ATP/GTP binding protein 1

Overview
NameATP/GTP binding protein 1
Smed IDSMED30015121
Length (bp)4677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP/GTP binding protein 1 (SMED30015121) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP/GTP binding protein 1 (SMED30015121) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP/GTP binding protein 1 (SMED30015121) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP/GTP binding protein 1 (SMED30015121) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015121

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015121SMESG000063805.1 SmedASXL_017810SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015121SMESG000063805.1 dd_Smed_v4_11728_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP/GTP binding protein 1 vs. Ensembl Human
Match: AGTPBP1 (ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17258])

HSP 1 Score: 516.924 bits (1330), Expect = 2.220e-159
Identity = 258/525 (49.14%), Postives = 335/525 (63.81%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DI+D+ V+DL+                         + + P +   L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L   L                              K+E    P+  I F    LC T+ GN  P++TI     SN+  +     R +PYVFL++RVHPGE+NASWVMKG ++YL+S+NP ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W  P   L+PTI+H KGL+  L+   + P+V+CD+HGHSR+KN+FM+GCS +   +    +N T  D   ED  Y  LP IL++I+ AF + SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  629 GVQRTKIAQDIERLIHQSDIIDRVVYDLD-----------------------NPNYTIPEEGDILKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQ-----------------------------KLESAHNPQQ-IYFRKDVLCETLSGNSCPLVTITAMPESNYY-EHICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNDNATSCDV-VEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRL 1097          

HSP 2 Score: 189.889 bits (481), Expect = 6.644e-48
Identity = 114/313 (36.42%), Postives = 187/313 (59.74%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLY 1051
            L + SR++  L  LEKI A  S       E  T R  TSKIL L +  E+  R++  K    ++ L++TL+   D QT+ NI+ I+ ELV  +  G+R   LV  G S+ LLQ +   SKE  P ED +  +H +L KI  KDK+ GV+ARI+  L + ++L++   NL  H               + +L  L +LR+YS N +N+  LG+ G + L+ KII   +K N +++KV+++TL   +++K N+ RAV++G + +LL +++DW+R D++ +++ +RK IL  +KS+ N++ G+KAF++A+G+  LY
Sbjct:   12 LTNNSRIVGLLAQLEKINAEPS-------ESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEILLSTLENTKDLQTTLNILSILVELVS-AGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILAKIGPKDKKFGVKARINGALNITLNLVKQ--NLQNH---------------RLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIGPFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILY 299          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Human
Match: AGTPBP1 (ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17258])

HSP 1 Score: 516.924 bits (1330), Expect = 6.079e-159
Identity = 258/525 (49.14%), Postives = 335/525 (63.81%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DI+D+ V+DL+                         + + P +   L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L   L                              K+E    P+  I F    LC T+ GN  P++TI     SN+  +     R +PYVFL++RVHPGE+NASWVMKG ++YL+S+NP ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W  P   L+PTI+H KGL+  L+   + P+V+CD+HGHSR+KN+FM+GCS +   +    +N T  D   ED  Y  LP IL++I+ AF + SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  669 GVQRTKIAQDIERLIHQSDIIDRVVYDLD-----------------------NPNYTIPEEGDILKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQ-----------------------------KLESAHNPQQ-IYFRKDVLCETLSGNSCPLVTITAMPESNYY-EHICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNDNATSCDV-VEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRL 1137          

HSP 2 Score: 223.402 bits (568), Expect = 2.606e-58
Identity = 135/359 (37.60%), Postives = 210/359 (58.50%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR++  L  LEKI A  S       E  T R  TSKIL L +  E+  R++  K    ++ L++TL+   D QT+ NI+ I+ ELV  +  G+R   LV  G S+ LLQ +   SKE  P ED +  +H +L KI  KDK+ GV+ARI+  L + ++L++   NL  H               + +L  L +LR+YS N +N+  LG+ G + L+ KII   +K N +++KV+++TL   +++K N+ RAV++G + +LL +++DW+R D++ +++ +RK IL  +KS+ N++ G+KAF++A+G+  LY           L+ LV  SSLI+RKCFPKNRLPL    S     LP
Sbjct:   12 LTNNSRIVGLLAQLEKINAEPS-------ESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEILLSTLENTKDLQTTLNILSILVELVS-AGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILAKIGPKDKKFGVKARINGALNITLNLVKQ--NLQNH---------------RLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIGPFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLP 345          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Human
Match: AGTPBP1 (ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17258])

HSP 1 Score: 516.924 bits (1330), Expect = 9.117e-159
Identity = 260/525 (49.52%), Postives = 338/525 (64.38%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DI+D+ V+DL+             N  +T  +E ++          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L   L                              K+E    P+  I F    LC T+ GN  P++TI     SN+  +     R +PYVFL++RVHPGE+NASWVMKG ++YL+S+NP ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W  P   L+PTI+H KGL+  L+   + P+V+CD+HGHSR+KN+FM+GCS +   +    +N T  D   ED  Y  LP IL++I+ AF + SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  681 GVQRTKIAQDIERLIHQSDIIDRVVYDLD-------------NPNYTIPEEGDI----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQ-----------------------------KLESAHNPQQ-IYFRKDVLCETLSGNSCPLVTITAMPESNYY-EHICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNDNATSCDV-VEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRL 1149          

HSP 2 Score: 189.889 bits (481), Expect = 5.842e-48
Identity = 114/313 (36.42%), Postives = 187/313 (59.74%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLY 1051
            L + SR++  L  LEKI A  S       E  T R  TSKIL L +  E+  R++  K    ++ L++TL+   D QT+ NI+ I+ ELV  +  G+R   LV  G S+ LLQ +   SKE  P ED +  +H +L KI  KDK+ GV+ARI+  L + ++L++   NL  H               + +L  L +LR+YS N +N+  LG+ G + L+ KII   +K N +++KV+++TL   +++K N+ RAV++G + +LL +++DW+R D++ +++ +RK IL  +KS+ N++ G+KAF++A+G+  LY
Sbjct:   64 LTNNSRIVGLLAQLEKINAEPS-------ESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEILLSTLENTKDLQTTLNILSILVELV-SAGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILAKIGPKDKKFGVKARINGALNITLNLVKQ--NLQNH---------------RLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIGPFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILY 351          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Human
Match: AGTPBP1 (ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17258])

HSP 1 Score: 516.538 bits (1329), Expect = 2.562e-158
Identity = 258/524 (49.24%), Postives = 337/524 (64.31%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLK----DGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DI+D+ V+DL+             N  +T  +E ++          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L   L                              K+E    P+  I F    LC T+ GN  P++TI+   +    +     R +PYVFL++RVHPGE+NASWVMKG ++YL+S+NP ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W  P   L+PTI+H KGL+  L+   + P+V+CD+HGHSR+KN+FM+GCS +   +    +N T  D   ED  Y  LP IL++I+ AF + SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  721 GVQRTKIAQDIERLIHQSDIIDRVVYDLD-------------NPNYTIPEEGDI----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQ-----------------------------KLESAHNPQQ-IYFRKDVLCETLSGNSCPLVTITAMPESNYYEHICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNDNATSCDV-VEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRL 1189          

HSP 2 Score: 223.402 bits (568), Expect = 3.027e-58
Identity = 135/359 (37.60%), Postives = 210/359 (58.50%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR++  L  LEKI A  S       E  T R  TSKIL L +  E+  R++  K    ++ L++TL+   D QT+ NI+ I+ ELV  +  G+R   LV  G S+ LLQ +   SKE  P ED +  +H +L KI  KDK+ GV+ARI+  L + ++L++   NL  H               + +L  L +LR+YS N +N+  LG+ G + L+ KII   +K N +++KV+++TL   +++K N+ RAV++G + +LL +++DW+R D++ +++ +RK IL  +KS+ N++ G+KAF++A+G+  LY           L+ LV  SSLI+RKCFPKNRLPL    S     LP
Sbjct:   64 LTNNSRIVGLLAQLEKINAEPS-------ESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEILLSTLENTKDLQTTLNILSILVELV-SAGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILAKIGPKDKKFGVKARINGALNITLNLVKQ--NLQNH---------------RLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIGPFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLP 397          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Human
Match: AGBL1 (ATP/GTP binding protein like 1 [Source:HGNC Symbol;Acc:HGNC:26504])

HSP 1 Score: 499.59 bits (1285), Expect = 1.490e-154
Identity = 250/500 (50.00%), Postives = 327/500 (65.40%), Query Frame = 2
Query: 2684 KILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQ---SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLS-WINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYK 4159
            +I +D+RR+I   D+++K VF L                          D+  PLQ   S  L+F S+FE GNLRKAIQVR++EYDL++N DVN+    QWFYF+VS M++ +PY FNIINCEKPNSQFN+GMQP LYSVKEA+LG   W R G EI YYKNH+ +S A  GG  G+ YYT TF + FP+S DVCY+AYHYPYTYT L+T L                     D  EK +  K E Y        F    LC T+ GNP P++TI+   +  S       R +PY  +T+RVHPGESNASWVMKG +++L+SS+P++  LR+ ++FKI+PMLNPDGVING HRCS++G+DLNR+W+ P   L PTI+H KGL+  LS  G+SP+VFCDFHGHS++KN+F++GCS   + W    T   + +    E+ +Y  LP IL+ ++ AF++ SCSF VEKS+ STARVVVWR+ GV RSYTMES+YC  +QG Y+
Sbjct:  512 RIFEDIRRLIQPSDVINKVVFSL--------------------------DEPWPLQDNASNCLRFFSKFESGNLRKAIQVREFEYDLLVNADVNSTQHQQWFYFKVSGMQAAIPYHFNIINCEKPNSQFNYGMQPTLYSVKEALLGKPTWIRTGHEICYYKNHYRQSTAVAGGASGKCYYTLTFAVTFPHSEDVCYLAYHYPYTYTALMTHL---------------------DILEKSVNLK-EVY--------FRQDVLCQTLGGNPCPLVTITAMPESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKGTLEFLVSSDPVARLLRENFIFKIIPMLNPDGVINGNHRCSLSGEDLNRQWLSPSAHLQPTIYHAKGLLYHLSSIGRSPVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTI---LEEVNYRTLPKILDKLAPAFTMSSCSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQ 952          

HSP 2 Score: 129.798 bits (325), Expect = 1.562e-29
Identity = 75/262 (28.63%), Postives = 136/262 (51.91%), Query Frame = 2
Query:  416 LVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            ++  G S+ALLQ +   ++   P  D L  L ++L K+  +DK+IG +A   + L V + L R  +                 S  +N+L  L+ LR+++ ++   + LG  GA+ LL K+I    +     ++ + E L   +++K+N  RAVN+G +  LL L  DW+  D+ + ++ +R+ +L  ++ +  LRSG++AFL A G+  L+          ++E ++++   ILR+C+P + LPL    S    P+P   T
Sbjct:    1 MISKGGSEALLQTLVDTARTAPPDYDILLPLFRLLAKVGLRDKKIGRKALELEALDVTLILARKNL-----------------SHGQNLLHCLWALRVFASSVSMGAMLGINGAMELLFKVITPYTRKRTQAIRAATEVLAALLKSKSNGRRAVNRGYVTSLLGLHQDWHSHDTANAYVQIRRGLLLCLRHIAALRSGREAFLAAQGMEILFSTTQNCLDDKSMEPVISVVLQILRQCYPTSPLPLVTASSAYAFPVPGCIT 245          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Celegans
Match: ccpp-1 (Cytosolic carboxypeptidase 1 [Source:UniProtKB/Swiss-Prot;Acc:O76373])

HSP 1 Score: 318.161 bits (814), Expect = 2.116e-90
Identity = 177/471 (37.58%), Postives = 263/471 (55.84%), Query Frame = 2
Query: 2852 SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNN-NHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRS----YYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLL--SSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYG-QSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQA-FSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINES 4237
            S  LQFDS+FE GNLR  IQV    Y+L L+PDVN      QWF+F+VS M   V Y F I+NC K  S ++ GMQP++YS+ E+  G   W+R G  + Y++N +            +     YY+  F + F  + D+CYIAYHYPYTY+ L + L    ++   K +  +        +E  + H                     ++ GNP+ +LTI+        + R+   + L++RVHPGE+NASW+M+G ++ LL   SN +  +LR+ ++FKIVPM+NPDGV NG HRCS+AG DLNR W  P E L+P +F TK ++  L +   + P  + D HGHS++ + F++G +   SW  +D  +      + E++ +L LP  L     + F+   C FN+ ++KES+ARV VWRQFGV  +YT+EST+C F +G      IN   L+EIG     + L + ++
Sbjct:  584 SKDLQFDSRFESGNLRMVIQVAPTHYELFLSPDVNQLRDHYQWFFFQVSNMRKSVKYTFEIVNCLKSTSLYSQGMQPVMYSMMESANG---WRRVGENVCYFRNLYINENEEKKNVEEQKKKKYYYSIRFNVTFQNTGDICYIAYHYPYTYSFLNSSLSMLKKR---KQENVY-------CREDVIGH---------------------SLAGNPIKMLTITTPASAAEIAARE--VIVLSARVHPGETNASWIMQGILENLLCRQSNEMY-RLRESFIFKIVPMINPDGVTNGSHRCSLAGIDLNRMWDRPNEALHPEVFATKAIIQYLCEVANKKPFAYVDIHGHSKKWDYFVYGNNASESWRADDVLD--VGAAQLEEELHLALPKALEATCPSRFNASECRFNITRAKESSARVNVWRQFGVSTAYTLESTFCGFHKGQNSGYQINTSDLKEIGRDLLHSFLEMTKT 1015          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Celegans
Match: ccpp-6 (Cytosolic carboxypeptidase 6 [Source:UniProtKB/Swiss-Prot;Acc:Q09296])

HSP 1 Score: 191.045 bits (484), Expect = 4.972e-52
Identity = 157/519 (30.25%), Postives = 243/519 (46.82%), Query Frame = 2
Query: 2861 LQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQ-PLLYSVKEAMLGTSYWKRYGSE-IFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQ-ATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQ--KPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSP----MVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRS---YTMESTYCSFDQGNYKHLHIN--VPMLQ----EIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLT 4363
            L F++ FE GNL +  +V   EYDL + PD  NN    WFYF            FNI+N  K  + F  G+  P++ S  +     + W R  S  I+YY++           +  R   +F F+ E P   D    AY  PYTY ++   L++  ++K+ F                                  F+   L  T+    V ++TI     D +  T Q  K  +FLT+RVHPGES +S VM G I++L+S +  +++LR +Y FKI+PMLNPDGV  G +RCS+ G DLNR W  P +  +P+I+  K    LL++Y  +P    +++ D H HS++ N F++G             N + V++K+  +  L LPH+L ++S+ +S+E   FN +  K  T R    R  G   S   YT+E ++ S+   +     I    P LQ     +G  F  ALL+  E+       +    + + E  F T   +R++K  +   +KV  T
Sbjct:   19 LVFEASFESGNLGRVDKVSCSEYDLFIRPDTLNNKYRVWFYFECKNASENQRAIFNIVNFSKQRTLFEMGIAAPVVKSNAQ-----NSWARIPSRHIYYYRS---------SQHNDRWILSFAFIFESP---DPVQFAYCIPYTYGQMQIWLNELESRKYPF----------------------------------FHRDLLVQTVQKRRVDLITI-----DATPDTFQGSKKMIFLTARVHPGESPSSHVMHGIIEFLVSKDDRAQKLRKVYCFKIIPMLNPDGVFLGNYRCSLMGHDLNRMWRTPSDWAHPSIYAVKN---LLTQYDNNPQAQTVIYVDLHAHSQKPNCFLYG-----------NVNMSAVEEKSTFRQ-LWLPHLLADLSEDYSLEFTQFNTDVEKAGTGR----RTMGDLLSCLCYTLEVSFFSYRHTDSSGNGIQHCTPYLQYKYEALGEAFCRALLNFYEA-------DCGLREIVLERPFKTFLPARAQKTLKKQARKVIQT 455          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340677)

HSP 1 Score: 285.804 bits (730), Expect = 2.056e-81
Identity = 165/483 (34.16%), Postives = 257/483 (53.21%), Query Frame = 2
Query: 2843 PLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCG-GNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQE 4288
            P +   L+F+S+FE GNL KA+Q+    Y+L L PD+  +   QWFYFRV     ++ YRF+I+N  K +S +N GMQP++YS   A   +  W+R G  I YY+N    ++++    +   S YT TF IEF +  D  + A+ YPYTY+ L   L                               +E    P       ++ LC T+ GN V  LT++        + R+K  + +++RVHP E+ ASW+MKG +D++     ++++LR  ++FK+VPMLNPDGVI G  R S+ G+DLNR++        P+I++TK ++  L +     M +CD H HSR+ NIF++GC        E+  NP   ++K  ++ + L+ H   N +  FS ESC F +++SKE T R+VVW   G+  SYT+E+++     G+ K  H N    + +G  F E LL   +   N   ++A   K I++
Sbjct:  274 PEEYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYL-------------------------------MEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTA-PSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAM-YCDMHAHSRKHNIFIYGC--------ENKRNP---EKKLTEQVFPLMLH--KNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDYCDENPNKVKRHAKLFKQIKK 709          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340676)

