLP-PAQVLEAHSRVGHF-----FHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLPLKCPPRVHLILSTCSGQQVLHNLQQTLKDPS---TYWEVKALSGSQGQEFIQLLLAAEKRMLSPGQRDVLWASLPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYR-----DWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERAKRHGVLAEFF--SGAWSQGIKKLITLPLVGKPLNLDRKVAPQPLWF---------SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCA 776          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 71.2478 bits (173), Expect = 1.597e-11
Identity = 104/475 (21.89%), Postives = 188/475 (39.58%), Query Frame = 3
Query: 1806 SLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDS-----------NSMFNWLPLKMN-NCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLG---TFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILP-NYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAA 3173
            S ++ P+  L   P  GKT+LMC L  A Q  +L    +  +V+ RLLG S  + D   +LRS+  Q+     + L  P  ++     +        F  ++      N +                 +   +WLPLK      +I ST     +  NL   +KD     + + +  LS    +  I+  ++  +   +  Q+++L +++ +C   G +  +   AR W S +    L    E        RLE+  G  ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG         G  L+   H   +     RYL   ++A  +  L  ++  +  + + +      P    P N    +  Q ++F           +  N R++ +LP HL+ +   + LK   + N  WI    I  G+  +++   + A
Sbjct:  373 SRTHTPL-VLFGPPGIGKTSLMCKL--AQQVPELLG--HKTVVVLRLLGTSKLSLDARSLLRSLSFQVCLAYGLPLP-PAQVLEAHSRVGHF-----FHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLPLKCPPRVHLILSTCSGQQVLHNLQQTLKDPS---TYWEVKALSGSQGQEFIQLLLAAEKRMLSPGQRDVLWASLPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYR-----DWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERAKRHGVLAEFF--SGAWSQGIKKLITLPLVGKPLNLDRKVAPQPLWF---------SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCA 817          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 70.8626 bits (172), Expect = 1.741e-11
Identity = 104/475 (21.89%), Postives = 188/475 (39.58%), Query Frame = 3
Query: 1806 SLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDS-----------NSMFNWLPLKMN-NCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLG---TFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILP-NYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAA 3173
            S ++ P+  L   P  GKT+LMC L  A Q  +L    +  +V+ RLLG S  + D   +LRS+  Q+     + L  P  ++     +        F  ++      N +                 +   +WLPLK      +I ST     +  NL   +KD     + + +  LS    +  I+  ++  +   +  Q+++L +++ +C   G +  +   AR W S +    L    E        RLE+  G  ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG         G  L+   H   +     RYL   ++A  +  L  ++  +  + + +      P    P N    +  Q ++F           +  N R++ +LP HL+ +   + LK   + N  WI    I  G+  +++   + A
Sbjct:  332 SRTHTPL-VLFGPPGIGKTSLMCKL--AQQVPELLG--HKTVVVLRLLGTSKLSLDARSLLRSLSFQVCLAYGLPLP-PAQVLEAHSRVGHF-----FHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLPLKCPPRVHLILSTCSGQQVLHNLQQTLKDPS---TYWEVKALSGSQGQEFIQLLLAAEKRMLSPGQRDVLWASLPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYR-----DWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERAKRHGVLAEFF--SGAWSQGIKKLITLPLVGKPLNLDRKVAPQPLWF---------SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCA 776          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q149M9|NWD1_HUMAN (NACHT domain- and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 1.783e-12
Identity = 155/790 (19.62%), Postives = 297/790 (37.59%), Query Frame = 3
Query: 1320 EQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHK---SGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSM-----------FNWLPLKMNNC--KVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLGTFYDE---SGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLH----IVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSII------TNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILG 3578
            EQ  T+F +EI+ L   I+E   L +     D  +  + Q   + L  HI + +     L+ H+   S  L   + + H  Y+ ++           +L  ++  +    EL  + L + I       L++   + Q +   +++L             + +H  S  + P+  L   P  GKT LMC L  A Q  +L    +  + + RLLG S  ++D   +L+S+C Q+     + L  P  ++     + Q      F  ++      N +      ++M             WLPL   NC  +V       +     L    +  LD  + + +  LS    + +I+  ++  R   +    ++L +++ +C   G +  +   AR W S +    L    E        RLE   G+ ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG +       G  L+   H         RYL   ++A  +  L  ++    +     L         L   PL+    +  Q ++F           +  N R++ +LP+HL+ S   + LK   + +  WI    I  G+  +++   L A      ++ P +          L+   LQ  C+    +  + R    T  + +       + +++        +W      P L+P    ++ P   + + +      +T +        L I T  G++ +WD  +  +  ++ G
Sbjct:  182 EQGATVFLREIQDLHKHILEDCALRMVDRLADGCLDADAQNLLSSLKSHITDMHP--GVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRELDTAGQEL--AWLYQEIRHH----LWQSSEVIQTFCGRQELLAR--------LGQQLRHDDSKQHTPL-VLFGPPGIGKTALMCKL--AEQMPRLLG--HKTVTVLRLLGTSQMSSDARGLLKSICFQVCLAYGLPLP-PAQVLDAHTRVVQF-----FHTLLHTVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPL---NCPPRVHLILSACSGALGVLDTLQRVLLDPEAYWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYR-----DWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLIT-----LPLVGKPLNLDRKVAPQPLWF---------SHTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCA----PHLDSPEV---------GLVREALQL-CRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTG 908          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|A6H603|NWD1_MOUSE (NACHT domain- and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Nwd1 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.071e-10
Identity = 104/475 (21.89%), Postives = 188/475 (39.58%), Query Frame = 3
Query: 1806 SLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDS-----------NSMFNWLPLKMN-NCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLR---CVCTELDSFLG---TFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILP-NYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAA 3173
            S ++ P+  L   P  GKT+LMC L  A Q  +L    +  +V+ RLLG S  + D   +LRS+  Q+     + L  P  ++     +        F  ++      N +                 +   +WLPLK      +I ST     +  NL   +KD     + + +  LS    +  I+  ++  +   +  Q+++L +++ +C   G +  +   AR W S +    L    E        RLE+  G  ++  +LGYI     G+S  EL D+++ DD + + +       D++  S  LLR    +   L   LG         G  L+   H   +     RYL   ++A  +  L  ++  +  + + +      P    P N    +  Q ++F           +  N R++ +LP HL+ +   + LK   + N  WI    I  G+  +++   + A
Sbjct:  332 SRTHTPL-VLFGPPGIGKTSLMCKL--AQQVPELLG--HKTVVVLRLLGTSKLSLDARSLLRSLSFQVCLAYGLPLP-PAQVLEAHSRVGHF-----FHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLPLKCPPRVHLILSTCSGQQVLHNLQQTLKDPS---TYWEVKALSGSQGQEFIQLLLAAEKRMLSPGQRDVLWASLPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYR-----DWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERAKRHGVLAEFF--SGAWSQGIKKLITLPLVGKPLNLDRKVAPQPLWF---------SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCA 776          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: K1RYK2 (WD_REPEATS_REGION domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10026127 PE=4 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 4.665e-120
Identity = 429/1786 (24.02%), Postives = 793/1786 (44.40%), Query Frame = 3
Query:  567 IYVACSTFDMKNEISKLELNVWPHLRQLCLQYNRILVIHNLH-------NFSEELSSLGIQQYRKEIERSIEICSDQKSQHIKGLILFGDEYDEKDIPNYLLRDQIESIKSNMLPD----IEKIMNLQSNIQSLKQRQSQIKQQNFKRENTVENFRENSF--EDLNKSISKPTK---------ITEIDKINAEIINCTSEIETLNYVTNIKLIDQWYH-KANLTDNFYQLVSESEIIKDLKSPDFAKRKQARIIFKNIKTQLCAILSKYAANVLEQEQTL-------FEQEIK--LLTNIIMEKKCLLVSRTFTD---------------------KMMSEN----IQLQRNDLLKHINEENQI-RYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQI-LLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQL--LYETKVNLRIPEDIIGLKILLNQIL---LMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST--EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVP--KLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGR--EFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVRED--RQTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLD--LVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENIFDICEANELSRIFFASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKK--KSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRP----------NPSVLSTSKSRLSXX------XXXXXXXXXFISFGTANNTPVKQTSFLKASIHDLVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIH-HKLENSEANCCAEEFQDYRLEFLQEDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQAKI 5639
            ++  C   + + E S     V+P LR  C ++   L IH+LH            L S+ +   RK        C    S  I  L++ G++Y    +P+ +  D   SI    L +    ++K+    + I+S  Q + +  QQ       +E+ +++    +DLN  + + T          + ++ K   +II      E    + +  L+ QWY    N     Y+L + S +IK+    D   R+  RI++     +L  +L ++A   ++ EQ+         EQE+   LL N  + +  ++V+R  TD                     K +SE     +Q  + + +    + N I  +E+E  K G + PAQ R H  Y+D+++        K +L+ +K E        S  + E + + D    L++E++ Q   L + +  + +   E+L    +T  S   S   +  ++ G    GKT L C +    Q     H      VI R +G +  + ++  +LRSVC Q+  ++ +K    +P +  GL     Q L      D  V+IF D ++ + + +++ + M +WLP ++ +N K+I +T  E+    +  L+     + D+    +IP +     E+++K ++       T  Q +++I    +C    ++  +   +++W+S + +   KL   +       F +LE + GEP++RR LGYI+    G++ +E+ DI++ D+ +   +     P      S   +R +    D    T     G+    W H  ++ AA  RYL  +DKAPSYH++++ Y+      + V      P        L  V +  F+    E  H+ + +S +N R++ +LP+HL+ SQ   + K   + +F WI   L    +  ++E  +     EP D E   +  ++ LS   L  +P Q + QI+ R+  I+  D  R  G+  +Y  +  L K     + LP LIPS  C+  P   +F L+      +T +       K F  +    + +WD     +   I  +G  + ++ +  +   ++    ++I+VW+++  + + R + + D   + ++ +     A F G   + TW+       ++   H        +   +I+  S ++ I L A +  N A + ++RNG+   + L   +  SA+  +GIS +YYI+  R      +E  IY ++ FD++  K  R + GC+ D +    IN +GSHAI      +TN +D+++WN+ETE+HKH +       +    +      A      +   N+   +  +  +   +   Y +     N +Y      NN  + ++N+ R K  KS  +  R  ++ D++DI++    K+++L+DK  +    + + VFQ + I+DL + +   K K+ FI PC   E+V+L +++ +GLS+NRSH V WNL  GQ++ RIRP             V+S +K R              +          A +   ++   LK  I    ID  L+S D    + ++F+ F+CVF + N  H+ TL  + S+L L +ASLTH G YL+   +++    + ++LW+C        L    NV+A+ ++  A+     + N+ + +W+        K++N +      EF +    F+ ++ T          +W+I + GV  +  F PD  I    +  +  +I F L    +I  LKL+  +   I