HSP 1 Score: 286.574 bits (732), Expect = 2.115e-80
Identity = 169/503 (33.60%), Postives = 263/503 (52.29%), Query Frame = 2
Query: 2843 PLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCG-GNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIK 4348
            P +   L+F+S+FE GNL KA+Q+    Y+L L PD+  +   QWFYFRV     ++ YRF+I+N  K +S +N GMQP++YS   A   +  W+R G  I YY+N    ++++    +   S YT TF IEF +  D  + A+ YPYTY+ L   L                               +E    P       ++ LC T+ GN V  LT++        + R+K  + +++RVHP E+ ASW+MKG +D++     ++++LR  ++FK+VPMLNPDGVI G  R S+ G+DLNR++        P+I++TK ++  L +     M +CD H HSR+ NIF++GC        E+  NP   ++K  ++ + L+ H   N +  FS ESC F +++SKE T R+VVW   G+  SYT+E+++     G+ K  H N    + +G  F E LL   +   N   ++A   K I++         + EK  Q  +K
Sbjct:  439 PEEYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYL-------------------------------MEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVT-APSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAM-YCDMHAHSRKHNIFIYGC--------ENKRNP---EKKLTEQVFPLMLH--KNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDYCDENPNKVKRHAKLFKQIKKIR-------KREKREQKALK 887          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340673)

HSP 1 Score: 286.574 bits (732), Expect = 2.115e-80
Identity = 169/503 (33.60%), Postives = 263/503 (52.29%), Query Frame = 2
Query: 2843 PLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCG-GNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIK 4348
            P +   L+F+S+FE GNL KA+Q+    Y+L L PD+  +   QWFYFRV     ++ YRF+I+N  K +S +N GMQP++YS   A   +  W+R G  I YY+N    ++++    +   S YT TF IEF +  D  + A+ YPYTY+ L   L                               +E    P       ++ LC T+ GN V  LT++        + R+K  + +++RVHP E+ ASW+MKG +D++     ++++LR  ++FK+VPMLNPDGVI G  R S+ G+DLNR++        P+I++TK ++  L +     M +CD H HSR+ NIF++GC        E+  NP   ++K  ++ + L+ H   N +  FS ESC F +++SKE T R+VVW   G+  SYT+E+++     G+ K  H N    + +G  F E LL   +   N   ++A   K I++         + EK  Q  +K
Sbjct:  439 PEEYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYL-------------------------------MEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVT-APSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAM-YCDMHAHSRKHNIFIYGC--------ENKRNP---EKKLTEQVFPLMLH--KNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDYCDENPNKVKRHAKLFKQIKKIR-------KREKREQKALK 887          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340672)

HSP 1 Score: 286.574 bits (732), Expect = 3.785e-80
Identity = 165/483 (34.16%), Postives = 257/483 (53.21%), Query Frame = 2
Query: 2843 PLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCG-GNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQE 4288
            P +   L+F+S+FE GNL KA+Q+    Y+L L PD+  +   QWFYFRV     ++ YRF+I+N  K +S +N GMQP++YS   A   +  W+R G  I YY+N    ++++    +   S YT TF IEF +  D  + A+ YPYTY+ L   L                               +E    P       ++ LC T+ GN V  LT++        + R+K  + +++RVHP E+ ASW+MKG +D++     ++++LR  ++FK+VPMLNPDGVI G  R S+ G+DLNR++        P+I++TK ++  L +     M +CD H HSR+ NIF++GC        E+  NP   ++K  ++ + L+ H   N +  FS ESC F +++SKE T R+VVW   G+  SYT+E+++     G+ K  H N    + +G  F E LL   +   N   ++A   K I++
Sbjct:  463 PEEYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYL-------------------------------MEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTA-PSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAM-YCDMHAHSRKHNIFIYGC--------ENKRNP---EKKLTEQVFPLMLH--KNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDYCDENPNKVKRHAKLFKQIKK 898          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340675)

HSP 1 Score: 286.189 bits (731), Expect = 3.875e-79
Identity = 165/484 (34.09%), Postives = 260/484 (53.72%), Query Frame = 2
Query: 2843 PLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCG-GNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLM-MLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQE 4288
            P +   L+F+S+FE GNL KA+Q+    Y+L L PD+  +   QWFYFRV     ++ YRF+I+N  K +S +N GMQP++YS   A   +  W+R G  I YY+N    ++++    +   S YT TF IEF +  D  + A+ YPYTY+ L   L                               +E    P       ++ LC T+ GN V  LT++        + R+K  + +++RVHP E+ ASW+MKG +D++     ++++LR  ++FK+VPMLNPDGVI G  R S+ G+DLNR++        P+I++TK ++  L+ + G +  ++CD H HSR+ NIF++GC        E+  NP   ++K  ++ + L+ H   N +  FS ESC F +++SKE T R+VVW   G+  SYT+E+++     G+ K  H N    + +G  F E LL   +   N   ++A   K I++
Sbjct:  615 PEEYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYL-------------------------------MEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVT-APSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVA--MYCDMHAHSRKHNIFIYGC--------ENKRNP---EKKLTEQVFPLMLH--KNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDYCDENPNKVKRHAKLFKQIKK 1050          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Zebrafish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 513.072 bits (1320), Expect = 1.513e-163
Identity = 259/527 (49.15%), Postives = 338/527 (64.14%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPL--QSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE-LCTTILGNPVPVLTISNWLKDGS----SSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DILDK V+DL+                         ++S+PL     SL+F+S+FE GNLRKAIQVR++EYDLILN D+N+NH  QWFYF V  M   V YRFNIINCEK NSQFN+GMQ ++YSV+EA+ G+ +W R GS+I YYKNHFARS+   GG  G+SY+T TF + F +  DVCY AYHYPYTY+ L                             K    K+    TPE   ++Y QE LC T+ GN  P+LTI+   +  S    S  R +P +FL++RVHPGE+N+SWVMKG +++L+S +P ++ LR  Y+FKI+PMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+H K L+  L   G++P+VFCD+HGHSR+KN+FM+GCS   +      N  T      ED  Y  LP +L+ ++ AFS+ SCSF VE+SKE+TARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G QF  ALL +
Sbjct:  164 GVQRTKIFQDIERLIHSSDILDKVVYDLD-------------------------NQSSPLTDNGESLKFNSKFESGNLRKAIQVRKFEYDLILNSDINSNHYHQWFYFEVGNMRPGVRYRFNIINCEKSNSQFNYGMQVIMYSVQEAINGSPHWVRTGSDICYYKNHFARSSIAAGGQKGKSYFTMTFTVTFQHKDDVCYFAYHYPYTYSML-----------------------------KMHLQKLSALCTPE---IYYRQEDLCETLGGNGCPLLTITAMPESSSDEHISQFRSRPVIFLSARVHPGETNSSWVMKGSLEFLMSCSPQAQSLRQSYIFKIMPMLNPDGVINGNHRCSLSGEDLNRQWQNPNAELHPTIYHAKSLLQYLRATGRTPLVFCDYHGHSRKKNVFMYGCSIKETMWQSSVNTSTC--DLNEDLGYRTLPKLLSQMAPAFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTSELEEMGSQFCLALLRL 631          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Zebrafish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 516.538 bits (1329), Expect = 9.046e-160
Identity = 259/527 (49.15%), Postives = 338/527 (64.14%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQ--SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE-LCTTILGNPVPVLTISNWLKDGS----SSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DILDK V+DL+                         ++S+PL     SL+F+S+FE GNLRKAIQVR++EYDLILN D+N+NH  QWFYF V  M   V YRFNIINCEK NSQFN+GMQ ++YSV+EA+ G+ +W R GS+I YYKNHFARS+   GG  G+SY+T TF + F +  DVCY AYHYPYTY+ L                             K    K+    TPE   ++Y QE LC T+ GN  P+LTI+   +  S    S  R +P +FL++RVHPGE+N+SWVMKG +++L+S +P ++ LR  Y+FKI+PMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+H K L+  L   G++P+VFCD+HGHSR+KN+FM+GCS   +      N  T      ED  Y  LP +L+ ++ AFS+ SCSF VE+SKE+TARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G QF  ALL +
Sbjct:  595 GVQRTKIFQDIERLIHSSDILDKVVYDLD-------------------------NQSSPLTDNGESLKFNSKFESGNLRKAIQVRKFEYDLILNSDINSNHYHQWFYFEVGNMRPGVRYRFNIINCEKSNSQFNYGMQVIMYSVQEAINGSPHWVRTGSDICYYKNHFARSSIAAGGQKGKSYFTMTFTVTFQHKDDVCYFAYHYPYTYSML-----------------------------KMHLQKLSALCTPE---IYYRQEDLCETLGGNGCPLLTITAMPESSSDEHISQFRSRPVIFLSARVHPGETNSSWVMKGSLEFLMSCSPQAQSLRQSYIFKIMPMLNPDGVINGNHRCSLSGEDLNRQWQNPNAELHPTIYHAKSLLQYLRATGRTPLVFCDYHGHSRKKNVFMYGCSIKETMWQSSVNTSTC--DLNEDLGYRTLPKLLSQMAPAFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTSELEEMGSQFCLALLRL 1062          

HSP 2 Score: 209.149 bits (531), Expect = 3.542e-54
Identity = 126/354 (35.59%), Postives = 202/354 (57.06%), Query Frame = 2
Query:  131 LISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            L+SQL+ L +        +S+  +    R  T KIL LI+  E+  ++V  K  G ++ ++++L+   D QT+ NI+ I+NEL+     G+R    V  G +  LLQ +   SK+    E+ +  +H +L K+  KD++ GV+AR++  L V        +NL  HN  +           K +L  L VLR+YS N +N   LG+ GA+ +L +I+   +K +  +LKV+++TL   +++  N+ RAV++G +  LL ++ DW+R D++ +H+ +RKSIL  IK++ N++ G+KAF+EA G+  LY           L+ LV  SSLI+RKCFPKNRLPL    SV   PLP+
Sbjct:   18 LLSQLERLNE--------ESRVSDNDAIRQVTGKILHLIQTQEKTRKEVGSKGSGGMEIILSSLENTRDLQTTLNILGILNELL-TVGGGRRTGLFVSKGGTAILLQLLVSSSKDPPANEELMLHIHSLLVKVGPKDRKFGVKARLNGALNV-------TLNLAKHNLQNY----------KLLLPCLQVLRVYSSNSVNAVSLGKSGALEILFEIVGPFSKKSTTLLKVALDTLAALLKSGMNARRAVDRGHLPTLLAIYQDWHRNDTRHRHVIIRKSILGCIKNITNIKLGRKAFIEASGMRILYNTSTECLPVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSVFLYPLPH 345          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Zebrafish
Match: agbl1 (ATP/GTP binding protein-like 1 [Source:ZFIN;Acc:ZDB-GENE-110207-1])

HSP 1 Score: 464.151 bits (1193), Expect = 6.818e-143
Identity = 239/533 (44.84%), Postives = 330/533 (61.91%), Query Frame = 2
Query: 2672 LAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGS----SSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNK 4258
            + + K+ +DL+R+I  ED+++K VFD+                     DE  +   + +   SL+F S+FE GNLRKAIQVR +EYDLILN DVN++   QWFYF VS M + VPYRFNIINCEK NSQ N+GMQP+LYSV+EA+ G  +W R GSEI YY+N+F              +YT TF + F +  DVCY+AYHYPYTYT L T L                ++   D ++ F  H                Q LC T+ GN   ++TI+      +       R +P V LT+RVHPGESNASWV+KG +++L S +P++E LR+ Y+FKIVPMLNPDGVING +RCS+  +DLNR+W+ P   L+PTI+HTKG +  L+  G++P+VFCD+HGHSR+KN+F++GCS  +      + +P       ED  Y  +   L+ I+ AFS+ SC++ VEKS+ STARVVVWR+ GV RSYTMESTY   +QG YK L      L+E+G +F+++LL +  +  ++S++
Sbjct:  337 VQRKKVFEDLKRVICPEDMINKVVFDM---------------------DEPSLQCPSDVCPSSLRFFSKFESGNLRKAIQVRSHEYDLILNADVNSSAHCQWFYFEVSGMMANVPYRFNIINCEKGNSQCNYGMQPVLYSVREALEGRPHWLRTGSEICYYRNNFCPRRGQ-----KHPFYTLTFTVTFRHEDDVCYLAYHYPYTYTTLQTHLKM--------------LEKSVDPRKVFFRH----------------QNLCDTLGGNSCSLVTITACPTSRAWKHLHQLRNRPCVVLTARVHPGESNASWVLKGTLEFLCSDDPVAESLREAYIFKIVPMLNPDGVINGNNRCSLTAEDLNRQWLKPDPNLSPTIYHTKGFLYYLNSIGRTPLVFCDYHGHSRKKNVFLYGCS--MKETLWQSGSPINTASLKEDPGYRTIAKTLDRIAPAFSLNSCNYLVEKSRASTARVVVWREIGVLRSYTMESTYNGCNQGLYKGLQTGTQELEEMGLKFSQSLLTLRRNSAHYSSR 811          

HSP 2 Score: 70.0922 bits (170), Expect = 2.115e-11
Identity = 46/161 (28.57%), Postives = 80/161 (49.69%), Query Frame = 2
Query:  800 NMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSP 1282
            ++  +K + +     + +K N   AV +G +A LL+L+ DW+  D+  K++ +R+++L  +    +   G+ A +  DG+  L+    T  T   LESLV  +  ++RKC PK  LPLT   S    PLP+      +A + L D S  + +     +  P
Sbjct:    8 HLRTVKAAADAFTAMLCSKMNCRTAVAKGYIADLLKLYEDWHNNDTNLKNVPIRRALLYCLHLAASSSVGRDAIVAVDGISLLFQTTQTCLTMKGLESLVEPAIQLMRKCNPKIPLPLTSDRSAYSFPLPSRPVDDWEADLELYDGSSEDDSEEDAENEEP 168          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Zebrafish
Match: agbl1 (ATP/GTP binding protein-like 1 [Source:ZFIN;Acc:ZDB-GENE-110207-1])

HSP 1 Score: 464.922 bits (1195), Expect = 4.365e-142
Identity = 239/533 (44.84%), Postives = 330/533 (61.91%), Query Frame = 2
Query: 2672 LAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGS----SSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNK 4258
            + + K+ +DL+R+I  ED+++K VFD+                     DE  +   + +   SL+F S+FE GNLRKAIQVR +EYDLILN DVN++   QWFYF VS M + VPYRFNIINCEK NSQ N+GMQP+LYSV+EA+ G  +W R GSEI YY+N+F              +YT TF + F +  DVCY+AYHYPYTYT L T L                ++   D ++ F  H                Q LC T+ GN   ++TI+      +       R +P V LT+RVHPGESNASWV+KG +++L S +P++E LR+ Y+FKIVPMLNPDGVING +RCS+  +DLNR+W+ P   L+PTI+HTKG +  L+  G++P+VFCD+HGHSR+KN+F++GCS  +      + +P       ED  Y  +   L+ I+ AFS+ SC++ VEKS+ STARVVVWR+ GV RSYTMESTY   +QG YK L      L+E+G +F+++LL +  +  ++S++
Sbjct:  441 VQRKKVFEDLKRVICPEDMINKVVFDM---------------------DEPSLQCPSDVCPSSLRFFSKFESGNLRKAIQVRSHEYDLILNADVNSSAHCQWFYFEVSGMMANVPYRFNIINCEKGNSQCNYGMQPVLYSVREALEGRPHWLRTGSEICYYRNNFCPRRGQ-----KHPFYTLTFTVTFRHEDDVCYLAYHYPYTYTTLQTHLKM--------------LEKSVDPRKVFFRH----------------QNLCDTLGGNSCSLVTITACPTSRAWKHLHQLRNRPCVVLTARVHPGESNASWVLKGTLEFLCSDDPVAESLREAYIFKIVPMLNPDGVINGNNRCSLTAEDLNRQWLKPDPNLSPTIYHTKGFLYYLNSIGRTPLVFCDYHGHSRKKNVFLYGCS--MKETLWQSGSPINTASLKEDPGYRTIAKTLDRIAPAFSLNSCNYLVEKSRASTARVVVWREIGVLRSYTMESTYNGCNQGLYKGLQTGTQELEEMGLKFSQSLLTLRRNSAHYSSR 915          

HSP 2 Score: 95.9005 bits (237), Expect = 2.609e-19
Identity = 71/289 (24.57%), Postives = 139/289 (48.10%), Query Frame = 2
Query:  416 LVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSP 1282
            ++  G S+ALL  +   ++   P    L  L  +L K+  +D++IG++A+ +  + V++ L+R  V                   A+     L+VLR++  ++     LG+   ++++ ++++     ++  +K + +     + +K N   AV +G +A LL+L+ DW+  D+  K++ +R+++L  +    +   G+ A +  DG+  L+    T  T   LESLV  +  ++RKC PK  LPLT   S    PLP+      +A + L D S  + +     +  P
Sbjct:    1 MISKGGSEALLTALVNSARSFTPNYTILLPLLHLLAKVGHRDRQIGLKAQKADAVLVVLGLLRQNV-----------------ENARRAAACLWVLRVFCSSVTTAELLGKNRGLDVVFRLMSPHTTKHLRTVKAAADAFTAMLCSKMNCRTAVAKGYIADLLKLYEDWHNNDTNLKNVPIRRALLYCLHLAASSSVGRDAIVAVDGISLLFQTTQTCLTMKGLESLVEPAIQLMRKCNPKIPLPLTSDRSAYSFPLPSRPVDDWEADLELYDGSSEDDSEEDAENEEP 272          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Zebrafish
Match: agbl2 (ATP/GTP binding protein-like 2 [Source:NCBI gene;Acc:568152])

HSP 1 Score: 327.02 bits (837), Expect = 8.305e-96
Identity = 179/459 (39.00%), Postives = 258/459 (56.21%), Query Frame = 2
Query: 2849 QSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLM-MLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALL 4222
            + P+L F+S+FECGNL+KA+QV QY+Y+L L  D+      QWFYFRV  M   V YRF IIN  K +S +  GM PLLYS K A L    WKR GS I YY+N+  +         G++ Y+ T+ +EFPY  D CY+A+ YPYTY++L   L                                E  S P       ++ LC ++ GN V VLTI+       +  + K  V +T+RVHPGE+N SW+M+G +++LLS  P +  LR+ ++FK++PMLNPDGV+ G +RCS+AG+DLNR +        P I++T+ ++  LL++  +  +V+CDFHGHSR+ N+FM+GC           N      Q  +++ + L+  +  N    FS  SC F + KSKE T R+V+WR  G++ SYTMEST+     G+ K  H +   L+ +G  F + LL
Sbjct:  200 KEPTLAFESRFECGNLQKAVQVGQYDYELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNNIEQD--------GKALYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLR-------------------------------EVISDPVRAAYCKLRVLCRSLAGNAVYVLTITA-PSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNMVKRLLAE--REVVVYCDFHGHSRKNNVFMYGC-----------NERKDASQCLQERVFPLM--MSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGDRKGTHFSTLDLKSMGYCFCDTLL 602          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 519.235 bits (1336), Expect = 2.349e-161
Identity = 260/525 (49.52%), Postives = 339/525 (64.57%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + ++KI  D+ R+I   DI+D+ V+DL+             NS  +  DE EV          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M + V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G +I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L                             K    K+E    P+  + F  + LC T+ GN  PV+TI     SN+  +     R +PY+FL+SRVHPGE+NASWVMKG +++L+ S+  ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTKGL+  L+   ++P+V+CD+HGHSR+KN+FM+GCS +   +     N    D   ED  Y  LP +LN ++ AFS+ SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  547 GVQRSKIFQDIERMIHPNDIIDRVVYDLD-------------NSSCSAQDESEV----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTL-----------------------------KMHLKKLESLHNPQQ-VYFRQEVLCETLGGNGCPVITITAMPESNYY-EHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNANAASCDM-VEDSGYRTLPKVLNQLAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLLRL 1015          

HSP 2 Score: 183.341 bits (464), Expect = 4.391e-46
Identity = 116/362 (32.04%), Postives = 186/362 (51.38%), Query Frame = 2
Query:  116 MDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            M KS     L  LEK+ A    F S        R  T+KIL L +  E+  +++  K    ++ +++                           G+R   L+  G S+ LLQ +   SKE    E+ + +LH +L K+  KDK+ G++AR+S  L +        +NLV  N  +           + IL  L VLR+   N +N+  LG+ GA+ +L K+I    + N  ++KVS++T    +++K N+ +AV++G +  LL ++ DW+R D++ +H+ +RK IL  +KS+ N++ G+KAF++A+G+ TLY      +    L+ LV  SSLI+RKCFPKNRLPL    S  +  LP   T
Sbjct:    6 MAKSNYALLLSQLEKVNAEPLLFDSDNT-----RYVTAKILHLAQTQEKTRKEIAAKGSTGMEVILSG--------------------------GRRINALISKGGSRILLQLLLSASKESSSNEELMMVLHSLLAKVGPKDKKFGIKARVSGALNI-------SLNLVKQNLQN----------PRLILPCLQVLRVCCMNSVNSVYLGKNGAVEILFKLIGPFTRRNTGLIKVSLDTFAALLKSKTNARKAVDRGYVQALLSIYTDWHRHDTRHRHMLIRKGILQCLKSITNIKIGRKAFIDANGMKTLYNTSQECQAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSAFQFQLPIMPT 319          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 514.612 bits (1324), Expect = 1.550e-159
Identity = 260/527 (49.34%), Postives = 340/527 (64.52%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSP--SLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + ++KI  D+ R+I   DI+D+ V+DL+             +S+H            PL SP   L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M + V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G +I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L                             K    K+E    P+  + F  + LC T+ GN  PV+TI     SN+  +     R +PY+FL+SRVHPGE+NASWVMKG +++L+ S+  ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTKGL+  L+   ++P+V+CD+HGHSR+KN+FM+GCS +   +     N    D   ED  Y  LP +LN ++ AFS+ SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  522 GVQRSKIFQDIERMIHPNDIIDRVVYDLD------------NSSLH------------PLHSPLEVLKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTL-----------------------------KMHLKKLESLHNPQQ-VYFRQEVLCETLGGNGCPVITITAMPESNYY-EHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNANAASCDM-VEDSGYRTLPKVLNQLAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLLRL 991          

HSP 2 Score: 189.119 bits (479), Expect = 8.015e-48
Identity = 106/285 (37.19%), Postives = 167/285 (58.60%), Query Frame = 2
Query:  335 DSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            D QT  NI+ I+NEL   +  G+R   L+  G S+ LLQ +   SKE    E+ + +LH +L K+  KDK+ G++AR+S  L +        +NLV  N  +           + IL  L VLR+   N +N+  LG+ GA+ +L K+I    + N  ++KVS++T    +++K N+ +AV++G +  LL ++ DW+R D++ +H+ +RK IL  +KS+ N++ G+KAF++A+G+ TLY      +    L+ LV  SSLI+RKCFPKNRLPL    S  +  LP
Sbjct:   46 DLQTILNILNILNELASTAG-GRRINALISKGGSRILLQLLLSASKESSSNEELMMVLHSLLAKVGPKDKKFGIKARVSGALNI-------SLNLVKQNLQN----------PRLILPCLQVLRVCCMNSVNSVYLGKNGAVEILFKLIGPFTRRNTGLIKVSLDTFAALLKSKTNARKAVDRGYVQALLSIYTDWHRHDTRHRHMLIRKGILQCLKSITNIKIGRKAFIDANGMKTLYNTSQECQAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSAFQFQLP 312          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 515.768 bits (1327), Expect = 2.359e-159
Identity = 260/525 (49.52%), Postives = 339/525 (64.57%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + ++KI  D+ R+I   DI+D+ V+DL+             NS  +  DE EV          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M + V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G +I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L                             K    K+E    P+  + F  + LC T+ GN  PV+TI     SN+  +     R +PY+FL+SRVHPGE+NASWVMKG +++L+ S+  ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTKGL+  L+   ++P+V+CD+HGHSR+KN+FM+GCS +   +     N    D   ED  Y  LP +LN ++ AFS+ SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  585 GVQRSKIFQDIERMIHPNDIIDRVVYDLD-------------NSSCSAQDESEV----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTL-----------------------------KMHLKKLESLHNPQQ-VYFRQEVLCETLGGNGCPVITITAMPESNYY-EHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNANAASCDM-VEDSGYRTLPKVLNQLAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLLRL 1053          

HSP 2 Score: 148.288 bits (373), Expect = 3.499e-35
Identity = 95/313 (30.35%), Postives = 163/313 (52.08%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLY 1051
            L + SR+ S L  LEK+ A    F S        R  T+KIL L +  E+  +++  K    ++ +++                           G+R   L+  G S+ LLQ +   SKE    E+ + +LH +L K+  KDK+ G++AR+S  L +        +NLV  N  +           + IL  L VLR+   N +N+  LG+ GA+ +L K+I    + N  ++KVS++T    +++K N+ +AV++G +  LL ++ DW+R D++ +H+ +RK IL  +KS+ N++ G+KAF++A+G+ TLY
Sbjct:   12 LSNNSRIQSLLSQLEKVNAEPLLFDSDNT-----RYVTAKILHLAQTQEKTRKEIAAKGSTGMEVILSG--------------------------GRRINALISKGGSRILLQLLLSASKESSSNEELMMVLHSLLAKVGPKDKKFGIKARVSGALNI-------SLNLVKQNLQN----------PRLILPCLQVLRVCCMNSVNSVYLGKNGAVEILFKLIGPFTRRNTGLIKVSLDTFAALLKSKTNARKAVDRGYVQALLSIYTDWHRHDTRHRHMLIRKGILQCLKSITNIKIGRKAFIDANGMKTLY 276          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 514.998 bits (1325), Expect = 9.081e-159
Identity = 260/525 (49.52%), Postives = 339/525 (64.57%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + ++KI  D+ R+I   DI+D+ V+DL+             NS  +  DE EV          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M + V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G +I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L                             K    K+E    P+  + F  + LC T+ GN  PV+TI     SN+  +     R +PY+FL+SRVHPGE+NASWVMKG +++L+ S+  ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTKGL+  L+   ++P+V+CD+HGHSR+KN+FM+GCS +   +     N    D   ED  Y  LP +LN ++ AFS+ SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  609 GVQRSKIFQDIERMIHPNDIIDRVVYDLD-------------NSSCSAQDESEV----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTL-----------------------------KMHLKKLESLHNPQQ-VYFRQEVLCETLGGNGCPVITITAMPESNYY-EHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNANAASCDM-VEDSGYRTLPKVLNQLAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLLRL 1077          

HSP 2 Score: 190.274 bits (482), Expect = 3.872e-48
Identity = 123/359 (34.26%), Postives = 188/359 (52.37%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR+ S L  LEK+ A    F S        R  T+KIL L                              D QT  NI+ I+NEL   +  G+R   L+  G S+ LLQ +   SKE    E+ + +LH +L K+  KDK+ G++AR+S  L +        +NLV  N  +           + IL  L VLR+   N +N+  LG+ GA+ +L K+I    + N  ++KVS++T    +++K N+ +AV++G +  LL ++ DW+R D++ +H+ +RK IL  +KS+ N++ G+KAF++A+G+ TLY      +    L+ LV  SSLI+RKCFPKNRLPL    S  +  LP
Sbjct:    9 LSNNSRIQSLLSQLEKVNAEPLLFDSDNT-----RYVTAKILHL---------------------------NTRDLQTILNILNILNELASTAG-GRRINALISKGGSRILLQLLLSASKESSSNEELMMVLHSLLAKVGPKDKKFGIKARVSGALNI-------SLNLVKQNLQN----------PRLILPCLQVLRVCCMNSVNSVYLGKNGAVEILFKLIGPFTRRNTGLIKVSLDTFAALLKSKTNARKAVDRGYVQALLSIYTDWHRHDTRHRHMLIRKGILQCLKSITNIKIGRKAFIDANGMKTLYNTSQECQAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSAFQFQLP 317          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 516.153 bits (1328), Expect = 9.971e-159
Identity = 260/525 (49.52%), Postives = 339/525 (64.57%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + ++KI  D+ R+I   DI+D+ V+DL+             NS  +  DE EV          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M + V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G +I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L                             K    K+E    P+  + F  + LC T+ GN  PV+TI     SN+  +     R +PY+FL+SRVHPGE+NASWVMKG +++L+ S+  ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTKGL+  L+   ++P+V+CD+HGHSR+KN+FM+GCS +   +     N    D   ED  Y  LP +LN ++ AFS+ SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  664 GVQRSKIFQDIERMIHPNDIIDRVVYDLD-------------NSSCSAQDESEV----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTL-----------------------------KMHLKKLESLHNPQQ-VYFRQEVLCETLGGNGCPVITITAMPESNYY-EHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNANAASCDM-VEDSGYRTLPKVLNQLAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLLRL 1132          

HSP 2 Score: 212.616 bits (540), Expect = 4.848e-55
Identity = 127/359 (35.38%), Postives = 202/359 (56.27%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR+ S L  LEK+ A    F S        R  T+KIL L +  E+  +++  K    ++ ++ TL+   D QT  NI+ I+NEL   +  G+R   L+  G S+ LLQ +   SKE    E+ + +LH +L K+  KDK+ G++AR+S  L +        +NLV  N  +           + IL  L VLR+   N +N+  LG+ GA+ +L K+I    + N  ++KVS++T    +++K N+ +AV++G +  LL ++ DW+R D++ +H+ +RK IL  +KS+ N++ G+KAF++A+G+ TLY      +    L+ LV  SSLI+RKCFPKNRLPL    S  +  LP
Sbjct:   12 LSNNSRIQSLLSQLEKVNAEPLLFDSDNT-----RYVTAKILHLAQTQEKTRKEIAAKGSTGMEVILCTLENTRDLQTILNILNILNELASTAG-GRRINALISKGGSRILLQLLLSASKESSSNEELMMVLHSLLAKVGPKDKKFGIKARVSGALNI-------SLNLVKQNLQN----------PRLILPCLQVLRVCCMNSVNSVYLGKNGAVEILFKLIGPFTRRNTGLIKVSLDTFAALLKSKTNARKAVDRGYVQALLSIYTDWHRHDTRHRHMLIRKGILQCLKSITNIKIGRKAFIDANGMKTLYNTSQECQAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSAFQFQLP 347          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Mouse
Match: Agbl1 (ATP/GTP binding protein-like 1 [Source:MGI Symbol;Acc:MGI:3646469])

HSP 1 Score: 514.998 bits (1325), Expect = 2.081e-159
Identity = 256/533 (48.03%), Postives = 344/533 (64.54%), Query Frame = 2
Query: 2684 KILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQ---SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLS-WINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNK 4258
            KIL+D+RR++   D+++K VF L                          D+  PLQ   S  L F S+FE GNLRKAIQVR++EYDL++N DVN++   QWFYF+VS M + VPY FNIINCEKPNSQFN+GMQP LYSVKEA+LG   W R GS+I YYKNH+ ++AAT  G +G+ YYT TF + FP++ D CY+AYHYPYTY+ L+T L    +                D +E +  H +                LC T+ GNP P++TI+ + +  S+      R +PY  +T+RVHPGESNASWVMKG +++L+SS+P+++ LR+ +VFKI+PMLNPDGVING HRCS+ G+DLNR+W+ P   L PTI+H KGL+  LS  G+ P+VFCDFHGHS++KN+F++GCS   + W    T   + +    ED SY  LP IL+ ++ AF++ SCSF VEKS+ STARVVVWR+ GV RSYTMES+YC  +QG Y+ L      L+E+G  +   LL +    +N S+K
Sbjct:  557 KILEDIRRLLHPSDVINKVVFSL--------------------------DEPRPLQGSISNCLMFHSKFESGNLRKAIQVREFEYDLLVNADVNSSQHQQWFYFKVSGMRAAVPYHFNIINCEKPNSQFNYGMQPTLYSVKEALLGRPAWIRTGSDICYYKNHYRQNAATMDGALGKRYYTLTFAVTFPHNEDACYLAYHYPYTYSTLMTHLEILERSI--------------DHREIYFRHDV----------------LCQTLGGNPCPLVTITAFPESNSTEHLEQFRCRPYQVITARVHPGESNASWVMKGTLEFLVSSDPVAKLLRENFVFKIIPMLNPDGVINGNHRCSLRGEDLNRQWLSPQAHLQPTIYHAKGLLHYLSSTGRGPVVFCDFHGHSQKKNVFLYGCSMKETLWQAGCTVGESAL---LEDVSYRTLPKILDKLAPAFTMNSCSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQGLQFGTGELEEMGAMYCLGLLILELKSVNCSHK 1030          

HSP 2 Score: 151.369 bits (381), Expect = 2.720e-36
Identity = 86/301 (28.57%), Postives = 164/301 (54.49%), Query Frame = 2
Query:  299 IDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            +  L++TLQ  +D  ++ +I++++ +L+    T +R   ++  G S+ALLQ +   ++   P  D L  L ++L K+  +DK+ G +A   + L V + L R  +                 S ++N+L  L+VLR+++ ++   + LG  GA+ LL K+++   + +   ++ + E L   +++K+N  RAVN+G +  LL L  DW+  D  + ++ +R  +L  ++ ++ LRSG++AFL A G+ TL+    T   + N+E +++    ILR+C+P +RLPL    S    P P + +
Sbjct:    9 LQMLLHTLQNSSDKASTLSILQVLGDLL-SVGTDRRIYYMISKGGSEALLQTLVDTARSSSPDWDILLPLFRLLAKVGLRDKKFGQKALELEALDVTLILARKNL-----------------SHSQNLLHCLWVLRVFASSVTTGAMLGINGAMELLFKVLSPYTRKHTRTIRAATEVLAALLKSKSNCRRAVNRGYVNSLLRLHQDWHSRDVTNTYVTIRHGLLLCLRHIVALRSGREAFLAAQGMETLFSIAQTCLENKNMELVISAVIQILRQCYPASRLPLVTASSAYTFPAPGSTS 291          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Mouse
Match: Agtpbp1 (ATP/GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:2159437])