Sbjct:  320 VHPPCVAENTEAERSTFIEKVYPELRTHCREHGFELQIHDLHWGLRDDSTDDHSLPSMCLNYLRK--------CQTSPSGGIV-LVVLGNKYGSYILPSVIPVDDFHSIHEQSLHEWKQKVDKMRKRIAEIESASQDRDKKIQQGLTEGQIMEDTKKDHLKTQDLNIKLEETTGKESLNMFRNLADMVKREQQIIKALKVKE--ETMPSPHLLSQWYKLDENCLPPVYRLQNISSVIKEYSRGDARTRESGRIMWNETVQKLRKLLDQFADLAIKDEQSRKNYFSSSLEQELDQCLLNNDDVTEDVIVVNRNITDLLSNLGDSTMADYADLSSTQDKTLSEPQTSYMQKLKTEFIPEKVDNNHILNHEIEWSKGG-VQPAQNRAHHLYLDRMS--------KQVLEVLKRE-------FSCHITEHVQQIDPTSKLYQEIS-QHVSLCQERGRHFQGRRELL----QTVKSYIRSKCRLPLILHGKAGCGKTALACKVALETQKWIKSH------VIIRTVGRTTASRNVRTLLRSVCLQMSHIFGSKTE-EVPMEFKGLVNDFAQRLGHASTADPLVLIF-DAVDQLSD-EHEGHKM-SWLPKELPHNVKMIITTNPEEQFESFPGLMKVYGSNKDI--TIAIPNMPQEDAESILKYWLQHDNRELTQHQFDVIIKAYNKCSLPLYLKLAFMESKSWSSFTEIENCKLSETITKLAALKFGKLESKHGEPLVRRALGYITASREGIASIEMEDILSLDEAVMDDVMANYRPSKRRCPSVLWIRLLEDLSDLLTPTLT--YGVITYVWAHSQFHQAADDRYLQNRDKAPSYHKVMAEYF------QGVWASKPKPCTGSEKGVLRYVSKQPFYYEPCENNHDGSDRS-YNVRKVNELPYHLLNSQQTAMYKSESLCHFEWIHAKLCGTSLRSLVEEYQTGLSVEPTDSELKMMSDVIQLSAKALSKDPRQLASQIVGRLATIIANDIPRAPGDPPRYPYIHALLKQAHEPS-LPALIPSIRCLTEPGGILFDLLSGHTDPITAVEVTSDGGKAFTASKDNTMKMWDLRTGKVMKTIHDVGTNITRIRVGYNVAFVITVEENVIQVWNLRYSERVLRVDKYPDPPVIGMAGEGKYLCALFDGNNTLRTWNLNKAGYPMISEAHTENHRVYKDNSALIAPFSFDERI-LHASRGANCALVNNVRNGK-QVLSLKCNDHSSAVISLGISRDYYIVACRQHYMQLHE--IYQLELFDLKRGKYLRSVRGCIHDKIKDLHINYIGSHAIAICASEETNTSDIAVWNIETEDHKHLARHAGASVLGACADFKYCLTAGRNDKTLNIWNLTGKINQSMPRLKKQSGVYQIMSMTKNPRYAVARQFNNGPVSVWNIARAKQLKSAVRIER--SLSDSSDIVVVRDTKVVVLTDKGIANAKDNARPVFQTVLIYDLLQKKFVKKIKKCFITPCPSHEYVMLKDEMLLGLSENRSHFVIWNLKNGQVEHRIRPMLKDLEKKIAETDVMSLAKDRCHTAKLTPWERRVESLSAKQRRRDAAVDIERQRVDELKKEISSSGIDRYLLSGDQKIAVASFFAHFMCVFDIENHTHMTTLESDTSMLSLLVASLTHTGNYLVQANYDEEQRTSYVTLWDCFEGVVKKRLKNESNVMALGISEDASKVIIGKGNKEIHIWEPQKTPSLRKIKNID----GLEFNELSKIFIVDNDTRAVVFAGDISVWDI-ERGV-VLAVFSPDTKITCCHVVNSGRVITFGLHDIPEIVILKLMSSDMPSI 2039          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: V3ZQU4 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236714 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 4.292e-118
Identity = 436/1825 (23.89%), Postives = 804/1825 (44.05%), Query Frame = 3
Query:  510 SGSISNEVLNKY------YNSRTIHIYVACSTFDMKNEISKLEL--NVWPHLRQLCLQYNRILVIHNLHNFSEELSSLGIQQYRKEIERSIEICSDQKSQHIKGLILFGDEYDEKDIPNYLLRDQIESI--KSNMLPDIE------KIMNLQSNIQSLKQRQSQIKQQNFKRENTVENFRENSFEDLNKSISKPTKITEIDKINAEIINCTSEIETLNYVTNIKLIDQWY-HKANLTDNFYQLVSESEIIKDLKSPDFAKRKQARIIFKNIKTQLCAILSKYAANVLEQEQ-------TLFEQEIKL-LTNIIMEKKCLLVSRTFT-------------------------DKMMSENIQLQRNDLLK-HINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELA--IQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVC---CQLLYETKVNLRIPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFSTEKSA-----PIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTS--SSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGD--FSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMD--PDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVRED--RQTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENIFDICEANELSRIFFASSKSG---KVFKLNIQSALQVAK-SKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKK--KSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPNPSVLSTSKSRLSXXXXXXXXXXXFISFGTANNTPVKQTSFLKASIHDLVIDS--------------------------------VLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQEDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQAKINQVK 5651
            SG++ N VL  Y        S+ I IYV CS F +  E+ +  L   V+P +R+ CL+        +LH +S +   +   +  K  ++ I  C    S  I  LIL G++Y    +P  + +D+ E I   +    D E      K++ + SN             Q+   +   E   EN+  +   +  KP        I  E I      E    + ++K ++QWY    N     Y+L + S   K++ + D AKR QAR  + ++  +L  IL +YA  VL+  +       +LFE E++  L        CLL+ RT                           DK   E I+  R  +L   + E  +  +++E +  G ++P   R H +Y+D++         K++LD +K       ++ +++  E     +Q+ L+EE++  + Q + + R     +   E+L    +T  +   S   +  ++ G    GK+ L+        Y   + +  D  VIYR +  +  +T++  +LRS+C   C++  +   +  IP D  G+       +     +  ++I LD ++ + +  +D   +  WLP  + ++  +I ST         PI +      ++ L  L I  +P+   +T+   +  +++ +    TDEQ E+L++  E+C T  ++  +   + +WTS  +  + KL   ++      F RLE   GE +++R LGYI+   +G++ +E+ D+++ DD +   +    +P       F +  L+    +LD +L     ++   L  W H+ +  AA  RYL Q+DKAPSYH+ ++ Y+     D+   +   D   D +L   PL       +F  E  +       +N R++ +LP+HL+ SQ   LLK   + NF WI   L    +  ++E  + A   + +D ++  L   L LS + L+  P Q + Q++ R+  I+ +D     G+ RKY  L  L      N+ LP LIPS  C+  P   +F L+      +T +       K   ++  G + +WD     +   I  +G++V ++ L  ++   + +  ++I++W I     +   + + D      +SD     A FYG   I TW   TL        I  + ++    I+++++      L A +  N A +I  R+ ++   L+ ++E  S+I  + I++ Y+++  R      +E  IY ++ FD +     R + GC  D +S   +N  GSHAI      + N +D+++WNLETE+HKH +    +  I    +  R    ++K     +++ L+ Q      K  K +   Q + +++Y    +Y+     N+  I ++N+ + K  ++  +  R   + + +D+++    +L+IL+D+ FS    D K VFQ + I++LK  R   K    +I P    E+V+L E+  +G SDNR+H V W+L  GQ+ +RIR +            E              G   N   K+ S L  +  DL  +S                                 +VS +   ++ ++F+  LCVF + ++ H   +  E S++ L +A+LT++G +L+H  +++    + ++LW+  +      L    +V ++ + + A      +    L +W   +    K     +     +F      F+ E+            +W+I +V V  V  F PD  I    L  +D+LI F L   +++  LKL+ + Q  +N+V+
Sbjct:  333 SGTMMNRVLQGYNYRRCHPESKMIQIYV-CSEF-VGTEVERTHLMEKVYPKIRRYCLEKGYDFRAIDLH-WSLQDDVIDDHRLPKLCQQVIGDCQSD-STAIDFLILCGEKYGTYVLPPEIPKDEFEEIYNTAKAFYDEEMQFIRDKLIAIDSN-------------QDVNLDAKTEASSENTNSETAATDDKPKIRGRKSVIRKETIRDLKARE--EALPDVKALEQWYILDENSVPPVYRLQNISSFYKEILNKDTAKRTQARQNYGSVMKKLLKILQEYAPKVLDDPEDRRKYFISLFEMELEHGLETDNSSPHCLLIQRTIRNVKNNLDDVTSAKYLDVTHPRSQQMDKSREERIEHLRETVLPMKVPESYRTEFKIEWYGGG-INPQTKREHSAYVDRMC--------KAVLDTLK------RDIGTALDDEGSMSNEQVKLYEEVSQHVAQCHHRSRNFHGRK---ELL----QTIKAYMRSPTKLPLVVHGKSGTGKSALLAKATKEI-YKWFKGT--DIRVIYRQIATTMASTNIRTLLRSICLQMCEIFDDNSCD--IPSDFKGIVNDFGYRMQQATKQKPLVIVLDALDMLSD-AHDGRKLI-WLPKDVPDHVHIIVSTLPDDKYLCYPILKKQYEGSENCL--LGISDMPENDAITI---LHHWLNSHNRALTDEQYEVLLNAFEKCPTPLYLKCAFNESLSWTSYTNPEMVKLSETVKKIATIKFGRLERDHGEALVKRALGYITASRSGITDLEMEDLLSMDDVVMDEVYAFHKPCSRRLPQFKWESLK---VDLDDYLLKRSADNTTTLC-WAHVDFCEAAQERYLNQRDKAPSYHKALAEYFRGIWVDKPKPYAGNDKGADRLLSPQPL-------YFEPENPNPSGSDRVYNLRKLNELPYHLLSSQQNSLLKSETLCNFEWILAKLCGTSLTALLEEYQFAHSVDEKDFDFKALSDALHLSSNALLCEPKQLASQLIGRLHGILSKDVPATAGDPRKYPFLHNLVAQA-ENSSLPALIPSHGCLTEPGGILFDLLSGHTEPITAVTLTNDGFKAVTSSKDGTMKLWDLRSGKVVKTIENVGHHVSRIRLAMNNTYAITSEDNVIKIWSITTGANIHTISEYVDPAVTITASDSCTLVACFYGSNMIRTWDLGTLTFT-GEERIPGSCIHKDRSILAADNSPTDKVLVAFRSANTALVIGARSKKVLQKLVCNEE-SSSIVALAITSEYFVVGCRQQYMKLHE--IYQLELFDAKKGYYIRSVRGCTHDQLSELHLNLHGSHAIAVCTSERNNTSDIALWNLETEDHKHLATHARLSTIGACCDF-RFCLTAAKDDNTLRIWNLSKQVNQHAPKLKKALGVGQIFPMKEYP---RYVVAKAVNHGPISVWNVAKAKCLQTAVRIER--GMTETSDVVIALNSQLVILTDRGFSNATDDSKPVFQTVLIYNLKTKRYERKLTSCYIVPAPSHEYVLLDENHLMGPSDNRTHFVVWSLQTGQVTYRIRTD----------FKEKVAKTKMAKGLALLGIGGNKK-KRASDLSMTPWDLRAESDADRERRHQKEKEQERNRLAELKKEKENSMEQFIVSGNQKKIVASFFAHHLCVFDIPSQTHTQVIENEHSMMFLHVAALTYDGDHLVHANYDEESKISYVTLWDLTTGEVKRRLKNESDVCSIGITDNANRVVIGKSPNELHIWDPMSPNSLKKIKGYSGL---KFSMGSKIFITEEGRRAIVLAGDISVWDIENVSVMAV--FTPDTKIMCCELAYHDSLITFGLYERSEVIILKLMCKGQP-VNKVE 2065          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A210Q3I7 (NACHT and WD repeat domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18745 PE=4 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 1.308e-115
Identity = 417/1789 (23.31%), Postives = 798/1789 (44.61%), Query Frame = 3
Query:  552 SRTIHIYVACSTFDMKNEISKLELNVWPHLRQLCLQYNRILVIHNLH-NFSEELSSLGIQQYRKEIERSIEICSDQKSQHIKGLILFGDEYDEKDIPNYL-------LRDQIESIKSNMLPDIEKIMNLQSNIQSLKQRQSQIKQQNFKRENTVENFRENSFEDLNKSISKPTKI----TEIDKINAEIINCTSEIETLNYVTNIKLIDQWYH-KANLTDNFYQLVSESEIIKDLKSPDFAKRKQARIIFKNIKTQLCAILSKYAANVLEQE-------QTLFEQEIK--LLTNIIMEKKCLLVSRTFTD-------------------------KMMSENIQ-LQRNDLLKHINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-IPEDIIGLKILLNQILLMI--DFKVMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIY-SIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVP--KLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGD--FSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVRED--RQTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPD-LIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSF--ETLDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENI--------FDIC-EANELSRIFFASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKK--KSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPNPSVLSTSKSRLSXXXXXXXXXXXFISFG-TANNTPVKQTSF-------------LKASIHDLVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAV-ILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQEDSTLLAFNGSS--------FQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKEN 5627
            S  + IY++    D   E +  E  V   LR+ C      L +++LH   ++ ++      Y      +I  C  + +  +  L+L GD+Y    +P+ +         D ++  +   +  I++ ++  S+ ++ ++RQ Q  +          + +E S       +S P K      ++ K  A+ +    E E +  +T+ +++ +WY    N     Y+L + S   K+    +  KR  A+  F  +  +L  +  ++A  V+           T+   EI+  +L     +  CL+V RT TD                         K  S  IQ L+   L   +   N + Y++E    G +     R+H  YI+++   +   L+K +   I F+E++                D+  LF+E++    + +ER   + +   E+L  +     S   S  P   ++ G    GKT L+C            H+++   V+ R++G++  +T++  +LR +C Q+      N+  +P D  GL       L +   +  ++I LD ++ + +  +       WLP ++  N  +I ST      Y+   N  K   +    Y  IP+L       +++ ++      +T EQ E L+   ++C    F+  + + A +WTS +++   K G+ ++    + F +LE + GEP++RR LGYI+    G++  E++DI++ DD +   + ++  P    F    +  LR    +L  ++     +S ++ ++W H  +  AA  RYLL +DKA SYH+ ++ Y++     +   F   D   +      H+  Q ++F  E   +      +N RR+ +LPHHL+ S   +L K   + NF W+   L    +  ++E  ++  + +P DI+   L   + LS   L ++P Q + Q++ R+  ++  D     G+  KY  L   Y    + + L +LIPS +C+  P   +F L+      +T +       K    +    + +W+     +   I G G  V + I+   +N LV  +   +I VW+I+  + +   + + D   L  + +     A F GI  + TW+   + + +V    +  ++   +   +I+S+S +  + L A +  N A + + R+G++   L  +++  SA++ +G++ +YYI+  R      +E  I+ ++ FD++     R + GC  D +++  +N +GSH I      +T+ +D++IWNLETE+HKH +    +        F  C  A +  +     + SGKV     QS  ++ K+  VT+     +     N +Y+     N+  I ++N++R K  ++  +  R   + +  D+++    +++ILSD+ FS      + VFQ + I+DL+E +   K    +I PC   E+V+L  +  +GLSDNRSH V W+L  G +  RI+PN  ++  S S         N+      +   A ++  KQ                LK    D  I+  ++S++ +  + +YF+  LCVF + N+ H+  +   FS+L L  A+LT +G +L+   +++    + +++W+C +      L    NV+A+ ILN+ + +     KN+ L +W          +   AN    + + Y       DS +   NG +          +W++ + GV  +  F PD  IN   + ++  LI F L    D+  L+L  ++
Sbjct:  380 STVVPIYISSGFTDTLAEKTAFEETVSLDLREYCAARGYELELYDLHWGMTDTVTD--DHSYPGTCLTTINRCL-ESNPGVNILLLLGDKYGPYLLPSNIPVEEFNAFYDFVQDFRQREIDLIKEQIDEISSARAERERQRQDAESVLTDATDHSSEKEGSTRPEGSGVSSPAKTRRQNADLAKAEAQTLKNLKEQEAI--LTDPEILKEWYSLDENCIPPVYKLDNISAHYKEFA--NAKKRDAAKNSFTEVTKKLRGVFDEFAPMVITDPFARKKYFSTMIGLEIEHGILETDASDNHCLVVQRTITDISRNLNDSAATDFVDVSKENPHALDKTQSSIIQDLKLETLPTKVGVANILPYDVEWAAGGVIIGGH-RSHQHYIERMCKQVTETLKKQL--CIYFDERKRKV------------DDKTKLFDEVSQHVAFCQER-TKHFQGRKELLQLVK----SYLRSKCPSPLVLYGKAGCGKTALLCKTAKETHKWFRGHNMS---VLLRVIGITTSSTNVRSLLRDLCLQMCQVFGTNVEDVPTDYKGLMNDFTHRLSLATPENPIVIILDSLDRLSD--DHEGRKLTWLPKELPKNAYIIVSTNPDDK-YECFDNLRKSIPETSEAYIEIPELPEQDAITILEHWLHKNDKTFTGEQFECLVDAFKKCPMPLFLKIAFQDALSWTSLTALDQIKFGDNVKKQASFKFGKLETKHGEPLVRRALGYITASRNGLTNNEMVDILSLDDAVMDDIMSIYHPPRRRFPTILWVRLR---DDLQEYITVIKSQS-MRTLQWAHAQFKEAAEERYLLARDKAASYHKAMAEYFLGKWATKKKPFPGNDKGMLR-----HVSSQPLYFEPEDSVKDGSDRVYNLRRVNELPHHLLNSSQTELYKSQGLCNFEWVLAKLCGTSLRALVEEYQIGLQVDPTDIDLKTLSDTIQLSATALTNDPRQLASQMIGRLHGMIARDIPATAGDPPKYPYLHSFYDQAKSPSLL-SLIPSISCLSEPGGILFDLLSGHSEPITAMTLTSEGLKALTASADNTIKLWNIRTGRVMKTIDGTGTNV-RSIIPALNNALVATVEGSVIRVWNIRFSECVLTIDHYLDPPVLGTAGEGKYLVALFDGINIMRTWNLKRQIMPMVCEARIEDNSVYTDNSLLIASSSFDDKV-LHAFRGANMATVQNARSGKVIHTLKCNEKSSSAVS-LGVTRDYYIVACRQQYMTLHE--IHQLELFDLKKGHYLRSVRGCTQDHMTSLHLNYMGSHVIAICSSEKTSTSDIAIWNLETEDHKHLARHAGVSLMGACVDFKYCLTAAKGDKTLRIWNLSGKVN----QSMPKLKKTLGVTQ-----IIPMVNNPRYVVARQMNSGPISVWNVVRAKILQNAVRIER--GLSETADVVIVRNTRVVILSDRGFSSASDSSRPVFQTVLIYDLREKKYLKKLTGCYITPCPAHEYVMLDNENLLGLSDNRSHFVVWSLVNGHVVRRIKPNREIVQKSPSSTDRVLSIRNSTEVMTPWDRRAESSSAKQRRREDELDQERKRHEELKKE-KDNGIEQYIISENQNIAVASYFAHHLCVFDIVNEKHLHIIETPFSMLFLHSAALTPDGIFLVLPNYDEETKTSYVTMWDCTTGQIKKRLKNESNVMALAILNDGSRVIIGRGKNE-LHIW----------DPMSANGL-RKIKGYPGLQFNADSQIFVTNGGTQAVVIAGDISVWDL-ERGV-VLAVFTPDMKINCCKVAMDGQLITFGLHDIPDVVVLRLANKD 2094          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8HP73 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 9.270e-111
Identity = 481/1985 (24.23%), Postives = 854/1985 (43.02%), Query Frame = 3
Query:  120 HYDHWVKYDGKKTYSVLPEQGIKAHLQRLRFQRSVTQLKLKRKKEKTIFLKKRSTFL------------NKSASKNGNGIFDFTDLYNDSIETGSTWWRITPLPDIVKQTETDTEKETVDFVQQPFIEASSIKTRIEALKHFSGSISNEV---LNKYYNSRTIHIYVACSTFDMKNEISKLELNVWPHLRQLCLQYNRILVIHNLHNFSEELSSLGIQQYRKEIERSIEICSDQKSQ------HIKGLILFGDEYDEKDIPNYLLRDQIESIKSNMLPDIEKIMNLQSNIQ-SLKQRQSQIKQQNFKR----------------ENTVENFRENSFEDLNKSISKPTKITEIDKINAEIINCTSEIETLNYVTNIKLIDQWYHKANLTDNFYQL-VSESEIIKDLKS-----PDF-AKRKQARIIFKNIKTQLCAILSKYAANVL------EQEQTL--------FEQEIK--LLTNIIMEKKCLLVSRTFTD---------KMMSENIQLQRNDL-LKHINEENQIRYELEL-------HKS-------GKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMI-----DFKVMIFLDGIENI-KEYKNDSNSMFNWLPLKMNN-CKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTV---ENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVIS-SLRIARAWTSSSSVPKLGNK-LETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRC---VCTELDSFLGTFYDESGIQ---LIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMN---NNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDR--QTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDS-VSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENIFDICEANELSRIFFASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPNPSVLSTSKSRLSXXXXXXXXXXXFISFGTANNTPVKQTSFL------------------------KASIHDL------VIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQ--EDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQAKINQV 5648
            HY HW  +   +      +Q + +H++R    R    L  +   E       RST L            N + S  G    DF     +S    +    +   P   ++ ++  +KE + FV   F  AS ++   E L   S S++           +++T+ +YV  S  D   E + +  ++ PHLR     +     + + H         G + +  +    ++IC +  ++       +  +IL GD++ +   P  + R + E I+       +K+  L+   Q  L++ +++ K Q  KR                 +T  N R  S      S+ KP     +  + A+ +     I       NI+ I+ +    N  D +Y L  S   ++  L       P+F A R Q +  ++    QL A L+  +  ++      E E T+         EQE++  +L +       L+  RTF +           +  +I+  R+++ L+  +    ++ +LEL       H++       G ++P + R H +++ ++   I  +LE  I       E+  +E  S  L+ TI E +   L        +         + +  +M  +LN        S++ I  ++ GP   GKT LM    S  +    E S      + R++GVS ++ ++  +L S+C +LL + K     P+D  G   L+N+    +     D  ++I LD +  + +EY+       +WLP  +    KVI ST     +   +L  +K      S     ++  LTV   E ++  +++      T  Q E ++S    C  +   +  S   +  W  S    +   K L+ ++ +Y +RLE  FG+ +++R LGY++    G++  ELLDI++ DD +   L       +F  F   + RC       L + LG F  E  +     I W    +N AA  RYL QK+K P  H+ ++ Y+      N  +  L      +  + + P +  +Q+      F+         N R++ +LP HL +SQ ++ LK  C+ NF +I   ++   V +V+++ +    AEP D +   +   L LS   L  +P Q + Q+L R+TD+++ DR     + +KY  +  L+     NN +PTL+PSK+CM +P   +  L+      +T +  +   T  F ++    + +WD + + + S I G G+ V  M L    + L+ +    ++V+ +K   +L    V  D   + V+ D +    F  GI  + TW+ E L  V  + L  +T ++    ++ S  CN  + L  ++  N A ++  R+G+ + + L   +K S +T V  S  YYI+  +  +  +    +++++ FD    K+ RRI GC  DS V    +  +  H I+ N     NMTD+  WNLETEEHKH +    I  I    +  R+   S     +   N+Q  +Q A  KT +      +     N++Y      +NSVI  +++   K SG       +I   ND++L  +  +I+L+   FSP VP+ K V+Q + IFD+++ +       V I PC  +E+ V+  +  + +++  ++ + ++L +G+I  RI+P  S    +K R S     +  +     F    N+  KQT F+                        K    +L       I   L+SKD ST++ ++F+  +CVF+L+N      L    +LL L  ASL+ NG YL H  +N+    + L LW+C++  ++        V AV +N+ A++  Y   ++G    +   R   K+  ++ + C    Q     F+Q   D         S  +WN+    +  +    PDQ ++S  L LND LI F  K SND   LK+L  N  +  +V
Sbjct:   48 HYGHWKLFRQSRAMGTERQQLVISHMKRGLRHR----LDRRPADEHESLESDRSTGLFQRYSQYGVQRSNSTLSTAGVIPVDFLHPETESTPPAAGPATLAADPQQDEKVKSLLDKE-LTFVNT-FAVASELE---EVLSRQSSSMTALPPIGARTRDDAKTLLLYVTSSLGDFDAERAAMAEHLVPHLRDTARSFGLDFRLIDPH--------FGCRFHACDNHEDMKICQEALAKTKLYKDRLNHVILLGDKFGKPSSPPTIDRAEFELIRGEYNSAYQKLQQLRVERQKELEEMETERKVQEEKRNRAGADDDDTDDDFEDASTRRNNRRTSVNRRRSSV-KPKPKASLTSV-AKTVGRAMLIRKSQLEDNIRSIEPYLPSENFLDTWYYLDSSRVPVVYRLAQVSSVLPEFSAYRMQVQDQWQRTDQQLLATLTFCSRRLVKNDVMPESESTILALNKTSVLEQELRQTVLRSRGSHSDTLMFVRTFDNLKDQVGQPLAALYTDIEPGRDEVDLEAAHAFVTVKRDLELMVPEDIIHRAQISWIPEGGVNPERSRIHENHVKKICAQIIRVLEPQIRQIGLDLERHQTEQQS--LMHTIQENENYCLQHAAECYGR---------KTMLAKMKAYLN--------SDSMIPMVVHGPSGSGKTTLMAKCFSKLKDWLPESST----CVVRVVGVSSRSGNVRYLLGSICRELLLKWKEQGDPPQDFAG---LVNEFTARLQQASRDRPLVILLDSLGQLTEEYQ---GRRCHWLPKVLPKYVKVIASTVGDERV--GVLGQLKSMYSDASPDHFMEMEQLTVEEAEKILSSWLAKEGKTLTTPQLEHVLSAF-NCVPLPLQLRLSFHESLNWPPSFLPREFAAKTLKQSVTFYLSRLESGFGDLLVKRALGYLTAAKNGLTEAELLDILSLDDHVMDVL-------NFQ-FHLPVRRCPPIAWLRLRNALGEFLTEKSVDNCVTIVWAFNMFNEAAAERYLNQKEK-PVLHKALAEYFDGMWAGNKRKPHLGNEAGSNRFVSSQPYYFERQE---PPGFV--------CNDRKLAELPWHLRESQQFESLKQKCLCNFDFILAKMLASSVRHVLDLYESVLSAEPRDKDLRLISNSLYLSRAELELDPKQLASQLLGRITDVLKADRPKAPADPKKYPFVHALFYRARRNN-VPTLVPSKSCMTTPSEIVLDLLQGHRLPITAVCISEDGTTGFTSSQEDTIKVWDLTNSRVVSTIEGSGSQVLSMTLGRQESVLITSELTCVKVYAVKIGCLLFTIPVQDDPCSVVVNGDTNNLVCFHQGICVMRTWNLERLTKVCDKTL-TETGLHQDRTVVVSTRCNADLVLYGLRGSNFARVVHCRSGQ-DVLKLSCLDKASLVTAVQTSREYYIVACQA-TDLHTRVHMFFLELFDTGKGKSVRRIKGCSSDSVVDELMLTNIQQHVISLNPMRDKNMTDIVAWNLETEEHKHFTRHPGISSIGAVYDFRRVITGSLAENALRMWNVQQNMQSAPQKTESLVNLADIVIDAGNNRYALTKLSDNSVIHAWSLSANKFSGKVVKSAKSIAGPNDMVLMDRHFVIVLARPGFSPKVPNAKFVYQTLTIFDIQKQKFTVNLNNVLIVPCAYEEYHVIHGNQLLCINEFHTNFLVYSLESGEIIRRIKPEFS-FDPNKKRPSALLEGSVLQRENEMFEEFINS-RKQTVFMTPWERRNESKSAKTRRYRSEWEEKKQRADELEQEKGNGIADFLISKDQSTVVSSFFAHHICVFNLSNGTQQSVLEHPNALLHLFTASLSPNGRYLAHTIYNEQQEMSQLCLWDCRT-GKVKKSFNEGGVGAVAVNSDASILVY-GTDRGELQVRDCRRSPAKVRVAKTSACVNFQQSSHRNFIQLFRDDKWALIYARSLSVWNM--QSLEMLSILTPDQPLHSIRLALNDQLIVFSSKDSNDPIILKMLSANSKRPQRV 1951          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: R7TMM5 (WD_REPEATS_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_208371 PE=4 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 4.427e-110
Identity = 344/1456 (23.63%), Postives = 667/1456 (45.81%), Query Frame = 3
Query: 1413 DKMMSENIQ-LQRNDLLKHINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKER--KVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQL--LYETKVNLRIPEDIIGLKILLNQI--LLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMNN-CKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSS--SSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRK--YLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFET-------LDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENIFDICEANELSRIFFASSK--SGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPN-------PSVLSTSKSRLSXXXXXXXXXXXFISFGTANNTPVKQTSFLKASIHDL------VIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYR---------LEFLQEDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQAKINQV 5648
            DK + +++  L+  +L K ++  N  RY +    +G + P+ +R H  Y D+   +   IL  ++      E+K                  ++ L  E+     + + R  K+L  +        L + +  I L N     LI G    G T++M     +F       S      + R++GV+ ++ +   +LRS+C Q+  +++   N R+P D+ GL  +   +      D +V+IF+D +  + +          WLP  +     ++ S++ +      +  F +   D + +  +  L N+    ++  ++   +   T  Q+E++++    C+T  F+   +  + +W+SS   S  K+GN ++        RLE ++GE   RR LGYI+    G+ I+EL D+++ D++    +      G        LLR   + +        D  G   + W+H      AV RY+  +DKAPSYH+ ++ Y++N  +D+   F   +           +V Q +F  +     +   + +N R++ +LP+HL++SQ + +LK  C+ NF ++   +   G+  V++ ++LA   EP D++   L   L LS   L  +P Q + QI+ R+  I+R D+         Y  L   Y   + N+  P+L+PS  C+  P S ++ L+      +T ++ +    K+F T+    L +W+     +   I+G+G +V  + L      ++ +  + I VWD+++ + + + +   D   +  +   S+   FF+G   + +W  ++       LD  +         ++     + + + N    L A K  N A + ++++GE+  +   + +K S+I  +  S  +YI C+  F   N  +  + I+ FD  + +  R ++GC LD  S   +N VGSH I  +  +    +D++ WN+ETEEHKH ++   +       +L  I  AS    S +++ L+ +      + K +   +  TL     N +Y+   + NN  + ++N+ +K  SG   +    +V+ +DI+L   +KL+IL++K  S +      VF+ I ++D+ E +   +    +++P    E+V+L ++  +GLS+NR+H+V W+L+ G I  RI+PN       P     +             +    S         K+    KA I  +       I+  ++SKD ST++ +Y++  LCVF + ++ H  TL  + S+L L +++LT+NG +L+H  ++D    + ++LW+C S      L    NV A+ +++ A    + +++Q L +W          E  E N    + + Y          +  +   S  + F G    +W++ + GV  +  F PD  I + ++ ++  LI F LK +N + +LK++      I ++