HSP 1 Score: 515.383 bits (1326), Expect = 5.507e-159
Identity = 258/526 (49.05%), Postives = 336/526 (63.88%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCS-PLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DI+D+ V+DL+             N  +T          TP +  +L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L   L                              K+E    P+  I F    LC T+ GN  P++TI     SN+ +      R +PY+FL++RVHPGE+NASWVMKG ++YL+S++P ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W  P   L+PTI+H KGL+  L+   + P+V+CD+HGHSR+KN+FM+GCS     W   D +    +    ED  Y  LP IL++I+ AF + SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  661 GVQRTKIAQDIERLIHQNDIIDRVVYDLD-------------NPTYT----------TPEEGDTLKFNSKFESGNLRKVIQIRKSEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQ-----------------------------KLESAHNPQQ-IYFRKDVLCETLSGNICPLVTITAMPESNYYEH-ICQFRTRPYIFLSARVHPGETNASWVMKGTLEYLMSNSPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPNPELHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTHDNSASCDI---VEDMGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGRYKGLQIGTRELEEMGAKFCVGLLRL 1129          

HSP 2 Score: 216.468 bits (550), Expect = 2.047e-56
Identity = 130/359 (36.21%), Postives = 205/359 (57.10%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR++  L  LEKI  + +       E  T R  TSKIL L +  E+  R++  K    ++ L++TL+   D QT  NI+ I+ ELV  S  G+RA  LV  G S+ LLQ +   SK+  P E+ +   H +L KI  KDK+ GV+AR++  L V ++L++                       + +L  L +LR+YS N +N+  LG+ G + L+ KII   +K N  ++KV+++TL   +++K N+ RAV++G + +LL +++DW+R D++ +++ +RK IL  +KS+ N++ G+KAF++A+G+  LY           L+ LV  SSLI+RKCFPKNRLPL    S     LP
Sbjct:   12 LTNSSRVVGLLAQLEKINTDST-------ESDTARYVTSKILHLAQSQEKTRREMTTKGSTGMEVLLSTLENTKDLQTVLNILSILIELV-SSGGGRRASFLVAKGGSQILLQLLMNASKDSPPHEEVMVQTHSILAKIGPKDKKFGVKARVNGALTVTLNLVKQHFQNY-----------------RLVLPCLQLLRVYSTNSVNSVSLGKNGVVELMFKIIGPFSKKNSGLMKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLP 345          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Mouse
Match: Agtpbp1 (ATP/GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:2159437])

HSP 1 Score: 515.768 bits (1327), Expect = 8.206e-159
Identity = 258/526 (49.05%), Postives = 336/526 (63.88%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCS-PLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DI+D+ V+DL+             N  +T          TP +  +L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L   L                              K+E    P+  I F    LC T+ GN  P++TI     SN+  +     R +PY+FL++RVHPGE+NASWVMKG ++YL+S++P ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W  P   L+PTI+H KGL+  L+   + P+V+CD+HGHSR+KN+FM+GCS     W   D +    +    ED  Y  LP IL++I+ AF + SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  661 GVQRTKIAQDIERLIHQNDIIDRVVYDLD-------------NPTYT----------TPEEGDTLKFNSKFESGNLRKVIQIRKSEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQ-----------------------------KLESAHNPQQ-IYFRKDVLCETLSGNICPLVTITAMPESNYY-EHICQFRTRPYIFLSARVHPGETNASWVMKGTLEYLMSNSPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPNPELHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTHDNSASCDI---VEDMGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGRYKGLQIGTRELEEMGAKFCVGLLRL 1129          

HSP 2 Score: 216.853 bits (551), Expect = 1.911e-56
Identity = 130/359 (36.21%), Postives = 205/359 (57.10%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR++  L  LEKI  + +       E  T R  TSKIL L +  E+  R++  K    ++ L++TL+   D QT  NI+ I+ ELV  S  G+RA  LV  G S+ LLQ +   SK+  P E+ +   H +L KI  KDK+ GV+AR++  L V ++L++                       + +L  L +LR+YS N +N+  LG+ G + L+ KII   +K N  ++KV+++TL   +++K N+ RAV++G + +LL +++DW+R D++ +++ +RK IL  +KS+ N++ G+KAF++A+G+  LY           L+ LV  SSLI+RKCFPKNRLPL    S     LP
Sbjct:   12 LTNSSRVVGLLAQLEKINTDST-------ESDTARYVTSKILHLAQSQEKTRREMTTKGSTGMEVLLSTLENTKDLQTVLNILSILIELV-SSGGGRRASFLVAKGGSQILLQLLMNASKDSPPHEEVMVQTHSILAKIGPKDKKFGVKARVNGALTVTLNLVKQHFQNY-----------------RLVLPCLQLLRVYSTNSVNSVSLGKNGVVELMFKIIGPFSKKNSGLMKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLP 345          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Mouse
Match: Agbl1 (ATP/GTP binding protein-like 1 [Source:MGI Symbol;Acc:MGI:3646469])

HSP 1 Score: 499.204 bits (1284), Expect = 7.804e-158
Identity = 247/500 (49.40%), Postives = 329/500 (65.80%), Query Frame = 2
Query: 2684 KILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQ---SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLS-WINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYK 4159
            KIL+D+RR++   D+++K VF L                          D+  PLQ   S  L F S+FE GNLRKAIQVR++EYDL++N DVN++   QWFYF+VS M + VPY FNIINCEKPNSQFN+GMQP LYSVKEA+LG   W R GS+I YYKNH+ ++AAT  G +G+ YYT TF + FP++ D CY+AYHYPYTY+ L+T L    +                D +E +  H +                LC T+ GNP P++TI+ + +  S+      R +PY  +T+RVHPGESNASWVMKG +++L+SS+P+++ LR+ +VFKI+PMLNPDGVING HRCS+ G+DLNR+W+ P   L PTI+H KGL+  LS  G+ P+VFCDFHGHS++KN+F++GCS   + W    T   + +    ED SY  LP IL+ ++ AF++ SCSF VEKS+ STARVVVWR+ GV RSYTMES+YC  +QG Y+
Sbjct:  305 KILEDIRRLLHPSDVINKVVFSL--------------------------DEPRPLQGSISNCLMFHSKFESGNLRKAIQVREFEYDLLVNADVNSSQHQQWFYFKVSGMRAAVPYHFNIINCEKPNSQFNYGMQPTLYSVKEALLGRPAWIRTGSDICYYKNHYRQNAATMDGALGKRYYTLTFAVTFPHNEDACYLAYHYPYTYSTLMTHLEILERSI--------------DHREIYFRHDV----------------LCQTLGGNPCPLVTITAFPESNSTEHLEQFRCRPYQVITARVHPGESNASWVMKGTLEFLVSSDPVAKLLRENFVFKIIPMLNPDGVINGNHRCSLRGEDLNRQWLSPQAHLQPTIYHAKGLLHYLSSTGRGPVVFCDFHGHSQKKNVFLYGCSMKETLWQAGCTVGESAL---LEDVSYRTLPKILDKLAPAFTMNSCSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQ 745          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Mouse
Match: Agbl1 (ATP/GTP binding protein-like 1 [Source:MGI Symbol;Acc:MGI:3646469])

HSP 1 Score: 386.726 bits (992), Expect = 8.759e-118
Identity = 190/395 (48.10%), Postives = 254/395 (64.30%), Query Frame = 2
Query: 2684 KILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQ---SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMV 3847
            KIL+D+RR++   D+++K VF L                          D+  PLQ   S  L F S+FE GNLRKAIQVR++EYDL++N DVN++   QWFYF+VS M + VPY FNIINCEKPNSQFN+GMQP LYSVKEA+LG   W R GS+I YYKNH+ ++AAT  G +G+ YYT TF + FP++ D CY+AYHYPYTY+ L+T L    +                D +E +  H +                LC T+ GNP P++TI+ + +  S+      R +PY  +T+RVHPGESNASWVMKG +++L+SS+P+++ LR+ +VFKI+PMLNPDGVING HRCS+ G+DLNR+W+ P   L PTI+H KGL+  LS  G+ P+V
Sbjct:  305 KILEDIRRLLHPSDVINKVVFSL--------------------------DEPRPLQGSISNCLMFHSKFESGNLRKAIQVREFEYDLLVNADVNSSQHQQWFYFKVSGMRAAVPYHFNIINCEKPNSQFNYGMQPTLYSVKEALLGRPAWIRTGSDICYYKNHYRQNAATMDGALGKRYYTLTFAVTFPHNEDACYLAYHYPYTYSTLMTHLEILERSI--------------DHREIYFRHDV----------------LCQTLGGNPCPLVTITAFPESNSTEHLEQFRCRPYQVITARVHPGESNASWVMKGTLEFLVSSDPVAKLLRENFVFKIIPMLNPDGVINGNHRCSLRGEDLNRQWLSPQAHLQPTIYHAKGLLHYLSSTGRGPVV 643          
BLAST of ATP/GTP binding protein 1 vs. UniProt/SwissProt
Match: sp|Q4U2V3|CBPC1_DANRE (Cytosolic carboxypeptidase 1 OS=Danio rerio OX=7955 GN=agtpbp1 PE=2 SV=1)

HSP 1 Score: 516.924 bits (1330), Expect = 5.338e-159
Identity = 259/527 (49.15%), Postives = 338/527 (64.14%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQ--SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE-LCTTILGNPVPVLTISNWLKDGS----SSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DILDK V+DL+                         ++S+PL     SL+F+S+FE GNLRKAIQVR++EYDLILN D+N+NH  QWFYF V  M   V YRFNIINCEK NSQFN+GMQ ++YSV+EA+ G+ +W R GS+I YYKNHFARS+   GG  G+SY+T TF + F +  DVCY AYHYPYTY+ L                             K    K+    TPE   ++Y QE LC T+ GN  P+LTI+   +  S    S  R +P +FL++RVHPGE+N+SWVMKG +++L+S +P ++ LR  Y+FKI+PMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+H K L+  L   G++P+VFCD+HGHSR+KN+FM+GCS   +      N  T      ED  Y  LP +L+ ++ AFS+ SCSF VE+SKE+TARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G QF  ALL +
Sbjct:  595 GVQRTKIFQDIERLIHSSDILDKVVYDLD-------------------------NQSSPLTDNGESLKFNSKFESGNLRKAIQVRKFEYDLILNSDINSNHYHQWFYFEVGNMRPGVRYRFNIINCEKSNSQFNYGMQVIMYSVQEAINGSPHWVRTGSDICYYKNHFARSSIAAGGQKGKSYFTMTFTVTFQHKDDVCYFAYHYPYTYSML-----------------------------KMHLQKLSALCTPE---IYYRQEDLCETLGGNGCPLLTITAMPESSSDEHISQFRSRPVIFLSARVHPGETNSSWVMKGSLEFLMSCSPQAQSLRQSYIFKIMPMLNPDGVINGNHRCSLSGEDLNRQWQNPNAELHPTIYHAKSLLQYLRATGRTPLVFCDYHGHSRKKNVFMYGCSIKETMWQSSVNTSTC--DLNEDLGYRTLPKLLSQMAPAFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTSELEEMGSQFCLALLRL 1062          

HSP 2 Score: 209.149 bits (531), Expect = 2.768e-53
Identity = 126/354 (35.59%), Postives = 202/354 (57.06%), Query Frame = 2
Query:  131 LISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            L+SQL+ L +        +S+  +    R  T KIL LI+  E+  ++V  K  G ++ ++++L+   D QT+ NI+ I+NEL+     G+R    V  G +  LLQ +   SK+    E+ +  +H +L K+  KD++ GV+AR++  L V        +NL  HN  +           K +L  L VLR+YS N +N   LG+ GA+ +L +I+   +K +  +LKV+++TL   +++  N+ RAV++G +  LL ++ DW+R D++ +H+ +RKSIL  IK++ N++ G+KAF+EA G+  LY           L+ LV  SSLI+RKCFPKNRLPL    SV   PLP+
Sbjct:   18 LLSQLERLNE--------ESRVSDNDAIRQVTGKILHLIQTQEKTRKEVGSKGSGGMEIILSSLENTRDLQTTLNILGILNELL-TVGGGRRTGLFVSKGGTAILLQLLVSSSKDPPANEELMLHIHSLLVKVGPKDRKFGVKARLNGALNV-------TLNLAKHNLQNY----------KLLLPCLQVLRVYSSNSVNAVSLGKSGALEILFEIVGPFSKKSTTLLKVALDTLAALLKSGMNARRAVDRGYLPTLLAIYQDWHRNDTRHRHVIIRKSILGCIKNITNIKLGRKAFIEASGMRILYNTSTECLPVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSVFLYPLPH 345          
BLAST of ATP/GTP binding protein 1 vs. UniProt/SwissProt
Match: sp|Q6DD21|CBPC1_XENLA (Cytosolic carboxypeptidase 1 OS=Xenopus laevis OX=8355 GN=agtpbp1 PE=2 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 7.947e-159
Identity = 260/525 (49.52%), Postives = 341/525 (64.95%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + ++KI  D+ R+I   DI+D+ ++DL+          N   S H   DE+++          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M + V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L                             K    K+E   +P+  I F  + LC T+ GN  PV+TI     SN+  +     R +PY+FLTSRVHPGE+NASWVMKG +++L+ S+  ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTKGL+  LS   + P+V+CD+HGHSR+KN+FM+GCS +   +     N    D   E+  Y  LP +LN I+ AFS+ SCSF VEKSKESTARVVVW++ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  663 GVQRSKIFQDIERMIHPNDIIDRVIYDLD----------NPSCSAH---DEIDI----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGTDICYYKNHFSRSSLATGGQKGKSYYTITFTVTFPHKDDVCYFAYHYPYTYSTL-----------------------------KMHLQKLESLHSPQQ-IYFRQEVLCETLGGNGCPVITITAMPESNYY-EHVYQFRNRPYIFLTSRVHPGETNASWVMKGTLEFLMGSSATAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNSDLHPTIYHTKGLLQYLSAIKRVPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNANAASCDM-VEESGYKTLPKVLNQIAPAFSMSSCSFVVEKSKESTARVVVWKEIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLLRL 1131          

HSP 2 Score: 207.994 bits (528), Expect = 7.620e-53
Identity = 125/359 (34.82%), Postives = 201/359 (55.99%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            SR+ S L  LEK+ A    F     +    R  T+KI  L +  E+  +++  K    I+ ++ TL+   D QT  NI+ I+NEL   +  G+R   L+  G ++ LLQ +   SKE    E+ + +LH +L K+  KDK+ GV+AR+S  L +        +NLV  N  +           + IL  L VLR+   N +N++ LG+ GA+ +L KII    + N  ++KVS++TL   ++++ N+ +AV++  +  L+  ++DW+R D++ +H+ +RK IL  +KS+ N++ G+KAF++A+G+ TLY      +    L+ LV  SSLI+RKCFPKNRLPL    S  +  LP   T
Sbjct:   16 SRIQSLLSQLEKVNAESLLF-----DTDNTRYVTAKIFHLAQTQEKTRKEMTAKGSTGIEVILCTLENTRDLQTILNILNILNELASTAG-GRRINALISKGGARILLQLLLSASKESPSNEELMIVLHSLLAKLGPKDKKFGVKARVSGALNI-------SLNLVKQNLQN----------PRLILPCLQVLRVCCMNSVNSAYLGKNGAVEILFKIIGPFTRRNTGLIKVSLDTLAALLKSRTNARKAVDRAYVQTLISTYMDWHRHDTRHRHMLIRKGILQCLKSITNIKIGRKAFIDANGMKTLYNTSQECQAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSAFQFQLPFMPT 351          
BLAST of ATP/GTP binding protein 1 vs. UniProt/SwissProt
Match: sp|Q09M05|CBPC4_MOUSE (Cytosolic carboxypeptidase 4 OS=Mus musculus OX=10090 GN=Agbl1 PE=1 SV=3)