Sbjct:  605 DKGLQKSLANLRMAELTKKLSFRNIRRYTVAWAPTG-IDPSTIRAHGVYCDRFVKDFYEILVANLSTFFAGEQKSKPR-----------NESKLQLINEIKYHIAFCQARASKMLGRKPI------LQKIRDHI-LKNCKFPLLIHGQAGCGLTSIMAKAAVSFAPRDPSCS-----TLIRMIGVTGESFNARTLLRSLCLQMSHIFDQNPN-RVPHDMKGLSNIFEFLCGFAHEDQEVVIFIDSLHKLSD--EHEGKKLAWLPRNLPEYVHMVLSSQSAGQGSDCVKAFTQAYGDEM-LLEVQALENIEASVMLAHWLEDAKRRLTMPQREVIMAAFAACQTPVFLRVLVNESFSWSSSYDPSGLKIGNAVKNVATVMMGRLEKEYGEAFTRRTLGYITASRKGLMIMELEDLISLDESAMDEIVAQNRIGIRRIPPVLLLRLYYSIMPHIQEVNAD--GHVTLMWKHSQVAEVAVERYMNARDKAPSYHKAMAEYFLNTWHDKLKPFSGNEK-----GSHRFVVAQPLFRTKTNPAGEVLGTTYNLRKLYELPYHLIKSQQHDVLKKSCLCNFEFVLAKISASGIQAVVDDLQLALSVEPADMDLKLLSDTLHLSSTALSKDPRQLASQIVGRLDTIIRMDKPVAPSDPVVYPALKSFYAQALRNS-TPSLLPSAACLSQPGSILYDLLSGHTDGITAVVVSSNGQKVFTTSLDDTLKVWELRSGRVIKTIVGVGKHVLHIRLGLKATLVITSEINAIRVWDVEKGECVYQIDS-DDPATVGTACGGSILVTFFHGCSRMKSWQLDSDFKELVDLDFELENPEEPAQGIHKDNSTLLAGNSNGDKVLHAFKDANYAMVRNVKSGEM--IYKLNCKKASSIQALASSREHYI-CAVRFR-FNISTETHQIEVFDNTNGQPYRVLAGCTLDHFSEIFVNNVGSHIIAISYSVSNQSSDIAGWNIETEEHKHLAKHAKVSKFGSCVDLRYILTASEAEPSLRIWNLSAKINQPCPREKPINGVE--TLVPMVDNPRYLVAKSFNNDPLTVWNITKKGFSGSAVYTERGLVEMSDIVLVRNNKLVILAEKGPSNVSKQGH-VFKTIHVYDMVEKKYIQRLSGCYVFPSPMHEYVILHDEQLMGLSENRTHLVIWSLTTGHITHRIKPNFKADYVLPDKEPNNFRTRGTTAEMTPWQRRSESASARKRRHQKEIEDEKAKIEAMKKEKENSIEQYIISKDYSTIVTSYYAHHLCVFDIQSQTHTQTLESQTSMLFLHVSALTNNGSHLVHTNYDDESKASYVTLWDCGSGLIRKRLRNEKNVQAIAISDNAQRVVFGKRSQELRIW----------EPFEPNSL-RKIKGYPSLNFGIGSVIHIVDNGSKAIVFAG-DISLWDLAN-GV-VLAVFTPDMRIQTLSVVMDGRLIVFGLKDTNKLVTLKMVYPGAPPIEKL 2002          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-212k18.6 (si:ch211-212k18.6 [Source:ZFIN;Acc:ZDB-GENE-130530-938])

HSP 1 Score: 223.016 bits (567), Expect = 7.356e-58
Identity = 387/1781 (21.73%), Postives = 724/1781 (40.65%), Query Frame = 3
Query:  555 RTIHIYVACSTFDMKNEISKLELNVWPHLRQLCLQYNRILVIHNLHNFSEELSSLGIQQYRKEIERSIEICSDQKSQHIKGLILF---GDEYDEKDIPNYLLRDQIESIKSNMLPDIEKIMNLQSNIQSLKQRQSQIKQQNFKRENTVENFRENSF--EDLNKSISKPTKITEIDKINAEIINCTSEIET--LNYVTNIKLIDQWYH-KANLTDNFYQLVSESEIIKDLKSPDFAKRKQARIIFKNIKTQLCAILSKYAANVLEQEQTL-------FEQEIKLLTNIIMEKKCLLVSRTFTD---KMMSENIQLQRNDLLKHINEENQIRYELELHKSGK--------------------------LSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENI-KEYKNDSNSMFNWLPLKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLG---TFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSK-FNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPED-IEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTG-EVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSP-------ISSMFSLVGFFFGN---VTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLDLVISRHLIIDTTVNNKGE--------IISSNSCNK--FIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYIL-CSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKH-----------CSEMENIFDICEANELSRIF-FASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRP--NPSVLSTSKSRLSXXXXXXXXXXXFI---SFGTANNTPVKQTSF------------LKASIHDLVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQIS-HLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQEDSTLLAFNGSS-------FQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDN 5564
            R   IY+ C  +    E S L   V+P L   C Q      + +L     +     I  +    E  IE+   +K Q  +G   F   G +++ + +P  + +   E+I   +  D +K        QS  +R+S++     K ++++    + SF  E       + T  + +   N++ ++  S+ E    +   ++ L+  WY    N     Y+L+  + +  D  S D  +RK A+  +++    +  +L       + +  T        +E E  L   +  E+      R  TD    + SE  Q Q  DL K   E NQ      LH+S +                          LSP   R+H  Y +++  + Q I+  + L+ +K  ++               E  +  L EE+   Q +L+  K      F +  L   +    IS S+     L+  P +GK+ LM  ++       L   I+   V+   +G++  + ++  +L+ +C Q+      +  I E I  L  LL  +L+  D  + + LDG++ + +E++ D + ++   P    +  ++ S  KS           K SL  L   S  +++      L  D        W      +L+     C    ++ ++  ++ +W+S +   +  L  +L++     FA LE + GE ++RR    +     GV+  ELL ++  D+ + + +  L      +    S+   +   L   +G   T  +  G  ++ W H  +   A  RYL  +D   + H   + YY  +  D S+                    Q + + RE   E  K+S  FN R++  LP+HL++S     L   CIFN+ ++   L  +G+++      L A   P+D ++   L++ L LS   L+ +P Q + Q+L R+  I  +D+    +  +Y  L  L      ++ LP L+PS +C+  P       ++ +  +    FG    V+C +    + KL+   D   L     ++    S     G     + L    + LV+     ++V ++   K+    +   D   +T + +  L   F+ G       S +  DL  S  L+    V  + E        ++S NS     F A +      +AA+    +G +  V+  ++E+ ++I  V +S+ Y +L C     P   ++ I +I+ +   S +  R I GC  D +S  +IN  G+H I      +T  T++  WNLETE+HKH           C ++      C      R++   S  + +    NI    +    + +       + KY     Y+         + ++N+ R    G       ++  ++D++L    KL IL+D+  +        V+Q + ++DL       +   +FI PC ++++ +L  +L +GLS+N  H++ W+L +G I+ RI+     S+L++S  +  ++      E   +    + T ++T  K+               L+   H+  ID  L+S D   +I +YF+  L VFS+ ++ H+ TL   +SLL L  A+LTH+G +L    +++      L+LW+ +   Q+   L     +  V + N A+  ++      L +W+   R H  +              YR   L   S L    G +         +W++ D G + +  F PD  I   ++  ++N
Sbjct:  174 RRFMIYL-CGGYLTVAERSALMERVYPQLYLYCKQRGYDFRMVDLRRGVTD----PISDHNDSAELHIELL--KKCQETEGPSFFMFTGQKHEVQSLPTTISQGDFEAILRTVTRDRKK--------QS--KRESEVDDVTVKSQSSLGISNDGSFTLEHRPGEEEEHTGSSALMSENSKSLSSFSDGEKTEADNDQDLGLLQTWYQLDENTVPPVYRLLPVTHL-PDFLSRDGQRRKAAKKAWRSTCLHIWGVLQCNGPEAIGETATSHLLRTLDWEMEQGLGAKLPAEEYSHCYKRIITDLLYNLRSEYAQ-QFIDLHKGRPEINQT-----LHRSQQSFIHNIHSKLRHTNIYETNVSWGRKGLSPKHNRSHQFYTERLCSHFQRIV-TTALNQVKPVKRSFDV--------RRREASRTRLHEEM---QLHLRHGKSAQSFEFRQNFLLEVKDSLEISASSQNALLLLGEPGSGKSTLMAKVVQL-----LPTWISKVKVLVCFVGLTSDSRNVRLLLQMICTQMADIYCKHTEISELIRELHSLL--MLVSEDRPLALVLDGLDELSEEHEADLSWLYTPPP---PHVYILLSASKS---------HAKVSLLSLPPLSSEEITAGLRSRLASDARRLQTAQWN-----LLLQRCLSCPNPLYLSTAYSLSLSWSSFTPPEQTTLPGQLQSLFQGIFASLERKHGEHLLRRAASLLCLSRCGVTEEELLRLLGRDERVAQEIAKLHNQTQTTSGYDSVPLVLWARLRHDIGYHLTQVESDGTWVLHWTHSEFGQVATQRYLKTEDTTRAVHADFAEYYGADGPDSSIF-------------------QPLAWSRE---EGGKRSYVFNLRKLHGLPYHLIRSGQILPLFSQCIFNYEFLLHKL--WGLSFCHIEEDLKAAIIPDDLVDKDMLVQALCLSRSVLLKDPCQLASQLLGRLLHITTQDKPVAPDPLRYTYLHTLMAQ-CQHSTLPVLVPSYSCLMPPGGLTHTLLTHLSPVTALAFGQDHAVSCSVDG--TLKLWKLDDTVAL-----ARTLPRSEGFTSGWAADSLTLCLKDSVLVLRKGHRLQVREVDSGKVFYTESESLDVPVVTSTGEGRLLVVFYDG-------SHKVFDLAASCSLLRCVNVTLESEPIHKDNSILLSHNSIKDHVFFAYSG----GEAAVFSANSGTVLSVVK-AQEQAASIQAVEMSSQYLLLFC----YPYKRDTEIIHIELYCPASFQYLRSILGCSQDYISQVTINRGGTHVIAFCPSNRTVSTEIITWNLETEDHKHMARFPGLLTAICPDLRFCLGFCSGERYLRLWNLISRINDQTLTYNIHRVQRDGTQEII------PMDKYP----YVVCRGIRTGTVRVWNVSRAHFRGRPVRVEHSLFSSSDVVLAQDLKLYILTDRGTATFTDTPTPVYQTLLVYDLLTRSYVKRQSGLFIVPCPQQDYRLLRGELLLGLSEN-DHLIVWDLDSGYIKGRIKTYHKESLLTSSPLKDQQSQTVLTGERKLMMPWDWRTESHTAKKRRQQFEERREKEEQRNLEREKHN-SIDQYLLSGDEKVVICSYFAHHLNVFSVDSQEHLHTLEDRWSLLGLCTAALTHSGGHLAISNYSEVQRSPYLTLWDTQHGRQVQKRLKNEPGICCVAITNDASRIAFGIMKSNLKVWEPFRRKHKTISG------------YRGLKLDVSSQLYVTEGGTKAILLAELSVWDL-DAG-TVLSVFTPDSRIQCVSVLGDEN 1820          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 78.5666 bits (192), Expect = 5.755e-14
Identity = 143/666 (21.47%), Postives = 280/666 (42.04%), Query Frame = 3
Query: 1800 SISLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIP-------EDIIG--LKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMN-NCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVEN---LIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVP--KLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFD-DTIQKFLTNLVEPGD----FSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMN---NNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEA----EPEDIEYPFLIKLLILSF-DNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNL-DELYKSIITNNWL-----PTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWD-NSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKIL 3686
            S+++ + P+  ++SGP   GKT ++C L    +      ++    V  RLLG S  ++D+  +L+SVC Q+      NL  P        D++    + +L+++    D  +++ LD ++++  + N  + +  WLP ++  N  ++ ST    +P  ++L     D           Q+  LT+E    + K Y+       T EQ + ++ + ++  +   +   L +A+ WTS +++   +LG+ ++  I  +   LE + G+  +R  LGYI+    G+S  EL DI++ D D + +   N + P      F    ++L R    +L   L   + E+GI +  +    +      RYL  + +    H ++S Y++        + +L   + P     N    +  Q ++F              N R++ +LP HL+ +  ++ L+ + + +  W+    +  GV  VI+      +     E   I   FL+    + F D  ID+ L    +I +R   +            Y +L   LY      +W      P L+P  + M +P  ++ + +  F   VT +      + L   ++ G+L +WD      L + +   G      ++N+    L       I+ W +   K L
Sbjct:    4 SLNMQHGPL--VVSGPPGSGKTAVLCRLAQEMRAVLGPQAV----VTLRLLGTSPLSSDVDSVLKSVCVQVC--GAFNLAPPCTQTANSHDMLVRFFQSMLHKVSEQGD-TLLLILDSLDHLP-HANGGHKL-RWLPKEIPPNIHLVVSTLADWSPCLESLKALNNDDKYFF------QVEPLTLEEGQLITKAYMDKAGRRLTSEQVDAVLQSFQKTGSPLHLKLLLDMAKQWTSYTTLSDIRLGSSVQEVISLFLDSLEGKHGKLFVRHALGYITLSRFGLSEAELQDILSLDNDVLAEVYQNRLPPNHTLLRFPPLLWALFR---QDLGDHLVERW-ENGIAVCGFSLRQFIEIVKERYLSVELRV-KMHTVLSEYFLGQWSQGQQKPIL---LHPLMTQLNADRKVPAQPLWFAEGIP---------NFRKLHELPFHLLHAGKWEELRQLLLGSLEWLYCKTLSCGVASVIQDFTFCTDVMDCPEIRLIRECFLLLKPTIDFIDGNIDSSL-LCTEITARFQAL---------AHAYPDLIGCLYSQ--CQDWFASCADPVLVPRCSFMEAPGGALKNTLNGFTKGVTAVDVCCEKSILTAGSEDGLLIVWDLKHLEVLHTFVAHTGVVECVKLINKGDQCLSAGRDGCIKKWSVCSGKQL 623          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 73.9442 bits (180), Expect = 1.694e-12
Identity = 112/485 (23.09%), Postives = 215/485 (44.33%), Query Frame = 3
Query: 1800 SISLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIP-------EDIIG--LKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMN-NCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVEN---LIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVP--KLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFD-DTIQKFLTNLVEPGD----FSGFSFSLLRCVCTELDSFLGTFYDESG-----IQLIKWRHLSYN-----NAAVSRYLLQKDKAPSYHQLVSYYYMNN-NYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIE 3155
            S+++ + P+  ++SGP   GKT ++C L    +      ++    V  RLLG S  ++D+  +L+SVC Q+      NL  P        D++    + +L+++    D  +++ LD ++++  + N  + +  WLP ++  N  ++ ST    +P  ++L     D           Q+  LT+E    + K Y+       T EQ + ++ + ++  +   +   L +A+ WTS +++   +LG+ ++  I  +   LE + G+  +R  LGYI+    G+S  EL DI++ D D + +   N + P      F    ++L R    +L   L   + E+G     I+++K R+LS       +  +S Y L +        ++ +  M   N DR V           P  PL       +F              N R++ +LP HL+ +  ++ L+ + + N  W+    +  GV  VI+
Sbjct:  334 SLNMQHGPL--VVSGPPGSGKTAVLCRLAQEMRAVLGPQAV----VTLRLLGTSPLSSDVDSVLKSVCVQVC--GAFNLAPPCTQTANSHDMLVRFFQSMLHKVSEQGD-TLLLILDSLDHLP-HANGGHKL-RWLPKEIPPNIHLVVSTLADWSPCLESLKALNNDDKYFF------QVEPLTLEEGQLITKAYMDKAGRRLTSEQVDAVLQSFQKTGSPLHLKLLLDMAKQWTSYTTLSDIRLGSSVQEVISLFLDSLEGKHGKLFVRHALGYITLSRFGLSEAELQDILSLDNDVLAEVYQNRLPPNHTLLRFPPLLWALFR---QDLGDHLVERW-ENGIAVQFIEIVKERYLSVELRVKMHTVLSEYFLGQWSQGQQKPILLHPLMTQLNADRKV-----------PAQPL-------WFAEGIP---------NFRKLHELPFHLLHAGKWEELRQLLLGNLEWLYCKTLSCGVASVIQ 770          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 71.2478 bits (173), Expect = 1.305e-11
Identity = 112/487 (23.00%), Postives = 205/487 (42.09%), Query Frame = 3
Query: 1839 SGPINGKTNLMCHLISAFQYNKLEHSIN---DYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-----IPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSV--PKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFL---TNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYM--------------NNNYDRSVLFKSMDP-------------------DFILPNYP----LHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFG 3137
             GP  GKT L+   ++   Y+ L+  +    D +VI R +G S  +TD+  +L+S+C Q+     +N R     +P  I  ++ LL  +L    F+  ++I LD +E + +  +D+  ++ WLP+ +    +++ ST      I Q L   + D  D   +  + +      + L +  +S  R   T  Q+  +   + +C    FV    R    W S   V    L + +  +I   F  +E++ G   + R LGY++    G++ VEL DI++ D+++   +   +NL  P      S+ L+  +  EL+ +L        + L+ W +   +  A   YL  ++     H L++ Y++              NN++    + +  +P                   D   P  P     +++ QDIFF              N R++ +L  HL +S     L    I NF W+  T+I+ G
Sbjct:  418 GGPCTGKTLLLAE-VAKQAYSCLQKEMGPETDPVVIVRFIGSSDLSTDLRNLLQSICEQI----AINYRCLIHFLPNKIQEMRELLVNLLGESSFQRPLVIILDALEQLSD-ADDARKLW-WLPIHLPRTVRIVVSTLPNKHGILQKLRCLIHD--DDCYVELMQRDRKACSQTLKQQLLSVKR-KVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFFSIENKLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLGDIMVSSNLKSP---LRISYDLIAQLKEELEGYL-VERQVRNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLDQDIFF-------------VNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLY-TMIKIG 876          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 70.8626 bits (172), Expect = 1.433e-11
Identity = 112/487 (23.00%), Postives = 205/487 (42.09%), Query Frame = 3
Query: 1839 SGPINGKTNLMCHLISAFQYNKLEHSIN---DYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-----IPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSV--PKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFL---TNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYM--------------NNNYDRSVLFKSMDP-------------------DFILPNYP----LHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFG 3137
             GP  GKT L+   ++   Y+ L+  +    D +VI R +G S  +TD+  +L+S+C Q+     +N R     +P  I  ++ LL  +L    F+  ++I LD +E + +  +D+  ++ WLP+ +    +++ ST      I Q L   + D  D   +  + +      + L +  +S  R   T  Q+  +   + +C    FV    R    W S   V    L + +  +I   F  +E++ G   + R LGY++    G++ VEL DI++ D+++   +   +NL  P      S+ L+  +  EL+ +L        + L+ W +   +  A   YL  ++     H L++ Y++              NN++    + +  +P                   D   P  P     +++ QDIFF              N R++ +L  HL +S     L    I NF W+  T+I+ G
Sbjct:  495 GGPCTGKTLLLAE-VAKQAYSCLQKEMGPETDPVVIVRFIGSSDLSTDLRNLLQSICEQI----AINYRCLIHFLPNKIQEMRELLVNLLGESSFQRPLVIILDALEQLSD-ADDARKLW-WLPIHLPRTVRIVVSTLPNKHGILQKLRCLIHD--DDCYVELMQRDRKACSQTLKQQLLSVKR-KVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFFSIENKLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLGDIMVSSNLKSP---LRISYDLIAQLKEELEGYL-VERQVRNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLDQDIFF-------------VNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLY-TMIKIG 953          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO31117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV4])

HSP 1 Score: 124.02 bits (310), Expect = 4.247e-28
Identity = 144/650 (22.15%), Postives = 277/650 (42.62%), Query Frame = 3
Query: 1851 NGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVC---CQLLYETKVNLRIPEDIIGL----KILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIY-SIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVP--KLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFS--LLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYY------YMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLN-LDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIG--VLYIWDN-SKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVS 3731
            +GKT++M   + AF+    E   ++ + I+R LG S   ++    ++SVC    Q+     +   + ED   L      LL+ + +  +  +++ LD ++ +    N    + NWLP  + ++ K++ S     P Y  +L  ++ SL   + Y  +P LS  T   ++  ++       T EQ+ ++++  ++C    F+      A  W S + V    LG  +   I + F RLE + G+ +  R L Y++   +G++  EL DI++ DD +   +    +P           L   V +++D FL       G  ++ W H  +  A    YL    K  ++  +  ++      +        VL +       LP+    +  Q + F +E          FN R++ +LP+HL+ S+ +  L    +FNF WI   +    +N V+     A +A+P D++   +   LILS  N+  +    + Q++ R+          G+  +  + L++ Y+ I   N +P + P   C+ SP   + + +      + C+    T    FI T  G  ++ IW+  + + + ++ +G G     ++L      +V A       WDI   + +  F       CL V+
Sbjct:  376 SGKTSIMA--VIAFRVK--EWLGDNAVCIFRFLGTSPGTSNTLLTIKSVCEQIHQVFGLESLKEDVAEDYTELVRHFHELLSTLSVSAERPLVLVLDSVDQLSPSYN--AHLMNWLPKSLSDHIKIVISV---LPGYYEILPTLQRSLTDTNCYIEVPTLSRDTGHEILDAWLDSKHRTLTPEQRVLVMAAFDKCPQPLFLKLIFAEASEWASYTDVSGVSLGANVPEAIGFLFERLERKHGKMLFSRALQYVTAARSGLTENELEDILSLDDDVIDDVYQYWDPPVEGVVRLPNLLWARVRSDIDEFL-VERQADGKTVVAWYHRQFWEACERMYLKDGVKVDAHALMAEFFLGEFWTWGGGRKKHIVLTRRQKA---LPDADRQVSAQPLMFSKEI---------FNLRKLSELPYHLVHSKQFNALSQEVLFNFEWIMAKVKAQSLNSVLADYDTALQAKP-DLDIRLVQDTLILSSSNIKHDLNSLAPQLIGRLLAF------KGKFPRIASLLEQAYRWIYARN-IPVIAPMNACLISPGGPLITNLHGHTQRLDCV--TVTRDDKFIVTSGGDSLINIWNTENHDCIHTLKIG-GKGQSHLVLTNDDRFVVAAADSSFGAWDIDTGEKVVSFESHVKITCLAVT 992          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT6])

HSP 1 Score: 83.5741 bits (205), Expect = 4.207e-16
Identity = 114/507 (22.49%), Postives = 223/507 (43.98%), Query Frame = 3
Query: 1323 QEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEE---------NQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSI--SLSNNPISCLISGPIN-GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQL--LYETKVNLRIPEDIIGLKILLNQILLM--IDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRH 2786
            +E   F + I+ L   + + +  L    F D     ++ L+   LL ++ ++         N   Y++   + G +SP     H +YI+++  ++Q +L+  I +AI  E +  SE+   +  E +    Q L F +   +Q Y +E  +L+        L LN   + +     N P+  +I G    GKT+    ++S       E    D  V+ R +G +  ++ +  ++RSVC Q+  +YE   +  I  DI  LK    + L M  ++  ++I LD ++ +     D     +WLP+ + ++  ++ ST     +       +K  L   S   +P+L       ++  Y+       + +Q++++   +++C    FV  +   A  W S S + +  L + +   I   F R+E Q G  ++ R LGY++   +G++  EL D+++ DD +   +     P          +R +  +L+S+L T     G Q++ W H
Sbjct:  161 RECCWFSRNIRDLEKHVADGRAHL----FIDTTREGDVDLEAQRLLGNLKKDLLHCYLPLDNVKTYDVTWSRDG-ISPNLNNEHRAYIERMCEDVQIVLQHLITNAI--ERRNSSEVTDPMFEEAL----QHLSFCQSKCEQFYGREDVLLS------CRLILNMRSYDVLDVCRNRPL--VIYGESGCGKTS----VVSMVAMRSREWLRGDTCVVVRYIGTTPDSSLVRLLVRSVCQQICAVYEKDPSF-IRNDIKELKEDFIRCLRMATVERPLLIVLDSLDQLS--AEDGARQLSWLPMTLPDHVHLVVSTIPE--VKYECFPVLKAFLPPESFVLVPKLPQKDAAEILVSYLRMEHRTLSTDQQDIVQQALQECSLPIFVRVAFDEAIRWKSYSPLDETVLQHTVRGAINSLFERVERQHGHVLVSRALGYVTAAKSGLTETELEDLLSCDDFVLDDVYQYWTPPVRRIPPLLWVR-IRQDLESYLVT-RGADGAQVVTWYH 637          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO40517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z9])

HSP 1 Score: 75.485 bits (184), Expect = 1.537e-13
Identity = 107/455 (23.52%), Postives = 196/455 (43.08%), Query Frame = 3
Query: 1467 INEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDY--LVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRI-PEDIIGLKILLNQILLMI--DFKVMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFD----DTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFL---GTFYDESGIQLIKWRH 2786
            +++ N   Y+++    G ++P     H  Y+ ++      +++K I DAI   ++   E+           RD+  LF+E+A    +      L  E F      L + +  IS S      L      GKT+L+          KL  S  +Y  +V+ R LG +  ++++  +LRS C QL      + ++ P+D   L       L M   +  +++ LD  + +    +D++ M  WLP K+  +  V+ ST K  P Y       K  LD      +  L +    N++  ++S      TD Q++++++   +C    ++  +   A  W S + + K  L   ++  I   F RLE + G  ++R  L YI+    G+S  EL DI++ D    D + ++ T  V         ++ +R    EL+S++   GT     G +++ W H
Sbjct:  225 LDKSNIFSYDIKWTSEG-VTPEGNLTHGQYLGKLCTEFYDVMKKKITDAIT--KRAAGEV-----------RDKEHLFQEVAQHATFCN----LKCENFHGREDILEKIRTYISGSGQKPLVLYGDSGCGKTSLVAMTA------KLVPSWTEYEPVVVLRFLGTTPDSSNIRLVLRSACLQLCKAFGTSTKVVPQDYQDLLREFQDRLKMAKSNRPIVVILDSADQLTT-TDDAHQMV-WLPRKLPKHVYVLVSTLKD-PKYACYPALKKLLLDSNCFVEVSSLPSEVACNILTSWLSNDNRRLTDSQRKIVLNAFNRCPLPLYLRLAYDHAVTWKSYTPLEKSVLEKNVQGMIKALFKRLERRHGTVLVRHALAYITAAKHGLSEPELEDILSCDEEVLDEVFQYWTPPVR--RIPPLLWARIR---AELNSYVVECGT----DGARVVTWYH 643          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO37261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG70])

HSP 1 Score: 72.0182 bits (175), Expect = 1.516e-12
Identity = 93/418 (22.25%), Postives = 186/418 (44.50%), Query Frame = 3
Query: 1410 TDKMMSENIQLQRNDLLKHINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFSTEKSAP--IYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTS--SSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTI 2642
            TD+M    +Q  ++ + + +   N + Y+++  K G + P     H  Y++    + Q +LE  I  +I   E   SE+ S I  E +    Q ++F +  +   +   + VLN      +  +L E      + +    C       GKT++M   ++A       H   +  V+ R LG + +++ + ++++S+C Q+    ++   IP+ +  +  L   +L     K  +++ LD ++ +     D   + +WLP  +  +CK+I ST   A    +  L    K+  D L I S+P L +  V +++  ++          Q+++++S   QC    F+  S   A  W S       +L   +   I     R+E + G  +++  LGY++   +G++  EL DI++ DD +
Sbjct:  197 TDRM--SMLQQLKSSMKQILGINNMLVYKIKWTKKG-IDPTN-DEHRQYLNTFCRDFQRVLETKITQSI--SENTSSEIESPIYEEVV----QHMMFCQSKLDM-FHGRQAVLNS-----IGDYLREGLGQPLVLHGCSGC-------GKTSIMA--MAAKCARDWIHP--EACVVLRFLGTTPKSSTIRRLMKSICEQIKCVYRLTTSIPQGLKDMVELFPSLLASATAKRPLLVLLDSLDQLSP--EDGARLLDWLPKHLPGHCKMIVSTLPGAQYRCFPKLKAMFKN--DKLFI-SVPSLPHSDVSDILSMWLQQSGRTLQPAQRDLVMSAFSQCPLPLFLKISFDEACRWHSYTDPGQTRLYGSVRDAINGLLERIEAKHGRILVQHALGYLTAARSGLTETELDDILSSDDEV 582          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO41687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3R7])

HSP 1 Score: 63.929 bits (154), Expect = 5.481e-10
Identity = 93/411 (22.63%), Postives = 170/411 (41.36%), Query Frame = 3