HSP 1 Score: 514.612 bits (1324), Expect = 1.681e-158
Identity = 256/533 (48.03%), Postives = 344/533 (64.54%), Query Frame = 2
Query: 2684 KILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQ---SPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLS-WINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNK 4258
            KIL+D+RR++   D+++K VF L                          D+  PLQ   S  L F S+FE GNLRKAIQVR++EYDL++N DVN++   QWFYF+VS M + VPY FNIINCEKPNSQFN+GMQP LYSVKEA+LG   W R GS+I YYKNH+ ++AAT  G +G+ YYT TF + FP++ D CY+AYHYPYTY+ L+T L    +                D +E +  H +                LC T+ GNP P++TI+ + +  S+      R +PY  +T+RVHPGESNASWVMKG +++L+SS+P+++ LR+ +VFKI+PMLNPDGVING HRCS+ G+DLNR+W+ P   L PTI+H KGL+  LS  G+ P+VFCDFHGHS++KN+F++GCS   + W    T   + +    ED SY  LP IL+ ++ AF++ SCSF VEKS+ STARVVVWR+ GV RSYTMES+YC  +QG Y+ L      L+E+G  +   LL +    +N S+K
Sbjct:  557 KILEDIRRLLHPSDVINKVVFSL--------------------------DEPRPLQGSISNCLMFHSKFESGNLRKAIQVREFEYDLLVNADVNSSQHQQWFYFKVSGMRAAVPYHFNIINCEKPNSQFNYGMQPTLYSVKEALLGRPAWIRTGSDICYYKNHYRQNAATMDGALGKRYYTLTFAVTFPHNEDACYLAYHYPYTYSTLMTHLEILERSI--------------DHREIYFRHDV----------------LCQTLGGNPCPLVTITAFPESNSTEHLEQFRCRPYQVITARVHPGESNASWVMKGTLEFLVSSDPVAKLLRENFVFKIIPMLNPDGVINGNHRCSLRGEDLNRQWLSPQAHLQPTIYHAKGLLHYLSSTGRGPVVFCDFHGHSQKKNVFLYGCSMKETLWQAGCTVGESAL---LEDVSYRTLPKILDKLAPAFTMNSCSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQGLQFGTGELEEMGAMYCLGLLILELKSVNCSHK 1030          

HSP 2 Score: 145.976 bits (367), Expect = 9.901e-34
Identity = 84/301 (27.91%), Postives = 162/301 (53.82%), Query Frame = 2
Query:  299 IDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            +  L++TLQ  +D  ++ +I++++ +L+    T +R   ++  G S+ALLQ +   ++   P  D L  L ++L K+  +DK+ G +A   + L V + L R  +                 S ++N+L  L+VLR+++ ++   + LG  GA+ LL K+++   + +   ++ + E L   +++  +  RAVN+G +  LL L  DW+  D  + ++ +R  +L  ++ ++ LRSG++AFL A G+ TL+    T   + N+E +++    ILR+C+P +RLPL    S    P P + +
Sbjct:    9 LQMLLHTLQNSSDKASTLSILQVLGDLL-SVGTDRRIYYMISKGGSEALLQTLVDTARSSSPDWDILLPLFRLLAKVGLRDKKFGQKALELEALDVTLILARKNL-----------------SHSQNLLHCLWVLRVFASSVTTGAMLGINGAMELLFKVLSPYTRKHTRTIRAATEVLAALLKSSKHLRRAVNRGYVNSLLRLHQDWHSRDVTNTYVTIRHGLLLCLRHIVALRSGREAFLAAQGMETLFSSAQTCLENKNMELVISAVIQILRQCYPASRLPLVTASSAYTFPAPGSTS 291          
BLAST of ATP/GTP binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9UPW5|CBPC1_HUMAN (Cytosolic carboxypeptidase 1 OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=3)

HSP 1 Score: 516.924 bits (1330), Expect = 2.919e-158
Identity = 258/525 (49.14%), Postives = 335/525 (63.81%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DI+D+ V+DL+                         + + P +   L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G++I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L   L                              K+E    P+  I F    LC T+ GN  P++TI     SN+  +     R +PYVFL++RVHPGE+NASWVMKG ++YL+S+NP ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W  P   L+PTI+H KGL+  L+   + P+V+CD+HGHSR+KN+FM+GCS +   +    +N T  D   ED  Y  LP IL++I+ AF + SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  669 GVQRTKIAQDIERLIHQSDIIDRVVYDLD-----------------------NPNYTIPEEGDILKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQ-----------------------------KLESAHNPQQ-IYFRKDVLCETLSGNSCPLVTITAMPESNYY-EHICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNDNATSCDV-VEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRL 1137          

HSP 2 Score: 223.402 bits (568), Expect = 1.251e-57
Identity = 135/359 (37.60%), Postives = 210/359 (58.50%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR++  L  LEKI A  S       E  T R  TSKIL L +  E+  R++  K    ++ L++TL+   D QT+ NI+ I+ ELV  +  G+R   LV  G S+ LLQ +   SKE  P ED +  +H +L KI  KDK+ GV+ARI+  L + ++L++   NL  H               + +L  L +LR+YS N +N+  LG+ G + L+ KII   +K N +++KV+++TL   +++K N+ RAV++G + +LL +++DW+R D++ +++ +RK IL  +KS+ N++ G+KAF++A+G+  LY           L+ LV  SSLI+RKCFPKNRLPL    S     LP
Sbjct:   12 LTNNSRIVGLLAQLEKINAEPS-------ESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEILLSTLENTKDLQTTLNILSILVELVS-AGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILAKIGPKDKKFGVKARINGALNITLNLVKQ--NLQNH---------------RLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIGPFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLP 345          
BLAST of ATP/GTP binding protein 1 vs. UniProt/SwissProt
Match: sp|A9JRL3|CBPC1_XENTR (Cytosolic carboxypeptidase 1 OS=Xenopus tropicalis OX=8364 GN=agtpbp1 PE=2 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 5.282e-158
Identity = 260/525 (49.52%), Postives = 339/525 (64.57%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI-----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + ++KI  D+ R+I   DI+D+ V+DL+             NS  +  DE EV          L+F+S+FE GNLRK IQ+R+ EYDLILN D+N+NH  QWFYF VS M + V YRFNIINCEK NSQFN+GMQPL+YSV+EA+    +W R G +I YYKNHF+RS+   GG  G+SYYT TF + FP+  DVCY AYHYPYTY+ L                             K    K+E    P+  + F  + LC T+ GN  PV+TI     SN+  +     R +PY+FL+SRVHPGE+NASWVMKG +++L+ S+  ++ LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTKGL+  L+   ++P+V+CD+HGHSR+KN+FM+GCS +   +     N    D   ED  Y  LP +LN ++ AFS+ SCSF VEKSKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G +F   LL +
Sbjct:  664 GVQRSKIFQDIERMIHPNDIIDRVVYDLD-------------NSSCSAQDESEV----------LKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTL-----------------------------KMHLKKLESLHNPQQ-VYFRQEVLCETLGGNGCPVITITAMPESNYY-EHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCS-IKETVWHTNANAASCDM-VEDSGYRTLPKVLNQLAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLLRL 1132          

HSP 2 Score: 212.616 bits (540), Expect = 2.568e-54
Identity = 127/359 (35.38%), Postives = 202/359 (56.27%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            L + SR+ S L  LEK+ A    F S        R  T+KIL L +  E+  +++  K    ++ ++ TL+   D QT  NI+ I+NEL   +  G+R   L+  G S+ LLQ +   SKE    E+ + +LH +L K+  KDK+ G++AR+S  L +        +NLV  N  +           + IL  L VLR+   N +N+  LG+ GA+ +L K+I    + N  ++KVS++T    +++K N+ +AV++G +  LL ++ DW+R D++ +H+ +RK IL  +KS+ N++ G+KAF++A+G+ TLY      +    L+ LV  SSLI+RKCFPKNRLPL    S  +  LP
Sbjct:   12 LSNNSRIQSLLSQLEKVNAEPLLFDSDNT-----RYVTAKILHLAQTQEKTRKEIAAKGSTGMEVILCTLENTRDLQTILNILNILNELASTAG-GRRINALISKGGSRILLQLLLSASKESSSNEELMMVLHSLLAKVGPKDKKFGIKARVSGALNI-------SLNLVKQNLQN----------PRLILPCLQVLRVCCMNSVNSVYLGKNGAVEILFKLIGPFTRRNTGLIKVSLDTFAALLKSKTNARKAVDRGYVQALLSIYTDWHRHDTRHRHMLIRKGILQCLKSITNIKIGRKAFIDANGMKTLYNTSQECQAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSAFQFQLP 347          
BLAST of ATP/GTP binding protein 1 vs. TrEMBL
Match: R7TRE8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228599 PE=4 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 283/521 (54.32%), Postives = 358/521 (68.71%), Query Frame = 2
Query: 2678 QNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISN----WLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
            + KI +D+ R I+ E  LD+ V+DL++I+ +  ++Y    S H+N DE  V   +  +   L F+SQFE GNLRKAIQVRQYEYDLILNPDVN NH  QWFYF VS ME+ V YRFNI+NCEK NSQFNFGM+P++YSV EAM G  +W R GSEI YYKNHF RS+ T GG  G+ Y+T TF + F +  DVCYIAYHYPY YT ++  L               DV+   DS +                I +  Q+L  T+ GN VPVLTI++    + K G    + + Y++L+SRVHPGESNASWVM+G I++L+S  P ++ LRD+Y+FKIVPMLNPDGVING HRCS+  +DLNRRW+ PC  L+PTIFH+KGL+  L+   +SP+VFCD+HGHSRRKN+F++GCSP LSW+  D NNP  V  + ED+ Y  LP IL  ++ AFS  +C+F VEKSKESTARVVVWR+ GV RSYTMESTYC  DQGNYK  HIN    +E+G +F EAL  +
Sbjct:  667 RQKIFEDIDRFINPEKPLDRVVYDLDSIVSTAGSTYTSAYSTHSNDDEERVRNRSYCEH--LGFNSQFESGNLRKAIQVRQYEYDLILNPDVNTNHHHQWFYFEVSQMEAGVRYRFNIVNCEKVNSQFNFGMRPVVYSVVEAMNGRPHWLRSGSEICYYKNHFVRSSQTTGGVRGKVYFTGTFTMTFKHERDVCYIAYHYPYPYTTMMYHLQ--------------DVEKNYDSSQ----------------IFYKRQKLTQTLAGNDVPVLTITSHPHTYDKKGIQQLKNRSYIYLSSRVHPGESNASWVMRGTINFLMSDKPSAQALRDMYIFKIVPMLNPDGVINGNHRCSLTAEDLNRRWLHPCPHLHPTIFHSKGLLQYLNLINRSPLVFCDYHGHSRRKNVFLYGCSPSLSWMTNDFNNPAVVGNRMEDQGYKTLPKILQTLAPAFSFSNCNFVVEKSKESTARVVVWRECGVMRSYTMESTYCGCDQGNYKGYHINTRQHEEMGRRFCEALARV 1155          

HSP 2 Score: 286.96 bits (733), Expect = 3.648e-75
Identity = 151/363 (41.60%), Postives = 232/363 (63.91%), Query Frame = 2
Query:  122 KSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPE-RIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFH 1207
            +SRL+S    L++I + K+  K+ +EE+   R  +SKIL  +   + +I+RD+I K+VG ID L+  L T  D  T+ NI+ I++E+VGK+NTGKRA  LV  G S  LLQ I  ESKE    E+ LF +HQVL KI  KD++ GV+AR+S  L V ++L++   NL                  K +  +++VL+LY+ N +N S LG+ GAI+ L K++    +  + + K +++T+   V++K+NSARA+ QG + +LL ++ DW+R+D+K++H+N+RK+IL  +K + NLRSG++A +EADG+  LY FC        LE+LV ++S+I+RKCFP+NRLPL    SV+   LP +  FH
Sbjct:    4 QSRLMSFFQSLDRILSQKNGAKTTQEEVQQIRCLSSKILQHVSSSQDKIHRDIIAKNVGYIDLLLTVLATSRDGCTTQNIVYILSEVVGKTNTGKRASCLVAQGASHVLLQLIVYESKESQVSEELLFSVHQVLSKIGPKDRKFGVKARLSGALSVTLNLVKNLTNL------------------KILHPVVHVLKLYAINSVNASYLGKNGAISHLFKLLALSNRKYVTLSKYALDTMVQLVKSKSNSARAIGQGGVPLLLTMYADWHRVDTKNRHVNIRKAILSTLKHITNLRSGRRALIEADGVSLLYSFCQEVADSRELETLVFMASIIMRKCFPRNRLPLVSLRSVVGFSLPQSE-FH 347          
BLAST of ATP/GTP binding protein 1 vs. TrEMBL
Match: A0A2C9KMQ5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106053985 PE=4 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 3.309e-178
Identity = 278/529 (52.55%), Postives = 365/529 (69.00%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIH-TNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYI--QELCTTILGNPVPVLTIS----NWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINE 4234
             + ++KI +D+ R+I  + ++D  V+D + I+  T  S  M + ++  N DEL +       S +L+F+SQFECGNLRKA+QVR++EYDLILNPD+N+NH  QWFYF VS M+  +PYRFNI+NCEKPNSQFNFGMQPLL SV EA+ G   W R G++I YY+NHF R A T GG  G+SYYT TF I+FP+S DVCYI+YHYPYTY+ L+T L Q  +++                                D  L Y   Q LC T+ GNPVP+LTI+    +  K+     R +PY+FL+SRVHPGESNASW+MKG ID+LLS  P ++++R++++FK++PMLNPDGVING HR S+ G+DLNRRW +PC VL+PTI+HTKGL+  L+   +SP+V+CD+HGHSRRKNIF++GCSP  SWI  DT NP     K  +  Y  LP +L+    +FS+++CSF VEK KESTARVVVWR+ GV RSYTMES+YC  DQG YK +HIN  ML+E+G +F E L  I+ 
Sbjct:  667 GVQRSKIFEDIDRMIHADQLIDLVVYDYDKIVAGTEGS--MVDKVNLCNKDELRLGL-LDCHSEALKFNSQFECGNLRKAVQVREHEYDLILNPDINSNHHHQWFYFEVSNMKQDIPYRFNIVNCEKPNSQFNFGMQPLLMSVMEALEGNPCWARVGTDICYYRNHFIRDANTAGGVQGKSYYTATFNIKFPHSGDVCYISYHYPYTYSALMTHLRQWEKQY--------------------------------DSSLIYFKNQTLCKTLAGNPVPLLTITAQPRSIDKEALEELRNRPYIFLSSRVHPGESNASWIMKGTIDFLLSRKPQAQKVREMFIFKVMPMLNPDGVINGNHRSSLVGEDLNRRWGNPCSVLHPTIYHTKGLLQYLNLINKSPLVYCDYHGHSRRKNIFLYGCSPHQSWIPNDTQNPASPCSKFIESYYKQLPRLLHASCPSFSLQNCSFVVEKVKESTARVVVWREIGVLRSYTMESSYCGCDQGKYKDMHINTDMLEEMGQKFCETLARISR 1160          

HSP 2 Score: 219.55 bits (558), Expect = 6.343e-54
Identity = 131/364 (35.99%), Postives = 215/364 (59.07%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYL-ESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            ++D+S+L   +  L KI  NK+  K   E++   R  T+K+L +I+  E+  +D  ++H   +D L+  LQ V   QT  N+I I  ++VGK    KRA  LV HG++  L   + L  S +    ++ L  +H +L +I  KD++  V+AR+ Q L V ++L++T      HN              KN+  LL VL+ Y+ N +N S LG+  AI+L+ K+IN C K +   L++++E L    ++K+NSAR +N   + +LL L  +W + DSK ++L +R+SIL ++K++ NLR+G+KAF+EA+G+ TLY          ++ESL+ ++S+ILRKC P+N+LPL    S +  PLP+++T
Sbjct:   14 VLDRSKLNYWVQHLAKIL-NKNQKKVNYEDVHQIRFATNKLLHVIQQIEKPGKDAFVRHSLAMDTLITILQVVTCEQTLGNVINIFLDIVGKQQPVKRASLLVSHGLTTVLFHILKLTHSNDLVLGDEILIAIHTLLSRIGHKDRKFAVKARLHQSLMVTLNLVKTHS----HN-------------FKNLQPLLQVLKFYTSNSVNASYLGKHNAISLMFKVINSCGKRHTVDLRLALENLCNLTKSKSNSARLINIDGIPILLILHSNWQQQDSKQRYLAIRRSILLILKNITNLRAGRKAFVEANGIRTLYESALEASDSRDMESLILLASVILRKCCPRNKLPLKSTFSPIIFPLPSSST 359          
BLAST of ATP/GTP binding protein 1 vs. TrEMBL
Match: A0A2C9KMQ7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106053985 PE=4 SV=1)