Query: 1434 IQLQRNDLLKHINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQIL--LFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLI----SGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNL-RIPEDIIGLKILLNQILLMID--FKVMIFLDGIENIKEYKNDSNSMFNWLPLKMNNCKVIFSTEKSAPIYQ-NLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTS----SSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIM 2624
            + + ++++   +  +N I Y +     G + P     H +YI ++  +    L+ SI DAI  +EK +             ERD +   LF++    QK  K         F     FL   +  I    NP   ++    SG   GKT++M  +  A              V+YR LG S  ++    +L S+C QL     V L R+PED+  L   L + L       K+++ LD ++ +    +      +W P ++ +   +F+   + P  +   L ++K  L       +P LS    + +++ ++          QK  ++   + C+   ++  +   A  W S    S ++ K   K   N L  F RLE   G  ++ ++ GYI+   +G++  EL D++
Sbjct:  194 VCVSQDEIATRLPRDNVITYNVHWSDEG-IDPESCEEHQNYIKELCDHFYDTLKGSIQDAIAEKEKTI-------------ERDSLAKELFDQGTFCQKKCK--------TFQGRKQFLGSIRERI---QNPRRIVVIHGESG--CGKTSIMAKV--AMVMRSWMTDPESCAVVYRFLGTSPDSSSTRLLLHSICSQLCRIAGVTLARVPEDLKSLSEYLPECLARASRQHKIVLVLDSLDQLT--GDTFGQELDWWPKQLPD--NVFAVLSTLPGEEYRCLPYLKALLPETCFMDVPVLSFHEADVILEGWLQEAGRCLQPHQKSAVLEAFKSCQLPLYLKLAFDEAIRWRSYTDKSETIVKKDVKGIINAL--FDRLERLHGRVLVSKVFGYITASRSGLTQPELDDLL 569          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 75.485 bits (184), Expect = 6.861e-13
Identity = 135/600 (22.50%), Postives = 239/600 (39.83%), Query Frame = 3
Query: 1665 ETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSIN---DYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-----IPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSV--PKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDD------TIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYM--------------NNNYDRSVLFKSMDP----------------DFILPNYP----LHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFG-VNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIV 3299
            ET P  D++L    L      L E K    +   E L+    ++ S      P+  +  GP  GKT L+   ++   Y  L+  +    D +VI R +G S  +TD+  +L+S+C Q+     +N R     +P  I  ++ LL  +L    F   ++I LD +E + +   D      WLP+++    +++ ST      I Q L + + D    + +    Q        ++K  +   +   T  Q+  +   + +C    FV    R    W S   V    L + +  +I   F  +E++ G+  + R LGYI+    G++ VEL DI++ D+       +  +L N +        S+ L+  +  EL+ +L        I L+ W +   +  A   YL  ++     H L++ Y++              NN++    +    +P                D   P  P     ++++ DIFF              N R++ +L +HL +S     L    I NF W+  T+I+ G     +  + LA     E  E  FL   L      ++ NP   S ++  R+  +V
Sbjct:  357 ETDPLYDEVLQHLSLCKTYAALYEYKAETLDYVQEYLMPSKGSRMS------PM-VVFGGPCTGKTLLLSE-VAKQAYTWLQKEMGPETDPVVIVRFIGSSQLSTDLRTLLQSICEQI----AINYRCLIHFLPNKIQEMRELLINLLGESSFHRPLVIVLDSLEQLSD--ADEARKLWWLPIQLPRTVRIVVSTLPNKHGILQKLRHLIHDDGYYVELI---QRDRKACSQMLKQQLLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGQRFVFRALGYITMAKAGLTEVELEDILSLDNIVLGDVIVATYLKNPLR------ISYDLVAKLREELEGYL-IERQVRNIALLVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFTYDNNHFTSLNISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFF-------------VNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLY-TMIKIGQFEKALTDIDLAYSCSQEK-ELKFLATTLRGVKVKVLKNPASLSAELQQRLLPVV 917          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 74.7146 bits (182), Expect = 1.011e-12
Identity = 133/596 (22.32%), Postives = 238/596 (39.93%), Query Frame = 3
Query: 1665 ETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSIN---DYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-IPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSV--PKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDD------TIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYM--------------NNNYDRSVLFKSMDP----------------DFILPNYP----LHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFG-VNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIV 3299
            ET P  D++L    L      L E K    +   E L+    ++ S      P+  +  GP  GKT L+   ++   Y  L+  +    D +VI R +G S  +TD+  +L+S+C Q+    +  +  +P  I  ++ LL  +L    F   ++I LD +E + +   D      WLP+++    +++ ST      I Q L + + D    + +    Q        ++K  +   +   T  Q+  +   + +C    FV    R    W S   V    L + +  +I   F  +E++ G+  + R LGYI+    G++ VEL DI++ D+       +  +L N +        S+ L+  +  EL+ +L        I L+ W +   +  A   YL  ++     H L++ Y++              NN++    +    +P                D   P  P     ++++ DIFF              N R++ +L +HL +S     L    I NF W+  T+I+ G     +  + LA     E  E  FL   L      ++ NP   S ++  R+  +V
Sbjct:  367 ETDPLYDEVLQHLSLCKTYAALYEYKAETLDYVQEYLMPSKGSRMS------PM-VVFGGPCTGKTLLLSE-VAKQAYTWLQKEMGPETDPVVIVRFIGSSQLSTDLRTLLQSICEQIAINYRCLIHFLPNKIQEMRELLINLLGESSFHRPLVIVLDSLEQLSD--ADEARKLWWLPIQLPRTVRIVVSTLPNKHGILQKLRHLIHDDGYYVELI---QRDRKACSQMLKQQLLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGQRFVFRALGYITMAKAGLTEVELEDILSLDNIVLGDVIVATYLKNPLR------ISYDLVAKLREELEGYL-IERQVRNIALLVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFTYDNNHFTSLNISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFF-------------VNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLY-TMIKIGQFEKALTDIDLAYSCSQEK-ELKFLATTLRGVKVKVLKNPASLSAELQQRLLPVV 927          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 74.7146 bits (182), Expect = 1.011e-12
Identity = 133/596 (22.32%), Postives = 238/596 (39.93%), Query Frame = 3
Query: 1665 ETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSIN---DYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLR-IPEDIIGLKILLNQILLMIDFK--VMIFLDGIENIKEYKNDSNSMFNWLPLKM-NNCKVIFST-EKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSV--PKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDD------TIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYM--------------NNNYDRSVLFKSMDP----------------DFILPNYP----LHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFG-VNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIV 3299
            ET P  D++L    L      L E K    +   E L+    ++ S      P+  +  GP  GKT L+   ++   Y  L+  +    D +VI R +G S  +TD+  +L+S+C Q+    +  +  +P  I  ++ LL  +L    F   ++I LD +E + +   D      WLP+++    +++ ST      I Q L + + D    + +    Q        ++K  +   +   T  Q+  +   + +C    FV    R    W S   V    L + +  +I   F  +E++ G+  + R LGYI+    G++ VEL DI++ D+       +  +L N +        S+ L+  +  EL+ +L        I L+ W +   +  A   YL  ++     H L++ Y++              NN++    +    +P                D   P  P     ++++ DIFF              N R++ +L +HL +S     L    I NF W+  T+I+ G     +  + LA     E  E  FL   L      ++ NP   S ++  R+  +V
Sbjct:  367 ETDPLYDEVLQHLSLCKTYAALYEYKAETLDYVQEYLMPSKGSRMS------PM-VVFGGPCTGKTLLLSE-VAKQAYTWLQKEMGPETDPVVIVRFIGSSQLSTDLRTLLQSICEQIAINYRCLIHFLPNKIQEMRELLINLLGESSFHRPLVIVLDSLEQLSD--ADEARKLWWLPIQLPRTVRIVVSTLPNKHGILQKLRHLIHDDGYYVELI---QRDRKACSQMLKQQLLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGQRFVFRALGYITMAKAGLTEVELEDILSLDNIVLGDVIVATYLKNPLR------ISYDLVAKLREELEGYL-IERQVRNIALLVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFTYDNNHFTSLNISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFF-------------VNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLY-TMIKIGQFEKALTDIDLAYSCSQEK-ELKFLATTLRGVKVKVLKNPASLSAELQQRLLPVV 927          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 67.781 bits (164), Expect = 1.310e-10
Identity = 92/430 (21.40%), Postives = 177/430 (41.16%), Query Frame = 3
Query: 1854 GKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVC------CQLLYETKVNLRIPEDIIGLKILLNQILLMI---DFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMN-NCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDE---SGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPL-----HIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLK 3083
            GKT L+C ++   Q   LE  +   LVI  L     Q   + ++L S+C      C L+  T +    P +   L+     IL       + ++I LD +E + E  +      +W+P  +     ++ S +  +  + N+     DSL+  + + + +LS    E +++ ++   +   T EQK++ + +         +   L   + WTS + + +  LGN  E  +     RLE +  + ++   LGYI+    G+   EL D+M+ DD +   +     P   S      L  +   L   L    +E   +G+ +I + H   +   +  YL  + +    H+++  Y++     +      + P   LP   L      +  Q ++F              N R++  LPHHL+ + L++ L+
Sbjct:  352 GKTALLCKVVREMQ-RVLETRV--VLVIRFLAAHHPQRPALDQVLHSICLQVSSACGLVPPTPMTAGSPTE---LQKFFRNILEEASQQGYTLLIVLDALEQLAEQHHSHK--LHWIPTNLPPKVHLLVSMDTCSEAFVNM-RLKTDSLE--NFFEVERLSRDEGERIMESHLRASQRTLTAEQKDVALQSFTLTGCPLHLKLILSAVQNWTSFTPLTEQLLGNNTEEVMSQLLHRLEHKHRKELVGGALGYIALARDGLLEAELYDVMSLDDDVISEVYRYTHPPTPSLIRLPPL--LWARLKRDLKDHLEERWTNGVAVIAFNHRCLSEVVLGHYLTSERQG-RCHKILGEYFLGRWSGK------LKP-VALPGLSLLLSDRKVPPQPLWFAPGLA---------NIRKLQALPHHLLHAGLWEELR 751          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000064089.1 (SMESG000064089.1)

HSP 1 Score: 3824.63 bits (9917), Expect = 0.000e+0
Identity = 1883/1883 (100.00%), Postives = 1883/1883 (100.00%), Query Frame = 3
Query:   36 MDYNSSNYLSPLGLLVKNSGKHPISLQGHYDHWVKYDGKKTYSVLPEQGIKAHLQRLRFQRSVTQLKLKRKKEKTIFLKKRSTFLNKSASKNGNGIFDFTDLYNDSIETGSTWWRITPLPDIVKQTETDTEKETVDFVQQPFIEASSIKTRIEALKHFSGSISNEVLNKYYNSRTIHIYVACSTFDMKNEISKLELNVWPHLRQLCLQYNRILVIHNLHNFSEELSSLGIQQYRKEIERSIEICSDQKSQHIKGLILFGDEYDEKDIPNYLLRDQIESIKSNMLPDIEKIMNLQSNIQSLKQRQSQIKQQNFKRENTVENFRENSFEDLNKSISKPTKITEIDKINAEIINCTSEIETLNYVTNIKLIDQWYHKANLTDNFYQLVSESEIIKDLKSPDFAKRKQARIIFKNIKTQLCAILSKYAANVLEQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENIFDICEANELSRIFFASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPNPSVLSTSKSRLSXXXXXXXXXXXFISFGTANNTPVKQTSFLKASIHDLVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQEDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQAKINQVKKIENYLERNGI 5684
            MDYNSSNYLSPLGLLVKNSGKHPISLQGHYDHWVKYDGKKTYSVLPEQGIKAHLQRLRFQRSVTQLKLKRKKEKTIFLKKRSTFLNKSASKNGNGIFDFTDLYNDSIETGSTWWRITPLPDIVKQTETDTEKETVDFVQQPFIEASSIKTRIEALKHFSGSISNEVLNKYYNSRTIHIYVACSTFDMKNEISKLELNVWPHLRQLCLQYNRILVIHNLHNFSEELSSLGIQQYRKEIERSIEICSDQKSQHIKGLILFGDEYDEKDIPNYLLRDQIESIKSNMLPDIEKIMNLQSNIQSLKQRQSQIKQQNFKRENTVENFRENSFEDLNKSISKPTKITEIDKINAEIINCTSEIETLNYVTNIKLIDQWYHKANLTDNFYQLVSESEIIKDLKSPDFAKRKQARIIFKNIKTQLCAILSKYAANVLEQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENIFDICEANELSRIFFASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPNPSVLSTSKSRLSENNVYNNNENNFISFGTANNTPVKQTSFLKASIHDLVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQEDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQAKINQVKKIENYLERNGI
Sbjct:    1 MDYNSSNYLSPLGLLVKNSGKHPISLQGHYDHWVKYDGKKTYSVLPEQGIKAHLQRLRFQRSVTQLKLKRKKEKTIFLKKRSTFLNKSASKNGNGIFDFTDLYNDSIETGSTWWRITPLPDIVKQTETDTEKETVDFVQQPFIEASSIKTRIEALKHFSGSISNEVLNKYYNSRTIHIYVACSTFDMKNEISKLELNVWPHLRQLCLQYNRILVIHNLHNFSEELSSLGIQQYRKEIERSIEICSDQKSQHIKGLILFGDEYDEKDIPNYLLRDQIESIKSNMLPDIEKIMNLQSNIQSLKQRQSQIKQQNFKRENTVENFRENSFEDLNKSISKPTKITEIDKINAEIINCTSEIETLNYVTNIKLIDQWYHKANLTDNFYQLVSESEIIKDLKSPDFAKRKQARIIFKNIKTQLCAILSKYAANVLEQEQTLFEQEIKLLTNIIMEKKCLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHKSGKLSPAQLRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERDQILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCLISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKILRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENIKEYKNDSNSMFNWLPLKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKYLNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSNPTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVMALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWISTWSFETLDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALIDIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYIDTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSIWNLETEEHKHCSEMENIFDICEANELSRIFFASSKSGKVFKLNIQSALQVAKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSWRISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGRIASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRIRPNPSVLSTSKSRLSENNVYNNNENNFISFGTANNTPVKQTSFLKASIHDLVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIASLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNNTATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQEDSTLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLKGSNDIFSLKLLKENQAKINQVKKIENYLERNGI 1883          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.740e-12
Identity = 110/499 (22.04%), Postives = 216/499 (43.29%), Query Frame = 3
Query: 1929 LVIYRLLGVSFQNTDMTKILRSVC--CQLLYETKVNLRIPEDIIGLKILLNQILLMIDF------KVMIFLDGIENIKEYKND-----SNSMFNWLPLKMN-NCKVIFS--TE----KSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQ---LIKWRHLSYNNAAVSRYLLQKDKAPSYH-QLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEPEDIEYPFLIKLLILSFD----NLIDNPLQFSCQILSRVTDIVREDRQTGEVRKY 3335
            +++ R +G S  ++ + ++L SVC   QL Y+ KV  R    +  LK L N ++  I         ++I  D I+ +  + N      SNS+ +W+P+ +     +I S  TE    K   ++QN L+  +     ++ +   ++  L  ++L++      +   TD Q  ++IS +       ++  +L  A  W S  S+ +  + + +E+ + + FA LE+++G  ++   LGY++    G++ +EL D+++  D +   +    +P   SG    L   +C+ + S L  +  +        + W H   +  A+ RY+   +     H ++  YY +  N +++   ++           L I   D       I+EK        R++  L  HL++S+    L  +C  N  ++      FGV  +I ++K   +  P       L K  I   D    N+ D P Q   Q+      I+  D+ +G ++ Y
Sbjct:  481 VIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISHYSYQQSPLIIIFDSIDQLFMFSNTLNESLSNSL-DWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVV-LICQSLLEHK----KRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKSYMSMEECIIKDCVESAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDP-PISGI-IRLPSLMCSRIHSDLSEYIIKKQTDDKVTLYWYHKQIHQCALKRYVKDLEILEILHKEMADYYAICGNIEKTCFLQNHKRK-------LEIKNADRLINNPPINEK------EPRKLHALSFHLVESRQNYELSKLCTANLKFLLSYAKCFGVQELILLLKSCEKVFPLSKIINILKKCFIFLQDVMETNIEDLPYQLLGQLKYLDKIIISHDKSSGSIKLY 958          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.385e-10
Identity = 110/510 (21.57%), Postives = 217/510 (42.55%), Query Frame = 3
Query: 1929 LVIYRLLGVSFQNTDMTKILRSVC--CQLLYETKVNLRIPEDIIGLKILLNQILLMIDF------KVMIFLDGIENIKEYKND-----SNSMFNWLPLKMN-NCKVIFS--TE----KSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQ---LIKWRHLSYNNAAVSRYLLQKDKAPSYH-QLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEP-----------------------EDIEYPFLIKL-----LILSFDNLID-NPLQFSCQILSRVTD 3293
            +++ R +G S  ++ + ++L SVC   QL Y+ KV  R    +  LK L N ++  I         ++I  D I+ +  + N      SNS+ +W+P+ +     +I S  TE    K   ++QN L+  +     ++ +   ++  L  ++L++      +   TD Q  ++IS +       ++  +L  A  W S  S+ +  + + +E+ + + FA LE+++G  ++   LGY++    G++ +EL D+++  D +   +    +P   SG    L   +C+ + S L  +  +        + W H   +  A+ RY+   +     H ++  YY +  N +++   ++           L I   D       I+EK        R++  L  HL++S+    L  +C  N  ++      FGV  +I ++K   +  P                       ED+ Y  L +L     +I+S D   D NP+ +   + +R  D
Sbjct:  452 VIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISHYSYQQSPLIIIFDSIDQLFMFSNTLNESLSNSL-DWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVV-LICQSLLEHK----KRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKSYMSMEECIIKDCVESAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDP-PISGI-IRLPSLMCSRIHSDLSEYIIKKQTDDKVTLYWYHKQIHQCALKRYVKDLEILEILHKEMADYYAICGNIEKTCFLQNHKRK-------LEIKNADRLINNPPINEK------EPRKLHALSFHLVESRQNYELSKLCTANLKFLLSYAKCFGVQELILLLKSCEKVFPLSKIINILKKCFIFLQDVMETNIEDLPYQLLGQLKYLDKIIISHDKSSDKNPITYKIGLTAREVD 940          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.156e-10
Identity = 97/445 (21.80%), Postives = 196/445 (44.04%), Query Frame = 3
Query: 1929 LVIYRLLGVSFQNTDMTKILRSVC--CQLLYETKVNLRIPEDIIGLKILLNQILLMIDF------KVMIFLDGIENIKEYKND-----SNSMFNWLPLKMN-NCKVIFS--TE----KSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQ---LIKWRHLSYNNAAVSRYLLQKDKAPSYH-QLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEP 3185
            +++ R +G S  ++ + ++L SVC   QL Y+ KV  R    +  LK L N ++  I         ++I  D I+ +  + N      SNS+ +W+P+ +     +I S  TE    K   ++QN L+  +     ++ +   ++  L  ++L++      +   TD Q  ++IS +       ++  +L  A  W S  S+ +  + + +E+ + + FA LE+++G  ++   LGY++    G++ +EL D+++  D +   +    +P   SG    L   +C+ + S L  +  +        + W H   +  A+ RY+   +     H ++  YY +  N +++   ++           L I   D       I+EK        R++  L  HL++S+    L  +C  N  ++      FGV  +I ++K   +  P
Sbjct:  452 VIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISHYSYQQSPLIIIFDSIDQLFMFSNTLNESLSNSL-DWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVV-LICQSLLEHK----KRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKSYMSMEECIIKDCVESAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDP-PISGI-IRLPSLMCSRIHSDLSEYIIKKQTDDKVTLYWYHKQIHQCALKRYVKDLEILEILHKEMADYYAICGNIEKTCFLQNHKRK-------LEIKNADRLINNPPINEK------EPRKLHALSFHLVESRQNYELSKLCTANLKFLLSYAKCFGVQELILLLKSCEKVFP 875          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.167e-10
Identity = 97/445 (21.80%), Postives = 196/445 (44.04%), Query Frame = 3
Query: 1929 LVIYRLLGVSFQNTDMTKILRSVC--CQLLYETKVNLRIPEDIIGLKILLNQILLMIDF------KVMIFLDGIENIKEYKND-----SNSMFNWLPLKMN-NCKVIFS--TE----KSAPIYQNLLNFMKDSLDMLSIYSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISSLRIARAWTSSSSVPK--LGNKLETNILYYFARLEDQFGEPIIRRLLGYISCFSTGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSFLGTFYDESGIQ---LIKWRHLSYNNAAVSRYLLQKDKAPSYH-QLVSYYYMNNNYDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRILQLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEP 3185
            +++ R +G S  ++ + ++L SVC   QL Y+ KV  R    +  LK L N ++  I         ++I  D I+ +  + N      SNS+ +W+P+ +     +I S  TE    K   ++QN L+  +     ++ +   ++  L  ++L++      +   TD Q  ++IS +       ++  +L  A  W S  S+ +  + + +E+ + + FA LE+++G  ++   LGY++    G++ +EL D+++  D +   +    +P   SG    L   +C+ + S L  +  +        + W H   +  A+ RY+   +     H ++  YY +  N +++   ++           L I   D       I+EK        R++  L  HL++S+    L  +C  N  ++      FGV  +I ++K   +  P
Sbjct:  481 VIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISHYSYQQSPLIIIFDSIDQLFMFSNTLNESLSNSL-DWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVV-LICQSLLEHK----KRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKSYMSMEECIIKDCVESAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDP-PISGI-IRLPSLMCSRIHSDLSEYIIKKQTDDKVTLYWYHKQIHQCALKRYVKDLEILEILHKEMADYYAICGNIEKTCFLQNHKRK-------LEIKNADRLINNPPINEK------EPRKLHALSFHLVESRQNYELSKLCTANLKFLLSYAKCFGVQELILLLKSCEKVFP 904          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NWD12.501e-1319.62NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD13.247e-1319.62NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD13.247e-1319.62NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD13.247e-1319.62NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD13.713e-1319.62NACHT and WD repeat domain containing 1 [Source:HG... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T05C3.21.452e-1619.90pep chromosome:WBcel235:V:5493747:5503010:1 gene:W... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG101852.007e-1721.63gene:FBgn0038397 transcript:FBtr0083235[more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-212k18.67.762e-6322.78si:ch211-212k18.6 [Source:ZFIN;Acc:ZDB-GENE-130530... [more]
nwd18.873e-1321.44NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd23.358e-1022.00NACHT and WD repeat domain containing 2 [Source:ZF... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000003639.15.994e-6522.30uncharacterized LOC101730828 [Source:NCBI gene;Acc... [more]
ppp1r3c.16.622e-1921.62protein phosphatase 1, regulatory (inhibitor) subu... [more]
hsp90ab11.280e-1323.32heat shock protein 90kDa alpha family class B memb... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nwd11.531e-1121.89NACHT and WD repeat domain containing 1 [Source:MG... [more]
Nwd11.597e-1121.89NACHT and WD repeat domain containing 1 [Source:MG... [more]
Nwd11.741e-1121.89NACHT and WD repeat domain containing 1 [Source:MG... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q149M9|NWD1_HUMAN1.783e-1219.62NACHT domain- and WD repeat-containing protein 1 O... [more]
sp|A6H603|NWD1_MOUSE1.071e-1021.89NACHT domain- and WD repeat-containing protein 1 O... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RYK24.665e-12024.02WD_REPEATS_REGION domain-containing protein OS=Cra... [more]
V3ZQU44.292e-11823.89WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A210Q3I71.308e-11523.31NACHT and WD repeat domain-containing protein 1 OS... [more]
A0A1I8HP739.270e-11124.23WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
R7TMM54.427e-11023.63WD_REPEATS_REGION domain-containing protein OS=Cap... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-212k18.67.356e-5821.73si:ch211-212k18.6 [Source:ZFIN;Acc:ZDB-GENE-130530... [more]