HSP 1 Score: 578.17 bits (1489), Expect = 5.818e-178
Identity = 278/529 (52.55%), Postives = 365/529 (69.00%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIH-TNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYI--QELCTTILGNPVPVLTIS----NWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINE 4234
             + ++KI +D+ R+I  + ++D  V+D + I+  T  S  M + ++  N DEL +       S +L+F+SQFECGNLRKA+QVR++EYDLILNPD+N+NH  QWFYF VS M+  +PYRFNI+NCEKPNSQFNFGMQPLL SV EA+ G   W R G++I YY+NHF R A T GG  G+SYYT TF I+FP+S DVCYI+YHYPYTY+ L+T L Q  +++                                D  L Y   Q LC T+ GNPVP+LTI+    +  K+     R +PY+FL+SRVHPGESNASW+MKG ID+LLS  P ++++R++++FK++PMLNPDGVING HR S+ G+DLNRRW +PC VL+PTI+HTKGL+  L+   +SP+V+CD+HGHSRRKNIF++GCSP  SWI  DT NP     K  +  Y  LP +L+    +FS+++CSF VEK KESTARVVVWR+ GV RSYTMES+YC  DQG YK +HIN  ML+E+G +F E L  I+ 
Sbjct:  709 GVQRSKIFEDIDRMIHADQLIDLVVYDYDKIVAGTEGS--MVDKVNLCNKDELRLGL-LDCHSEALKFNSQFECGNLRKAVQVREHEYDLILNPDINSNHHHQWFYFEVSNMKQDIPYRFNIVNCEKPNSQFNFGMQPLLMSVMEALEGNPCWARVGTDICYYRNHFIRDANTAGGVQGKSYYTATFNIKFPHSGDVCYISYHYPYTYSALMTHLRQWEKQY--------------------------------DSSLIYFKNQTLCKTLAGNPVPLLTITAQPRSIDKEALEELRNRPYIFLSSRVHPGESNASWIMKGTIDFLLSRKPQAQKVREMFIFKVMPMLNPDGVINGNHRSSLVGEDLNRRWGNPCSVLHPTIYHTKGLLQYLNLINKSPLVYCDYHGHSRRKNIFLYGCSPHQSWIPNDTQNPASPCSKFIESYYKQLPRLLHASCPSFSLQNCSFVVEKVKESTARVVVWREIGVLRSYTMESSYCGCDQGKYKDMHINTDMLEEMGQKFCETLARISR 1202          

HSP 2 Score: 219.55 bits (558), Expect = 5.749e-54
Identity = 131/364 (35.99%), Postives = 215/364 (59.07%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYL-ESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            ++D+S+L   +  L KI  NK+  K   E++   R  T+K+L +I+  E+  +D  ++H   +D L+  LQ V   QT  N+I I  ++VGK    KRA  LV HG++  L   + L  S +    ++ L  +H +L +I  KD++  V+AR+ Q L V ++L++T      HN              KN+  LL VL+ Y+ N +N S LG+  AI+L+ K+IN C K +   L++++E L    ++K+NSAR +N   + +LL L  +W + DSK ++L +R+SIL ++K++ NLR+G+KAF+EA+G+ TLY          ++ESL+ ++S+ILRKC P+N+LPL    S +  PLP+++T
Sbjct:   14 VLDRSKLNYWVQHLAKIL-NKNQKKVNYEDVHQIRFATNKLLHVIQQIEKPGKDAFVRHSLAMDTLITILQVVTCEQTLGNVINIFLDIVGKQQPVKRASLLVSHGLTTVLFHILKLTHSNDLVLGDEILIAIHTLLSRIGHKDRKFAVKARLHQSLMVTLNLVKTH----SHN-------------FKNLQPLLQVLKFYTSNSVNASYLGKHNAISLMFKVINSCGKRHTVDLRLALENLCNLTKSKSNSARLINIDGIPILLILHSNWQQQDSKQRYLAIRRSILLILKNITNLRAGRKAFVEANGIRTLYESALEASDSRDMESLILLASVILRKCCPRNKLPLKSTFSPIIFPLPSSST 359          
BLAST of ATP/GTP binding protein 1 vs. TrEMBL
Match: A0A2C9KMW1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106053985 PE=4 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 9.071e-178
Identity = 278/529 (52.55%), Postives = 365/529 (69.00%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIH-TNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYI--QELCTTILGNPVPVLTIS----NWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINE 4234
             + ++KI +D+ R+I  + ++D  V+D + I+  T  S  M + ++  N DEL +       S +L+F+SQFECGNLRKA+QVR++EYDLILNPD+N+NH  QWFYF VS M+  +PYRFNI+NCEKPNSQFNFGMQPLL SV EA+ G   W R G++I YY+NHF R A T GG  G+SYYT TF I+FP+S DVCYI+YHYPYTY+ L+T L Q  +++                                D  L Y   Q LC T+ GNPVP+LTI+    +  K+     R +PY+FL+SRVHPGESNASW+MKG ID+LLS  P ++++R++++FK++PMLNPDGVING HR S+ G+DLNRRW +PC VL+PTI+HTKGL+  L+   +SP+V+CD+HGHSRRKNIF++GCSP  SWI  DT NP     K  +  Y  LP +L+    +FS+++CSF VEK KESTARVVVWR+ GV RSYTMES+YC  DQG YK +HIN  ML+E+G +F E L  I+ 
Sbjct:  700 GVQRSKIFEDIDRMIHADQLIDLVVYDYDKIVAGTEGS--MVDKVNLCNKDELRLGL-LDCHSEALKFNSQFECGNLRKAVQVREHEYDLILNPDINSNHHHQWFYFEVSNMKQDIPYRFNIVNCEKPNSQFNFGMQPLLMSVMEALEGNPCWARVGTDICYYRNHFIRDANTAGGVQGKSYYTATFNIKFPHSGDVCYISYHYPYTYSALMTHLRQWEKQY--------------------------------DSSLIYFKNQTLCKTLAGNPVPLLTITAQPRSIDKEALEELRNRPYIFLSSRVHPGESNASWIMKGTIDFLLSRKPQAQKVREMFIFKVMPMLNPDGVINGNHRSSLVGEDLNRRWGNPCSVLHPTIYHTKGLLQYLNLINKSPLVYCDYHGHSRRKNIFLYGCSPHQSWIPNDTQNPASPCSKFIESYYKQLPRLLHASCPSFSLQNCSFVVEKVKESTARVVVWREIGVLRSYTMESSYCGCDQGKYKDMHINTDMLEEMGQKFCETLARISR 1193          

HSP 2 Score: 219.55 bits (558), Expect = 5.762e-54
Identity = 131/364 (35.99%), Postives = 215/364 (59.07%), Query Frame = 2
Query:  113 LMDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYL-ESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTAT 1201
            ++D+S+L   +  L KI  NK+  K   E++   R  T+K+L +I+  E+  +D  ++H   +D L+  LQ V   QT  N+I I  ++VGK    KRA  LV HG++  L   + L  S +    ++ L  +H +L +I  KD++  V+AR+ Q L V ++L++T      HN              KN+  LL VL+ Y+ N +N S LG+  AI+L+ K+IN C K +   L++++E L    ++K+NSAR +N   + +LL L  +W + DSK ++L +R+SIL ++K++ NLR+G+KAF+EA+G+ TLY          ++ESL+ ++S+ILRKC P+N+LPL    S +  PLP+++T
Sbjct:   14 VLDRSKLNYWVQHLAKIL-NKNQKKVNYEDVHQIRFATNKLLHVIQQIEKPGKDAFVRHSLAMDTLITILQVVTCEQTLGNVINIFLDIVGKQQPVKRASLLVSHGLTTVLFHILKLTHSNDLVLGDEILIAIHTLLSRIGHKDRKFAVKARLHQSLMVTLNLVKTH----SHN-------------FKNLQPLLQVLKFYTSNSVNASYLGKHNAISLMFKVINSCGKRHTVDLRLALENLCNLTKSKSNSARLINIDGIPILLILHSNWQQQDSKQRYLAIRRSILLILKNITNLRAGRKAFVEANGIRTLYESALEASDSRDMESLILLASVILRKCCPRNKLPLKSTFSPIIFPLPSSST 359          
BLAST of ATP/GTP binding protein 1 vs. TrEMBL
Match: A0A1S3JTA4 (cytosolic carboxypeptidase 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106175928 PE=4 SV=1)

HSP 1 Score: 573.933 bits (1478), Expect = 2.423e-176
Identity = 276/536 (51.49%), Postives = 361/536 (67.35%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWL----KDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNA 4264
             + + KI +D+ R+I+ + +LDK V+DL+ I++   + Y+   S   N+DE  + +   + +  L F++QFE GNLRKAIQVRQYEYDL LNPD+N NH  QWFYF +S ME    YRFNI NCEK NSQFN+GMQP++YSVKEA+ G  +W R GSEI YYKNHF RS+   GG  G++YYT TF I F +  D+CYIAYH+PYTYT L T L         K +  +D                      +  I F  Q L  TI GN VP+LTI+ +     ++G    R +PY+FL+SRVHPGESN+SWVMKG I +LLS+ P+++ LR++YVFKIVPMLNPDGVING HRCS+  +DLNRRW+ PC  L+PTI+HT+GL+  L    + P+V+CD+HGHSRRKN+F++GCSP +SW  ED +NP  +  K ED  Y  LP +L + + AFS+ +CSF VEKSKE+TARVVVWRQ G+ RSYTMESTYC  DQG Y+ LHI    L+E+G +F EAL+ +       S+ N+
Sbjct:  712 GIQRQKIFEDIDRMINPDQLLDKVVYDLDTIVRLAGSMYSTHYSNLKNMDEQRLQRREDIGA-HLMFNAQFESGNLRKAIQVRQYEYDLFLNPDINTNHHHQWFYFEISNMEVGRQYRFNISNCEKLNSQFNYGMQPVMYSVKEALQGRPHWLRVGSEICYYKNHFTRSSQVTGGQKGKTYYTATFTITFKHERDICYIAYHFPYTYTMLQTHL--------IKWENTYD----------------------QSSIYFKNQVLTETISGNAVPLLTITAYPLSNNREGIEQFRNRPYIFLSSRVHPGESNSSWVMKGTIQFLLSNAPMAQTLREMYVFKIVPMLNPDGVINGNHRCSLVAEDLNRRWLVPCPKLHPTIYHTRGLLQYLKMVNKVPVVYCDYHGHSRRKNVFLYGCSPSMSWQTEDLDNPAMLAGKVEDTGYKTLPKLLAS-APAFSLNNCSFMVEKSKEATARVVVWRQVGIVRSYTMESTYCGCDQGPYRGLHIGTRELEEMGRKFCEALIKVRSRHAVSSDTNS 1215          

HSP 2 Score: 300.442 bits (768), Expect = 1.422e-79
Identity = 148/373 (39.68%), Postives = 235/373 (63.00%), Query Frame = 2
Query:  116 MDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLED 1234
            MD++RL +    LEK+  ++ + +   EE+   R TT+KIL  +   E+ +RD ++KH   +D+LV  L+   D   + N++ I+ EL+GK+ +GK+A TLV +G ++ L   +  E KE  P E+ L  +H +L K+  KD++ GV+AR+SQ LPV + L+R                    S  + +  +L VL+LYS N +N S LG+ GA++ L ++I  C K ++++LK+++++L L V++K+NSARA+  G + MLL +F DW+R DSK++H+ LRK++L V+K + NL+SG+ AF++ADG+  LY  C  +    +LE ++ ISSLI+RKCFPKNRLP+    SV+ CPLP +  FH    M+L D
Sbjct:    1 MDRTRLSNLFQTLEKLLGHRPS-RRDPEEVQQLRFTTTKILQFVSSQEKTHRDAVLKHSEYLDSLVTILEVAEDVAVTQNVVYILAELIGKTASGKKAGTLVSNGATQGLFAALTGEWKETQPNEELLLSIHHLLAKLGPKDRKFGVKARLSQALPVTLGLLRNHT-----------------SSTRVLQAVLPVLKLYSNNAVNASYLGKNGAVSYLFRVITSCGKKHLSMLKLTLDSLVLLVKSKSNSARAIGHGGVPMLLNMFSDWHRGDSKNRHIALRKAVLNVLKHITNLKSGRHAFIQADGIRILYSACQESINCRDLEQVIFISSLIMRKCFPKNRLPVASIRSVLTCPLPES-DFHIPEFMMLND 354          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Cavefish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:103039550])

HSP 1 Score: 516.924 bits (1330), Expect = 3.097e-160
Identity = 262/525 (49.90%), Postives = 344/525 (65.52%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE-LCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DILDK V+DL           +++N     +D+ E           L+F+SQFE GNLRKAIQVR++EYDL+LN D+N+NH  QWFYF VS+M   VPYRFNIINCEK NSQFN+GMQ L YSV+EA+ G+  W R GS+I YYKNHF+RS+   GG  G+SYYT TF + F +  DVCY AYHYPYT++ L                             K    K+    TP+   ++Y QE LC T+ GN  P+LTI+   +  SS      R +P VFL++RVHPGE+NASWVMKG +++L+SS+P+++ LR+ ++FKIVPMLNPDGVING HRCS++G+DLNR+W++P   L+PTI++ K L+  L+  G++P+VFCD+HGHSR+KN+FM+GCS  +      TN         ED  Y  LP +L+ ++ AFS+ SCSF VE+SKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G QF  ALL +
Sbjct:  572 GVQRTKIFQDIERLIHPGDILDKVVYDL-----------DLQNC--PVIDDGEC----------LKFNSQFESGNLRKAIQVRKFEYDLVLNSDINSNHYHQWFYFEVSSMRVGVPYRFNIINCEKSNSQFNYGMQVLKYSVQEAISGSPRWIRTGSDICYYKNHFSRSSIAAGGQKGKSYYTMTFTVTFQHKDDVCYFAYHYPYTFSTL-----------------------------KMHLQKLRALCTPQ---VYYRQEQLCETLGGNGCPLLTITARPESASSDHVCQFRNRPVVFLSARVHPGETNASWVMKGTLEFLVSSSPLAQSLRESFIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWLNPSAELHPTIYYAKSLLQYLTAIGRTPLVFCDYHGHSRKKNVFMYGCS--IKETVWQTNVSASSCDLQEDLGYRTLPKLLSQLAPAFSLASCSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGSQFCIALLRL 1039          

HSP 2 Score: 209.149 bits (531), Expect = 3.022e-54
Identity = 114/313 (36.42%), Postives = 182/313 (58.15%), Query Frame = 2
Query:  254 PERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            PE+  ++V+ K    ++ ++++L+   D QT  NI+ I+NEL+     G+R    V  G +  LLQ +    KE  P E+ +   H +L K+  KD++ G++AR++  L V V+L++  +                    K +L  L VLR+YS N +N   LG+ G + L+ K+I   +K N  +LKV+++TL   +++K N+ RAV++  M  LL ++ DW+R D++ +H+ +RKSIL  IK+L N++ G+KAF++ADG+  LY           L+ LV  SSLI+RKCFPKNRLPL    SV + PLP+
Sbjct:   19 PEKTRKEVMAKGSSGMEVILSSLENTRDLQTILNILCILNELLTLGG-GRRVGVFVSKGGTAILLQLLVQSGKEASPSEELMLQTHSLLAKVGPKDRKFGIKARLNGALNVTVNLLKQNLQNY-----------------KLLLPCLQVLRVYSSNSVNAVSLGKSGVVELMFKVIGPYSKKNTTLLKVALDTLAALLKSKMNARRAVDRAHMPALLAIYQDWHRNDTRHRHMIIRKSILGCIKNLTNIKLGRKAFIDADGMRILYNTSTECLPVRTLDPLVNASSLIMRKCFPKNRLPLPTIKSVFQHPLPH 313          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Cavefish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:103039550])

HSP 1 Score: 517.694 bits (1332), Expect = 3.565e-160
Identity = 262/525 (49.90%), Postives = 344/525 (65.52%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE-LCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHI 4228
             + + KI  D+ R+I   DILDK V+DL           +++N     +D+ E           L+F+SQFE GNLRKAIQVR++EYDL+LN D+N+NH  QWFYF VS+M   VPYRFNIINCEK NSQFN+GMQ L YSV+EA+ G+  W R GS+I YYKNHF+RS+   GG  G+SYYT TF + F +  DVCY AYHYPYT++ L                             K    K+    TP+   ++Y QE LC T+ GN  P+LTI+   +  SS      R +P VFL++RVHPGE+NASWVMKG +++L+SS+P+++ LR+ ++FKIVPMLNPDGVING HRCS++G+DLNR+W++P   L+PTI++ K L+  L+  G++P+VFCD+HGHSR+KN+FM+GCS  +      TN         ED  Y  LP +L+ ++ AFS+ SCSF VE+SKESTARVVVWR+ GVQRSYTMEST C  DQG YK L I    L+E+G QF  ALL +
Sbjct:  607 GVQRTKIFQDIERLIHPGDILDKVVYDL-----------DLQNC--PVIDDGEC----------LKFNSQFESGNLRKAIQVRKFEYDLVLNSDINSNHYHQWFYFEVSSMRVGVPYRFNIINCEKSNSQFNYGMQVLKYSVQEAISGSPRWIRTGSDICYYKNHFSRSSIAAGGQKGKSYYTMTFTVTFQHKDDVCYFAYHYPYTFSTL-----------------------------KMHLQKLRALCTPQ---VYYRQEQLCETLGGNGCPLLTITARPESASSDHVCQFRNRPVVFLSARVHPGETNASWVMKGTLEFLVSSSPLAQSLRESFIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWLNPSAELHPTIYYAKSLLQYLTAIGRTPLVFCDYHGHSRKKNVFMYGCS--IKETVWQTNVSASSCDLQEDLGYRTLPKLLSQLAPAFSLASCSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGSQFCIALLRL 1074          