nwd15.755e-1421.47NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd11.694e-1223.09NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd21.305e-1123.00NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd21.433e-1123.00NACHT and WD repeat domain containing 2 [Source:NC... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311174.247e-2822.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349944.207e-1622.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405171.537e-1323.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372611.516e-1222.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416875.481e-1022.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nwd26.861e-1322.50NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd21.011e-1222.32NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd21.011e-1222.32NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd11.310e-1021.40NACHT and WD repeat domain containing 1 [Source:ZF... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064089.10.000e+0100.00SMESG000064089.1[more]
SMESG000074035.14.740e-1222.04SMESG000074035.1[more]
SMESG000074035.11.385e-1021.57SMESG000074035.1[more]
SMESG000074035.13.156e-1021.80SMESG000074035.1[more]
SMESG000074035.13.167e-1021.80SMESG000074035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015127 ID=SMED30015127|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5779bp
TTTTGTTTAAATGAAGCATTTCAATTGAATTGTAAATGGATTATAACAGC
AGCAATTATCTATCACCGTTAGGTTTATTAGTGAAAAACAGTGGGAAGCA
TCCAATATCATTGCAGGGCCACTATGATCATTGGGTGAAATACGACGGAA
AGAAAACATATTCAGTACTTCCTGAACAAGGAATCAAAGCTCATTTACAA
CGTCTCAGGTTTCAGCGGTCAGTCACTCAATTAAAGCTAAAAAGAAAGAA
GGAGAAAACAATTTTTCTCAAGAAAAGATCAACATTCCTGAATAAATCAG
CATCAAAGAATGGCAATGGAATCTTTGATTTTACAGACCTATATAATGAT
TCAATTGAAACAGGAAGCACTTGGTGGAGAATAACCCCTTTGCCTGATAT
TGTGAAACAAACAGAAACAGACACAGAAAAGGAAACTGTTGATTTTGTAC
AACAACCATTTATTGAAGCTTCATCAATTAAAACAAGAATTGAAGCATTG
AAACATTTTTCCGGAAGCATTTCCAATGAAGTTTTGAATAAATATTACAA
TTCTAGGACAATACATATCTATGTTGCTTGCTCGACTTTTGATATGAAAA
ATGAAATCTCAAAATTGGAATTAAATGTTTGGCCACATTTACGCCAATTG
TGCTTGCAATATAATCGGATATTGGTTATTCACAACTTACACAATTTCAG
TGAAGAGCTTTCGTCTTTAGGAATCCAACAATACCGAAAGGAAATTGAGC
GGTCTATTGAAATATGTTCAGATCAGAAATCTCAGCATATTAAAGGTTTG
ATTCTTTTTGGGGATGAATATGATGAAAAGGATATTCCGAATTATTTACT
CAGAGATCAGATAGAGTCAATAAAAAGTAATATGCTGCCAGATATAGAAA
AAATTATGAATTTGCAATCAAATATTCAATCTTTGAAGCAGCGACAATCT
CAAATCAAGCAACAAAATTTTAAAAGAGAAAATACAGTAGAAAATTTTAG
GGAAAATTCGTTTGAAGATTTAAACAAAAGCATTTCTAAACCCACAAAGA
TTACAGAAATCGATAAAATCAATGCTGAAATAATAAATTGCACTAGTGAA
ATCGAAACTCTGAATTATGTAACAAATATAAAATTAATTGATCAATGGTA
TCACAAAGCAAATCTCACAGACAACTTTTATCAGTTGGTTTCGGAAAGTG
AAATTATAAAGGATTTGAAAAGCCCGGATTTTGCAAAGAGGAAGCAAGCT
AGAATTATTTTTAAAAATATAAAAACACAACTTTGTGCTATTTTATCAAA
ATATGCTGCCAACGTCCTAGAGCAAGAGCAGACCTTATTTGAGCAAGAAA
TAAAATTATTAACTAATATAATTATGGAAAAGAAATGTCTGTTAGTGTCC
CGAACCTTTACTGACAAAATGATGAGTGAAAATATACAATTACAAAGAAA
TGATTTATTAAAACATATTAATGAAGAAAACCAAATTCGATATGAGCTGG
AATTACACAAAAGTGGTAAATTGTCACCGGCTCAGTTGAGAAACCATTTT
TCATACATTGATCAAGTGGCACATAATATACAGACAATATTAGAAAAGAG
TATTTTGGATGCAATTAAATTTGAAGAGAAAGAGCTTTCAGAATTATGCA
GTTCTATTTTGGTTGAAACAATCCCCGAAAGGGATCAAATTCTTCTATTC
GAAGAATTAGCTATTCAGCAGAAATATTTAAAAGAAAGAAAGGTTTTGAA
TGAAGAAATTTTCCCTGAAATGTTATTGTTTCTTAATGAAACTCAGCACT
CTATTTCCCTGTCGAATAACCCGATATCTTGCTTGATTTCCGGTCCAATA
AATGGGAAGACCAATCTCATGTGTCATTTGATTTCAGCATTTCAATATAA
CAAATTAGAACATTCAATTAATGATTATTTGGTGATTTATCGATTATTGG
GAGTTTCCTTTCAAAATACCGATATGACAAAAATCCTGCGATCGGTCTGT
TGCCAGCTCCTATATGAAACTAAAGTAAATCTGAGAATTCCAGAAGATAT
CATTGGTCTGAAGATACTGCTGAATCAAATTCTTCTTATGATAGATTTTA
AAGTCATGATATTTCTAGACGGAATAGAAAATATAAAAGAATATAAAAAT
GATTCAAACTCAATGTTTAATTGGCTTCCTTTAAAAATGAACAATTGCAA
AGTTATATTTTCTACCGAAAAAAGTGCTCCGATATATCAAAATCTTTTAA
ATTTTATGAAGGACAGTTTGGACATGTTATCAATTTATTCAATTCCTCAA
TTGTCCAATTTGACAGTTGAAAATTTAATTAAAGATTATATTTCATTTTA
TCGTATTCCTTGGACAGATGAACAAAAAGAGATGCTGATTTCAAACATAG
AACAATGCAAAACAATCGGTTTTGTGATTTCAAGTCTGAGAATAGCTCGA
GCTTGGACGAGTTCTTCGTCAGTTCCAAAATTGGGGAATAAACTTGAAAC
TAATATTCTCTATTATTTTGCTAGACTAGAGGACCAATTTGGGGAACCTA
TCATTCGGCGGTTGTTGGGTTATATCAGTTGCTTTTCAACTGGGGTTTCA
ATAGTTGAACTCCTAGACATAATGACATTTGATGATACGATTCAGAAATT
TTTGACCAACTTAGTCGAACCAGGAGATTTCTCCGGATTTAGTTTTAGTT
TATTAAGATGTGTTTGCACTGAACTCGATTCCTTTCTTGGTACATTTTAC
GACGAATCCGGAATACAGCTTATAAAATGGCGCCATTTGTCTTATAATAA
CGCGGCTGTGTCGAGATATTTATTACAAAAAGACAAGGCCCCTTCCTATC
ATCAATTAGTTAGTTATTACTATATGAATAACAATTATGATAGATCTGTT
TTGTTTAAATCTATGGACCCAGACTTTATCTTACCAAACTATCCATTGCA
TATTGTCAAACAAGATATTTTCTTTGGACGAGAATTCATTCACGAAAAAA
CCAAAAAATCCAAATTCAATAAAAGACGAATTTTACAATTACCTCATCAT
TTAATGCAGAGCCAACTTTATAAGTTGCTGAAATGTGTTTGCATTTTTAA
TTTCCATTGGATCCAGCCAACTTTAATTGAGTTTGGGGTCAATTATGTTA
TTGAAATAGTGAAATTAGCCGCTGAAGCAGAACCAGAAGATATTGAATAT
CCTTTTTTAATAAAATTACTTATCCTCAGTTTTGATAATCTTATTGACAA
TCCGTTACAGTTCTCCTGTCAAATCCTCTCTCGAGTTACAGATATTGTCA
GAGAAGACCGACAAACAGGAGAAGTTCGTAAATACTTAAATTTAGACGAG
CTTTACAAATCCATTATAACCAACAATTGGTTGCCGACTTTGATACCGTC
AAAGAATTGTATGAGATCACCTATTAGTTCAATGTTTTCTTTGGTAGGAT
TCTTTTTTGGTAATGTCACTTGTTTATTATCGAATCCGACTTCCACAAAA
CTATTTATAACCACTGATATCGGTGTTCTTTACATATGGGATAACAGTAA
AAATACCCTTTCGTCTATCATTCTAGGAATCGGTAATTATGTATTTCAAA
TGATTCTAAATGAATCACATAATACCTTGGTGATGGCTTTGCCGGATCTT
ATTGAGGTTTGGGATATAAAAGAAGTAAAAATATTGAAAAGGTTCAATGT
GTTTTACGATTCTTATTGCTTAACGGTTTCCTCCGATAAATCTCTCTTTA
CCGCTTTTTTCTATGGGATATTTTGGATATCAACTTGGAGCTTTGAGACA
TTGGATCTAGTTATTTCAAGACATTTAATCATTGATACAACTGTCAATAA
TAAAGGGGAAATAATCTCTTCGAATTCTTGTAATAAATTTATTGCTCTCA
CAGCAGTCAAATATGATAATAAAGCAGCACTAATTGATATTAGGAATGGA
GAAATAAATCCTGTCCTTTTATGGAGTAAAGAGAAAGGATCTGCGATAAC
TAAAGTTGGAATATCAACAAATTATTACATTCTTTGTAGTAGGGGATTTT
CTCCTAATAATAATGAGTCTGTGATTTATTATATAGATACTTTTGACATA
GAAAGTTTGAAAAACGCTCGAAGAATATCTGGTTGTTTGTTAGATTCGGT
TAGCACTTTTTCAATTAATGGCGTTGGGTCGCATGCTATTACGTCTAATT
GTCATCTCCAAACTAACATGACAGACATGTCAATATGGAATCTTGAAACT
GAGGAGCATAAGCATTGCTCGGAGATGGAAAACATTTTTGACATATGTGA
AGCTAATGAGCTTTCAAGGATATTTTTTGCATCCTCAAAATCCGGCAAAG
TATTCAAGTTAAATATACAGTCGGCTCTACAAGTGGCAAAGAGTAAAACT
GTGACAAAACGACAAAATTACACTTTACGAAAATATGAACTAAACGACCA
ATATATTTTTCTAACAAATGAAAATAATTCAGTAATCGAAATCTACAACA
TGATGAGGAAAAAGAAGTCCGGCTTCAAATCATGGAGAATCTCCAATATT
GTAGACAACAATGACATTATGTTGCCTTATCAAGACAAGTTAATCATTCT
TTCAGATAAATCATTTTCCCCAATTGTTCCAGATTGTAAATGTGTTTTTC
AGATGATAAAAATATTTGATTTAAAAGAAGGTCGAATTGCAAGCAAGACA
AAAGAAGTGTTTATTTATCCATGTCGAGAAAAGGAATTTGTTGTTCTTAG
TGAGGATCTCTTTATCGGACTATCTGATAATAGGTCTCACATTGTGGCGT
GGAATTTGAGTGCTGGGCAAATTCAGTGGAGAATCCGACCAAATCCGTCG
GTTTTAAGCACCAGTAAATCGCGATTGTCGGAAAATAATGTTTATAATAA
TAACGAGAATAACTTTATTAGTTTTGGTACTGCCAATAATACCCCTGTTA
AGCAGACGTCCTTTTTAAAAGCCAGTATTCATGACTTGGTAATAGATTCT
GTTTTAGTCTCCAAAGACTTATCTACCTTGATTGTTGCGTACTTCAGTCC
GTTTCTCTGTGTGTTTTCTTTAACAAACAAATGTCACATTGGTACTTTGA
CCGGAGAATTCAGTCTTTTAGACTTAAGTATTGCTTCATTGACTCACAAT
GGATATTATCTTATTCATTACTGTTTTAATGATACACTTTCAAAGGCTTG
TTTGTCTTTGTGGAACTGTAAATCAGAAACTCAGATTTCTCATTTGACAG
TTAGACATAACGTTTTAGCCGTTATTCTTAATAATACGGCAACTCTAGCG
TCGTATTTCGAAAAGAATCAAGGACTATTCCTTTGGAAAATAAATAATAG
AATACATCATAAGCTTGAGAATAGCGAAGCAAATTGTTGTGCAGAAGAAT
TCCAGGATTACCGGTTGGAGTTTTTGCAGGAGGATTCGACTCTCTTGGCT
TTTAATGGATCCAGTTTTCAAATATGGAATATATTTGATGTGGGAGTTAG
TTTTGTAGGAAAGTTCCAACCTGACCAGTTGATTAATTCGTATACTTTAT
GTTTAAATGATAACTTAATAGCCTTTGTGTTGAAGGGGTCAAATGATATA
TTCAGTTTAAAATTATTGAAGGAAAATCAAGCTAAAATAAATCAAGTGAA
AAAGATTGAAAATTACCTAGAACGAAACGGTATAGATTCCAGTAGTAGTG
AAGACGAAGAATAACTGAATAACATTACACACTATTTTCTTTAAAGTTTA
AATAAATTGTATTGTTTTTTTAAAAAACA
back to top

protein sequence of SMED30015127-orf-1

>SMED30015127-orf-1 ID=SMED30015127-orf-1|Name=SMED30015127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1893bp
MDYNSSNYLSPLGLLVKNSGKHPISLQGHYDHWVKYDGKKTYSVLPEQGI
KAHLQRLRFQRSVTQLKLKRKKEKTIFLKKRSTFLNKSASKNGNGIFDFT
DLYNDSIETGSTWWRITPLPDIVKQTETDTEKETVDFVQQPFIEASSIKT
RIEALKHFSGSISNEVLNKYYNSRTIHIYVACSTFDMKNEISKLELNVWP
HLRQLCLQYNRILVIHNLHNFSEELSSLGIQQYRKEIERSIEICSDQKSQ
HIKGLILFGDEYDEKDIPNYLLRDQIESIKSNMLPDIEKIMNLQSNIQSL
KQRQSQIKQQNFKRENTVENFRENSFEDLNKSISKPTKITEIDKINAEII
NCTSEIETLNYVTNIKLIDQWYHKANLTDNFYQLVSESEIIKDLKSPDFA
KRKQARIIFKNIKTQLCAILSKYAANVLEQEQTLFEQEIKLLTNIIMEKK
CLLVSRTFTDKMMSENIQLQRNDLLKHINEENQIRYELELHKSGKLSPAQ
LRNHFSYIDQVAHNIQTILEKSILDAIKFEEKELSELCSSILVETIPERD
QILLFEELAIQQKYLKERKVLNEEIFPEMLLFLNETQHSISLSNNPISCL
ISGPINGKTNLMCHLISAFQYNKLEHSINDYLVIYRLLGVSFQNTDMTKI
LRSVCCQLLYETKVNLRIPEDIIGLKILLNQILLMIDFKVMIFLDGIENI
KEYKNDSNSMFNWLPLKMNNCKVIFSTEKSAPIYQNLLNFMKDSLDMLSI
YSIPQLSNLTVENLIKDYISFYRIPWTDEQKEMLISNIEQCKTIGFVISS
LRIARAWTSSSSVPKLGNKLETNILYYFARLEDQFGEPIIRRLLGYISCF
STGVSIVELLDIMTFDDTIQKFLTNLVEPGDFSGFSFSLLRCVCTELDSF
LGTFYDESGIQLIKWRHLSYNNAAVSRYLLQKDKAPSYHQLVSYYYMNNN
YDRSVLFKSMDPDFILPNYPLHIVKQDIFFGREFIHEKTKKSKFNKRRIL
QLPHHLMQSQLYKLLKCVCIFNFHWIQPTLIEFGVNYVIEIVKLAAEAEP
EDIEYPFLIKLLILSFDNLIDNPLQFSCQILSRVTDIVREDRQTGEVRKY
LNLDELYKSIITNNWLPTLIPSKNCMRSPISSMFSLVGFFFGNVTCLLSN
PTSTKLFITTDIGVLYIWDNSKNTLSSIILGIGNYVFQMILNESHNTLVM
ALPDLIEVWDIKEVKILKRFNVFYDSYCLTVSSDKSLFTAFFYGIFWIST
WSFETLDLVISRHLIIDTTVNNKGEIISSNSCNKFIALTAVKYDNKAALI
DIRNGEINPVLLWSKEKGSAITKVGISTNYYILCSRGFSPNNNESVIYYI
DTFDIESLKNARRISGCLLDSVSTFSINGVGSHAITSNCHLQTNMTDMSI
WNLETEEHKHCSEMENIFDICEANELSRIFFASSKSGKVFKLNIQSALQV
AKSKTVTKRQNYTLRKYELNDQYIFLTNENNSVIEIYNMMRKKKSGFKSW
RISNIVDNNDIMLPYQDKLIILSDKSFSPIVPDCKCVFQMIKIFDLKEGR
IASKTKEVFIYPCREKEFVVLSEDLFIGLSDNRSHIVAWNLSAGQIQWRI
RPNPSVLSTSKSRLSENNVYNNNENNFISFGTANNTPVKQTSFLKASIHD
LVIDSVLVSKDLSTLIVAYFSPFLCVFSLTNKCHIGTLTGEFSLLDLSIA
SLTHNGYYLIHYCFNDTLSKACLSLWNCKSETQISHLTVRHNVLAVILNN
TATLASYFEKNQGLFLWKINNRIHHKLENSEANCCAEEFQDYRLEFLQED
STLLAFNGSSFQIWNIFDVGVSFVGKFQPDQLINSYTLCLNDNLIAFVLK
GSNDIFSLKLLKENQAKINQVKKIENYLERNGIDSSSSEDEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR001611Leu-rich_rpt
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005682U5 snRNP
GO:0005737cytoplasm
GO:0005829cytosol
GO:0071011precatalytic spliceosome
GO:0071013catalytic step 2 spliceosome
Vocabulary: biological process
TermDefinition
GO:0008380RNA splicing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 290..310
NoneNo IPR availablePANTHERPTHR19871BETA TRANSDUCIN-RELATED PROTEINcoord: 364..1176
NoneNo IPR availableSUPERFAMILYSSF82171DPP6 N-terminal domain-likecoord: 1140..1456
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 201..222
score: 7.134
IPR011047Quinoprotein alcohol dehydrogenase-like superfamilySUPERFAMILYSSF50998Quinoprotein alcohol dehydrogenase-likecoord: 1573..1761