HSP 2 Score: 217.238 bits (552), Expect = 8.057e-57
Identity = 127/356 (35.67%), Postives = 202/356 (56.74%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            SR++  L  LE++  N     +  E +   R  T KIL LI+  E+  ++V+ K    ++ ++++L+   D QT  NI+ I+NEL+     G+R    V  G +  LLQ +    KE  P E+ +   H +L K+  KD++ G++AR++  L V V+L++  +                    K +L  L VLR+YS N +N   LG+ G + L+ K+I   +K N  +LKV+++TL   +++K N+ RAV++  M  LL ++ DW+R D++ +H+ +RKSIL  IK+L N++ G+KAF++ADG+  LY           L+ LV  SSLI+RKCFPKNRLPL    SV + PLP+
Sbjct:   16 SRVLMLLGQLERL--NGEVLVTDTEAV---RQVTGKILHLIQTQEKTRKEVMAKGSSGMEVILSSLENTRDLQTILNILCILNELLTLGG-GRRVGVFVSKGGTAILLQLLVQSGKEASPSEELMLQTHSLLAKVGPKDRKFGIKARLNGALNVTVNLLKQNLQNY-----------------KLLLPCLQVLRVYSSNSVNAVSLGKSGVVELMFKVIGPYSKKNTTLLKVALDTLAALLKSKMNARRAVDRAHMPALLAIYQDWHRNDTRHRHMIIRKSILGCIKNLTNIKLGRKAFIDADGMRILYNTSTECLPVRTLDPLVNASSLIMRKCFPKNRLPLPTIKSVFQHPLPH 348          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Cavefish
Match: agbl1 (ATP/GTP binding protein-like 1 [Source:ZFIN;Acc:ZDB-GENE-110207-1])

HSP 1 Score: 479.174 bits (1232), Expect = 7.628e-147
Identity = 241/534 (45.13%), Postives = 339/534 (63.48%), Query Frame = 2
Query: 2672 LAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGS----SSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLS-WINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNK 4258
            + + K+ +D++R++  EDI+++ VFD+E                     +  V  S+ + + SL+F S+FE GNLRKAI +R+YEYDLILN DVN++   QWFYF VS M + VPYRFN+INCEK NSQFN+GMQP+LYSV+EA+ G  +W R G+EI YY+NHF  +     G    S+YT TF + F +  DVCY+AYHYPYT++ L + L               D++   D ++ F                F  Q LC T+ GN  P++TI+      +       R +PYV LT+RVHPGESNASWVM+G +++L S++P++E LR+ ++ KIVPMLNPDGVI+G HRCS++  DLNR+W+ P   L+PTI+HTKGL+  L+  G+ P+VFCD+HGHSR+KN+F++GCS   + W    + +P       ED  Y  +   L+ I+ AFS  SC+F VEKS+ STARVVVWR+ GV RSYTMESTY   DQG YK L      L+E+G  F ++LL + ++ I+++++
Sbjct:  482 VQRKKVFEDVQRLLCPEDIINRVVFDME---------------------DTSVQCSSDVPTDSLRFFSKFESGNLRKAIHIRRYEYDLILNADVNSSSHHQWFYFEVSGMVANVPYRFNVINCEKSNSQFNYGMQPVLYSVREALEGRPHWVRAGTEICYYRNHFCPNR----GQRAPSFYTLTFTVTFRHEEDVCYLAYHYPYTFSALQSHLK--------------DLERSVDPRKVF----------------FRQQTLCNTLAGNSCPLITITACPPSRAWRHLHQLRNRPYVVLTARVHPGESNASWVMRGSLEFLCSNDPVAESLREAFILKIVPMLNPDGVIHGNHRCSLSADDLNRQWLKPNPSLSPTIYHTKGLLYYLNSIGRKPLVFCDYHGHSRKKNVFLYGCSVKETLW---QSGSPVNTASLKEDPGYRTIAKTLDRIAPAFSFNSCNFLVEKSRASTARVVVWREMGVLRSYTMESTYNGCDQGIYKGLQTGTRELEEMGQNFCQSLLTLRKNAISYNSR 957          

HSP 2 Score: 103.219 bits (256), Expect = 1.426e-21
Identity = 75/292 (25.68%), Postives = 140/292 (47.95%), Query Frame = 2
Query:  317 TLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            + Q   D +++ NI+ +++EL+  + T +R   ++  G S+ALL  +   +    P    L  +  +L K+  +D+RIGV+A     + V++ L+R  V                   ++     L+V+R++  ++   + LG+  A++++  +I      + + +        LCV ++ N   A  +G +A LL+L+ DW+  DS+ +HL +R++ L  +     +  G+ A +   G+  LY    +       ESLV  S  ++RKC+PK  LPLT   S    PLP 
Sbjct:   10 SFQNAGDLESTLNILNVLDELL-SAGTDRRIHYMISKGGSEALLMALVNTASSYSPNYTLLLPILHLLAKVGHRDRRIGVKAEKVDAVLVILRLLRHNVKN-----------------SRRAAACLWVIRVFCSSVSTATLLGQNRALDVVFDLIAPPTATHTHTINPDTGPA-LCV-SEENCRTAAGKGYIAGLLKLYEDWHTHDSEHEHLQIRRAFLHCLHKATKICLGRTALVTDGGIDLLYTTVQSCLLSKAAESLVEPSVQLMRKCYPKIPLPLTSDHSAYSFPLPG 281          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 298.516 bits (763), Expect = 1.993e-86
Identity = 172/460 (37.39%), Postives = 255/460 (55.43%), Query Frame = 2
Query: 2849 QSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSS--STRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALL 4222
            ++ SL F+S+FE GNL+KA+QV  Y+Y+L L  D+      QWFYFRV  M++ V YRF IIN  K +S +  GM+PLLYS   A L    W R GS I YY+N           N G + Y+ T+ ++FPY  D CY+A+ YPYTY+ L                            + +L   I   S         ++ LC ++ GN V VLTI+     G++    R K  V +T+RVHPGE+N SW+M+G +D+LL  +  +  LR+ +VFK+VPMLNPDGV+ G +RCS+AG DLNR +        P +++T+ ++  L    +  +++CDFHGHSR+ N+FM+GC           N+      + +++ + L+  +  N    FS  SC F +++SKE T R+V+WR  G++ SYTMEST+     G+ K  H ++  L+ +G  F + LL
Sbjct:  193 ETSSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCE--------NEGTALYSLTWTMQFPYENDTCYLAHCYPYTYSDL----------------------------QHYLRGVI---SDSVRAAYCKVRVLCRSLAGNAVYVLTIT---APGATWKERRNKQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVA-EREVVLYCDFHGHSRKNNVFMYGC-----------NDHKDASLQLQERIFPLM--MSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGSRKGTHFSMGDLKSMGYHFCDTLL 595          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 301.212 bits (770), Expect = 4.110e-85
Identity = 172/462 (37.23%), Postives = 253/462 (54.76%), Query Frame = 2
Query: 2849 QSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTI----SNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALL 4222
            ++ SL F+S+FE GNL+KA+QV  Y+Y+L L  D+      QWFYFRV  M++ V YRF IIN  K +S +  GM+PLLYS   A L    W R GS I YY+N           N G + Y+ T+ ++FPY  D CY+A+ YPYTY+ L                            + +L   I   S         ++ LC ++ GN V VLTI    + W        R K  V +T+RVHPGE+N SW+M+G +D+LL  +  +  LR+ +VFK+VPMLNPDGV+ G +RCS+AG DLNR +        P +++T+ ++  L    +  +++CDFHGHSR+ N+FM+GC           N+      + +++ + L+  +  N    FS  SC F +++SKE T R+V+WR  G++ SYTMEST+     G+ K  H ++  L+ +G  F + LL
Sbjct:  200 ETSSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCE--------NEGTALYSLTWTMQFPYENDTCYLAHCYPYTYSDL----------------------------QHYLRGVI---SDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATW-----KERRNKQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAE-REVVLYCDFHGHSRKNNVFMYGC-----------NDHKDASLQLQERIFPLM--MSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGSRKGTHFSMGDLKSMGYHFCDTLL 602          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Sea Lamprey
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 505.753 bits (1301), Expect = 4.200e-156
Identity = 254/532 (47.74%), Postives = 337/532 (63.35%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGS----SSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKT----EDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESV 4240
             + ++KI  D+ R+I   DI+D+ V+DL+           M + +  + D              L+F S+FE GNLRKAI +R+YEYDLIL+ D+N+N   QWFYF VS MES VPYRFNI+NCEK NSQFN+GMQP++YSV+EAM G  +W R G++I YYKN F+RS+A  GG  G+SYYT TF + F +  D CY AYH+PYTYT L+  L                + A  D ++                I F  Q LC ++ GN  PV+TI+   +          R +PY+FLTSRVHPGESN+SWVMKG +++L+S +P+++ LR+ Y+FKIVPMLN DGVING +RCS+ G+DLNR+W  P   L+PTIFHTKGL+  L+    +P+V+CD+HGHSR+KN+F++GCS       ++T   T  + K     ED SY  LP IL+ I+ AF + SC+F VEKSK STARVVVWR  GV RSYTMESTYC  DQG YK   +    L+E+G +F  ALL +  S+
Sbjct:  640 GVQRSKIFQDIERLIRPGDIIDRVVYDLD-----------MPSLVSEDGD-------------CLKFCSEFESGNLRKAIHIRRYEYDLILDSDINSNRHHQWFYFEVSGMESGVPYRFNIVNCEKVNSQFNYGMQPVMYSVREAMAGRPHWVRAGTDICYYKNSFSRSSAAAGGQRGKSYYTLTFTVTFFHKDDACYFAYHFPYTYTSLMAHLQ--------------GLGAACDQRQ----------------IYFKQQTLCQSMGGNGCPVVTITAAPQSTGWQDIYRLRNRPYIFLTSRVHPGESNSSWVMKGSLEFLMSDDPLAQSLRESYIFKIVPMLNADGVINGSYRCSLGGEDLNRQWSSPDPELHPTIFHTKGLLQYLASIAHTPLVYCDYHGHSRKKNVFLYGCS------MKETIWQTAAEAKASSVYEDLSYRTLPRILHQIAPAFCLSSCNFVVEKSKASTARVVVWRDIGVLRSYTMESTYCGCDQGIYKGSQMGSQELEEMGAKFCVALLRLKSSL 1111          

HSP 2 Score: 191.815 bits (486), Expect = 1.763e-49
Identity = 101/325 (31.08%), Postives = 184/325 (56.62%), Query Frame = 2
Query:  215 RVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLP 1189
            R  + K+L L++  E+  +++  K    +D ++ TL+   D Q + +I+ I+ EL+  + +G R   LV  G S+ LLQ +   +K+    ++ + + H +L K+  KD +   +AR+   LPV ++L++  +    HN+             + +L  ++ ++ YS +++N   LGR GA+ LL KI+   +K     +K++++TL   +++K N+ RAV++G +  LL ++ DW+R D++  H+ +R+ +L  +K +  ++ G++AFLEADG+   Y       T   L+ LV +S++I+RKC PKNRLPL    SV   PLP
Sbjct:    5 RSVSCKLLQLVQTQEKTRKEMAGKGSSGMDVMLTTLENSKDHQVTMDILNILLELL-SAGSGGRVSNLVCKGGSQILLQTLVRAAKDSPTNDELMLVTHSLLAKVGPKDAKFATKARLCGALPVTLTLVKQNL----HNQ-------------RLLLPCMHTIKAYSASIVNAVSLGRNGAVELLFKIVGPFSKRQSTFIKITLDTLATLLKSKTNARRAVDRGNIVFLLNVYQDWHRHDARHSHVPVRRGLLTCLKQITAIKHGRRAFLEADGMKIFYTTSQECLTSRGLDLLVNLSTMIMRKCCPKNRLPLPTIRSVHHFPLP 311          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Nematostella
Match: EDO42858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0D9])

HSP 1 Score: 313.538 bits (802), Expect = 4.078e-95
Identity = 179/467 (38.33%), Postives = 267/467 (57.17%), Query Frame = 2
Query: 2855 PSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCS--PLL---SWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYK-HLHINVPMLQEIGCQFAEALLHINES 4237
            P L+F+S+FECGNL++A ++ +YEYDL+L+ D+      QW+YFRV  M   V Y+FNIIN  K +S +N+GM+PLLYS K A   +  W+R G  + Y +    ++       I   Y+T TF +EFP++ D CY+A+ YPY+Y+ L                            E++L   ++    P        + LC T  GN   VLTI++  +  +  T  K  V +++RVHPGE+NASW+MKG +DYL S++ ++E LR  +VFKIVPMLNPDGVI G +R ++A +DLNR + DP +   PT+++TK ++    K     +++CD HGHSR+ N+FM+GC+  P +   +   E+   P  + QK  DK               FS + C F V K KESTARVV+W+Q G+  S+TME+T+C  + G+ +   H N    +++G  F E LL  +E+
Sbjct:    3 PHLKFESRFECGNLQQAKRIGRYEYDLVLSNDLYTKRHTQWYYFRVENMVPGVTYKFNIINLLKRDSLYNYGMKPLLYSSKVAEDSSIGWQRSGHHVNYTRTVNNKNVLLSRDLI---YFTLTFQVEFPHAGDTCYLAHCYPYSYSDL----------------------------ERYLMSLVD---NPLTSQHVRREVLCKTKAGNNCYVLTITS-SQGMNLETVDKLGVVISARVHPGETNASWMMKGLLDYLSSNDKVAESLRQKFVFKIVPMLNPDGVIVGNYRTNLAARDLNRTYKDPKKESFPTVWYTKNMLESFKK-NHEVIIYCDLHGHSRKPNVFMYGCTADPKVYSSASFLEERLFPWMMSQKAPDK---------------FSFQGCKFMVRKCKESTARVVMWQQLGIMNSFTMEATFCGSNFGDMEGGRHFNTRDFEDMGRHFCEVLLEYSEA 418          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Nematostella
Match: EDO34305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP4])

HSP 1 Score: 316.62 bits (810), Expect = 1.317e-90
Identity = 162/369 (43.90%), Postives = 229/369 (62.06%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQS----------------PSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAML-GTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVING 3712
             L +  +  D+ R+I    ++D+ VFDL+A+I+    + +  N ++ +    E+ K +   S                 +L+F+S+FE GNLRKAIQVR+YEYDLILNPD+N  H  QWFYF VS ME+ VPYRFNIINCEK NSQFNFGMQP+LYS++EA++ G   W R G+ + YY+N+F+RS    GG   ++Y+T TF + FP++ DVCY+AYHYPYTY+ L   L          A+ +  +D++                     + +    LC ++ GN   V+TI++  +   + T    R +PYVFL++RVHPGESNASWVMKG +++LLS+   ++ LRD ++FKIVPMLNPDGVING
Sbjct:  612 GLQRTMVFRDIDRLIQAHKVVDRVVFDLDALIRQESTANSTGNQMNADKPATELRKGSNSSSSSASDSDRMSSSDDGSKALRFESRFESGNLRKAIQVREYEYDLILNPDINCRHHHQWFYFEVSNMEADVPYRFNIINCEKINSQFNFGMQPVLYSMQEAVVEGRPCWARTGANVCYYRNYFSRSQDLGGGQKSKTYFTATFTVTFPHADDVCYLAYHYPYTYSMLQEHL----------ANIESSIDSD---------------------VYYRRSTLCHSLAGNACDVITITSNPRHRDAYTLDSFRSRPYVFLSARVHPGESNASWVMKGVLEFLLSAFYTAKHLRDRFIFKIVPMLNPDGVING 949          

HSP 2 Score: 196.438 bits (498), Expect = 3.851e-51
Identity = 125/391 (31.97%), Postives = 211/391 (53.96%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEE-EISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRT--------QVNLVPHNRGSLGSVPI----------------SGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN--TATFHNKA 1216
            +R+ + L+ L+K+    +  K+++E ++   R  T+KI  L+   E+  +D++ K+   +   +  L+   D Q + NI+  I+EL+    +GKRA  L   G    LL+ I   SKE   CE+ + L H +L KI AKD++  V+ARIS  L V ++++R         Q  L    + S    P+                SG   +  +  +Y L++     +N + LG+ GA+ +L KI++ C    +  LK+ ++  +  V++K ++++AVN GA+ +LL++F DW R D  ++   +RK+IL V+KS+   +SGKK+F++ADG+  LY           L+S+  ISS ILR+CFPKN+LP+T   S +  PL N  +AT  +K 
Sbjct:   11 ARMGTLLEQLQKLCIGVTEAKNEQEKDVDQLRYVTNKIQQLLCSQEKCRKDMMTKYTDGLSTFLIILEVSTDYQLTLNILGGISELL---TSGKRASALASKGAVDILLKVIISASKETPICEEVILLCHTILTKIGAKDRKFCVKARISGALQVTMNMIRNNTTNFRILQTTLPVLKQYSANGNPLISFILIEQYFANGLALSGIERRTNVFRVYNLQVLIYQTVNCTILGKAGAVGVLFKIVSACGHKRVTCLKLVLDVTSALVKSKTSASKAVNYGAVPVLLQMFSDWQRTDHHNRQTGVRKAILGVLKSITMTKSGKKSFIQADGIKVLYSLSLECLESRELDSINNISSQILRRCFPKNKLPITTLSSPLAFPLLNLDSATLSSKG 398          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Nematostella
Match: EDO49270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH06])

HSP 1 Score: 301.597 bits (771), Expect = 6.444e-90
Identity = 169/455 (37.14%), Postives = 251/455 (55.16%), Query Frame = 2
Query: 2858 SLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALL 4222
            +L F+S+FE GNL++AI+   YEY L +  D+  +   QWFYFRV    +   Y+F I+N  K  S +N GM+PL YS   A      W R GS + YYK    R   T      R YY  T+  +F YS D CY A+ YPYTY+    DL +  Q  +                           + P    +   + LC T+ GN V +LT++N  +  S +  ++  V +T+RVHPGE+N+SW+MKG +D+L S++  ++ LRD ++FKIVPM+NPDGVI G +RCS+AG+DLNR +    +   P+I+H + ++  L +  +   V+CDFHGHSR++N+FM+GC        E+ +NP    ++  ++ +  +  +  N    FS + C F V+KSKE T RVV+W Q G+  S+TME+T+C    G     H N   L+ +G  F + LL
Sbjct:   24 TLLFESRFESGNLKRAIKTGDYEYQLWMRTDLYTSKHTQWFYFRVRNTRAGATYKFTIMNFIKSGSLYNDGMRPLAYSEVNASKNKIGWLRTGSNVKYYKTEIRRDDTT----KDRYYYALTWTCQFQYSNDTCYFAHCYPYTYS----DLQEYLQGIR---------------------------NDPVKSRICKQRVLCRTLAGNFVYILTVTNPSRRPSDAEAKRA-VVVTARVHPGETNSSWMMKGLLDFLTSNSADAKLLRDTFIFKIVPMINPDGVIVGNYRCSLAGRDLNRNYKTMLKDSFPSIWHVRNMIKRLLE-EREITVYCDFHGHSRKQNVFMYGC--------ENRSNPL---KRLRERVFPTM--MAKNAPCKFSYKGCKFKVQKSKEGTGRVVMW-QLGILNSFTMEATFCGSSLGKRNGFHFNTVDLEAMGYHFCDTLL 427          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Nematostella
Match: EDO47454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM73])

HSP 1 Score: 189.504 bits (480), Expect = 1.212e-51
Identity = 135/434 (31.11%), Postives = 211/434 (48.62%), Query Frame = 2
Query: 2861 LQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYR---FNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSE-IFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVF-CDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQ-RSYTMESTYCSFD 4144
            L FD+ FE GNL +   + ++EYDL + PD  N     WF F V   E+  PY+   FNI+N  K  S +  GM PL+ S          W+R  ++  FYY+         C  +  R  Y  +F   F    DV   AY +PYTY+RL   L                     D + + L++             F  + LC T+    + +LTI++   D  +S  +K  VF+T+R+HPGE+ +S+V +G ID+++S++P+++ LR+  VFK++PMLNPDGV+ G +RCS+ G DLNR W +P    +PT+  +K L+M L     + + F  D H HS   N FM+G                  D++   +   + P +L   +  FS+ + SFN +  K  T R  +      +   YT+E ++ S++
Sbjct:   29 LIFDACFESGNLGRVDYITEFEYDLFIRPDTCNPRFRVWFNFTV---ENTAPYQRVIFNIVNFSKTKSLYREGMTPLVKSTSRPR-----WQRIPAKNCFYYR---------CPDH--RKNYVLSFAFAFDNDTDVYQFAYCFPYTYSRLQGYL--------------------DDIERRSLSY-------------FKREMLCLTVQQRRLDLLTITS--PDNMNSPLRKRVVFITARIHPGETPSSYVCQGLIDFIISNHPVAKVLREYLVFKVIPMLNPDGVVLGNYRCSLMGFDLNRHWHEPSPWAHPTLVASKNLLMELDSDSTAHLDFYIDIHAHSTLMNGFMYG---------------NIYDEEERYERQAVFPKLLCANADDFSMSNTSFNRDAMKAGTGRRFLGSSLDPETHCYTLEVSFFSYN 393          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Nematostella
Match: EDO32134 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVW8])

HSP 1 Score: 169.474 bits (428), Expect = 1.771e-43
Identity = 90/225 (40.00%), Postives = 129/225 (57.33%), Query Frame = 2
Query: 2687 ILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQS----------------PSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAML-GTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDL 3310
            +  D+ R+I    ++D+ VFDL+A+I+    + +  N ++ +    E+ K +   S                 +L+F+S+FE GNLRKAIQV                          S ME+ VPYRFNIINCEK NSQFNFGMQP+LYS++EA++ G   W R G+ + YY+N+F+RS    GG   ++Y+T TF + FP++ DVCY+AYHYPYTY+ L   L
Sbjct:  189 VFRDIDRLIQAHKVVDRVVFDLDALIRQESTANSTGNQMNADKPATELRKGSNSSSSSTSDSDRMSSSDDGSKALRFESRFESGNLRKAIQV--------------------------SNMEADVPYRFNIINCEKINSQFNFGMQPVLYSMQEAVVEGRPCWARTGANVCYYRNYFSRSQDLGGGQKSKTYFTATFTVTFPHADDVCYLAYHYPYTYSMLQEHL 387          

HSP 2 Score: 139.043 bits (349), Expect = 1.141e-33
Identity = 73/153 (47.71%), Postives = 88/153 (57.52%), Query Frame = 2
Query: 3845 VFCDFHGHSRRKNIFMFGCSPLLS------------------WINEDTNNPTFVD--QKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVI 4243
            V+CDFHGHSR+KN+FM+GCS L +                        N P   D  +  ED  Y  LP +L+NI+ AFS+ SCSF VE SKESTARVVVWR+ GV RSYTMESTY   DQG YK  H+    L+E+G  F   LL I    +
Sbjct:  460 VYCDFHGHSRKKNVFMYGCSTLATIAAASPSSSADLEVAAPTPATPAPNIPASADPNETVEDVGYRTLPRVLHNIAPAFSLGSCSFVVEPSKESTARVVVWRELGVVRSYTMESTYSGCDQGPYKGYHLGTRELEEMGRFFCAGLLRIGRPYV 612          

HSP 3 Score: 88.1965 bits (217), Expect = 1.394e-17
Identity = 45/105 (42.86%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  908 LFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN--TATFHNKA 1216
            +F DW R D  ++   +RK+IL V+KS+   +SGKK+F++ADG+  LY           L+S+  ISS ILR+CFPKN+LP+T   S +  PL N  +AT  +K 
Sbjct:    1 MFSDWQRTDHHNRQTGVRKAILGVLKSITMTKSGKKSFIQADGIKVLYSLSLECLESRELDSINNISSQILRRCFPKNKLPITTLSSPLAFPLLNLDSATLSSKG 105          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 503.442 bits (1295), Expect = 2.452e-154
Identity = 258/533 (48.41%), Postives = 340/533 (63.79%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPL---QSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE--LCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESV 4240
             + ++KI  D+ R+I   DILDK V+DL+                           + PL   +  SL+F+SQFE GNLRKAIQ R+YEYDL+LN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQ L+YSV+EA+ G   W R G++I YYKN+FARS+   GG  G+SYYT TF + F +  DVCY AYHYPYT++ L                             K    K+E   TP+     Y+++  LC T+ GN  P+LTI+   +  SS+     R +P +FL++RVHPGE+NASWVMKG +++L+ ++ ++  LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTK L+  L+   ++P+VFCD+HGHSR+KN+FM+GCS L   + +   + T  D + ED  Y  LP IL+ I+ AFS+ S SF VE+SKESTARVVVWR+ GVQRSYTMEST C  DQG YK   I    L+E+G QF  ALL +   +
Sbjct:  678 GVQRSKIFQDIERLIHPNDILDKVVYDLDI-------------------------PNCPLVKDEGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYYTLTFSMSFSHKDDVCYFAYHYPYTFSTL-----------------------------KMHLSKLEDLRTPQ----IYLRQDVLCETLGGNHCPLLTITAMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLAHIQRAPLVFCDYHGHSRKKNVFMYGCS-LKETVWQSNISATSSDLQ-EDLGYRTLPKILSEIAPAFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGFQIGTRELEEMGAQFCVALLRLKRLI 1150          

HSP 2 Score: 215.312 bits (547), Expect = 4.704e-56
Identity = 128/358 (35.75%), Postives = 208/358 (58.10%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINEL--VGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            S L++ LD +E++  N  A   ++ E++  R  T+KIL LI+  E+  R+++ K    ++ ++ +L+   D QT+ NI+ I+ EL  VG+   G R +  V  G +  L Q +   SKE  P  + +  LH +L K+  KD+R G++AR+S  L V VSL+R  +                    K +L  L+VLR+YS NL+N   LG+I  + L+ KII   +K N  +LKV+++ L   +++K N+ RAV+ G +A+LL L+ DW+R D++ +H+ +RK +L  ++++ N++ G+KAF++ADG+  L+           L+ LV  SSLI+RKCFPKNRLPL    S  +  LP+
Sbjct:   16 SSLLTLLDQIERM--NGEAML-RDTELA--RHVTAKILHLIQTQEKSGREIMSKGSSGMEVILASLENCRDVQTTLNILYILTELLSVGR---GHRVEVFVSKGGTGILFQILIAASKESPPSMELMLHLHSLLAKVGPKDRRFGMKARLSGALNVTVSLIRQNLQNT-----------------KLLLPCLHVLRVYSSNLVNAMSLGKIEGVELMFKIIGPYSKKNTTLLKVALDALGALLKSKTNARRAVDGGYVAVLLSLYQDWHRNDTRCRHILIRKGLLVCLRNITNIKLGRKAFIDADGMRILHNSSTECLPVRTLDPLVNTSSLIMRKCFPKNRLPLPTMKSAFQFQLPH 348          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 502.286 bits (1292), Expect = 3.147e-154
Identity = 258/533 (48.41%), Postives = 340/533 (63.79%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPL---QSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE--LCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESV 4240
             + ++KI  D+ R+I   DILDK V+DL+                           + PL   +  SL+F+SQFE GNLRKAIQ R+YEYDL+LN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQ L+YSV+EA+ G   W R G++I YYKN+FARS+   GG  G+SYYT TF + F +  DVCY AYHYPYT++ L                             K    K+E   TP+     Y+++  LC T+ GN  P+LTI+   +  SS+     R +P +FL++RVHPGE+NASWVMKG +++L+ ++ ++  LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTK L+  L+   ++P+VFCD+HGHSR+KN+FM+GCS L   + +   + T  D + ED  Y  LP IL+ I+ AFS+ S SF VE+SKESTARVVVWR+ GVQRSYTMEST C  DQG YK   I    L+E+G QF  ALL +   +
Sbjct:  643 GVQRSKIFQDIERLIHPNDILDKVVYDLDI-------------------------PNCPLVKDEGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYYTLTFSMSFSHKDDVCYFAYHYPYTFSTL-----------------------------KMHLSKLEDLRTPQ----IYLRQDVLCETLGGNHCPLLTITAMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLAHIQRAPLVFCDYHGHSRKKNVFMYGCS-LKETVWQSNISATSSDLQ-EDLGYRTLPKILSEIAPAFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGFQIGTRELEEMGAQFCVALLRLKRLI 1115          

HSP 2 Score: 207.994 bits (528), Expect = 8.079e-54
Identity = 114/318 (35.85%), Postives = 185/318 (58.18%), Query Frame = 2
Query:  245 IEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINEL--VGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            ++ PE+  R+++ K    ++ ++ +L+   D QT+ NI+ I+ EL  VG+   G R +  V  G +  L Q +   SKE  P  + +  LH +L K+  KD+R G++AR+S  L V VSL+R  +                    K +L  L+VLR+YS NL+N   LG+I  + L+ KII   +K N  +LKV+++ L   +++K N+ RAV+ G +A+LL L+ DW+R D++ +H+ +RK +L  ++++ N++ G+KAF++ADG+  L+           L+ LV  SSLI+RKCFPKNRLPL    S  +  LP+
Sbjct:   16 VDPPEKSGREIMSKGSSGMEVILASLENCRDVQTTLNILYILTELLSVGR---GHRVEVFVSKGGTGILFQILIAASKESPPSMELMLHLHSLLAKVGPKDRRFGMKARLSGALNVTVSLIRQNLQNT-----------------KLLLPCLHVLRVYSSNLVNAMSLGKIEGVELMFKIIGPYSKKNTTLLKVALDALGALLKSKTNARRAVDGGYVAVLLSLYQDWHRNDTRCRHILIRKGLLVCLRNITNIKLGRKAFIDADGMRILHNSSTECLPVRTLDPLVNTSSLIMRKCFPKNRLPLPTMKSAFQFQLPH 313          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 503.827 bits (1296), Expect = 3.180e-154
Identity = 258/533 (48.41%), Postives = 340/533 (63.79%), Query Frame = 2
Query: 2669 ALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPL---QSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQE--LCTTILGNPVPVLTISNWLKDGSSST----RQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESV 4240
             + ++KI  D+ R+I   DILDK V+DL+                           + PL   +  SL+F+SQFE GNLRKAIQ R+YEYDL+LN D+N+NH  QWFYF VS M   V YRFNIINCEK NSQFN+GMQ L+YSV+EA+ G   W R G++I YYKN+FARS+   GG  G+SYYT TF + F +  DVCY AYHYPYT++ L                             K    K+E   TP+     Y+++  LC T+ GN  P+LTI+   +  SS+     R +P +FL++RVHPGE+NASWVMKG +++L+ ++ ++  LR+ Y+FKIVPMLNPDGVING HRCS++G+DLNR+W +P   L+PTI+HTK L+  L+   ++P+VFCD+HGHSR+KN+FM+GCS L   + +   + T  D + ED  Y  LP IL+ I+ AFS+ S SF VE+SKESTARVVVWR+ GVQRSYTMEST C  DQG YK   I    L+E+G QF  ALL +   +
Sbjct:  692 GVQRSKIFQDIERLIHPNDILDKVVYDLDI-------------------------PNCPLVKDEGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYYTLTFSMSFSHKDDVCYFAYHYPYTFSTL-----------------------------KMHLSKLEDLRTPQ----IYLRQDVLCETLGGNHCPLLTITAMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLAHIQRAPLVFCDYHGHSRKKNVFMYGCS-LKETVWQSNISATSSDLQ-EDLGYRTLPKILSEIAPAFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGFQIGTRELEEMGAQFCVALLRLKRLI 1164          

HSP 2 Score: 215.698 bits (548), Expect = 3.651e-56
Identity = 128/358 (35.75%), Postives = 208/358 (58.10%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINEL--VGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPN 1192
            S L++ LD +E++  N  A   ++ E++  R  T+KIL LI+  E+  R+++ K    ++ ++ +L+   D QT+ NI+ I+ EL  VG+   G R +  V  G +  L Q +   SKE  P  + +  LH +L K+  KD+R G++AR+S  L V VSL+R  +                    K +L  L+VLR+YS NL+N   LG+I  + L+ KII   +K N  +LKV+++ L   +++K N+ RAV+ G +A+LL L+ DW+R D++ +H+ +RK +L  ++++ N++ G+KAF++ADG+  L+           L+ LV  SSLI+RKCFPKNRLPL    S  +  LP+
Sbjct:   16 SSLLTLLDQIERM--NGEAML-RDTELA--RHVTAKILHLIQTQEKSGREIMSKGSSGMEVILASLENCRDVQTTLNILYILTELLSVGR---GHRVEVFVSKGGTGILFQILIAASKESPPSMELMLHLHSLLAKVGPKDRRFGMKARLSGALNVTVSLIRQNLQNT-----------------KLLLPCLHVLRVYSSNLVNAMSLGKIEGVELMFKIIGPYSKKNTTLLKVALDALGALLKSKTNARRAVDGGYVAVLLSLYQDWHRNDTRCRHILIRKGLLVCLRNITNIKLGRKAFIDADGMRILHNSSTECLPVRTLDPLVNTSSLIMRKCFPKNRLPLPTMKSAFQFQLPH 348          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000020650.2 (pep primary_assembly:ASM223467v1:6:31072043:31073402:1 gene:ENSORLG00000016495.2 transcript:ENSORLT00000020650.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 2.297e-48
Identity = 96/232 (41.38%), Postives = 138/232 (59.48%), Query Frame = 2
Query: 3467 ILGNPVPVLTISNWLKDGSSSTRQ---KPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQA-------FSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTY 4132
            + GN V VLT+++     S+S R+   K  V LT+RVHPGE+NASWVM+G +D+LL  +  ++ LRD +VFK+VPMLNPDGV+ G +RCS+AG+DLNR +        P ++HTK ++  L +      ++CDFHGH+R+ N FM+GC                             PH+L+  + A       FS +SC F V+KSKE T R+ +WR  G+Q SYTME+++
Sbjct:   14 LAGNAVHVLTVTSE----SASRREAAHKRAVVLTARVHPGETNASWVMEGLLDFLLGDSEDAQVLRDNFVFKVVPMLNPDGVVVGNYRCSLAGRDLNRYYRSVLRESFPGVWHTKNMVERL-RAEMEVALYCDFHGHNRKNNAFMYGCR---------------------------RPHLLSCCTSAFVQLPLQFSFQSCKFRVQKSKEGTGRICMWR-LGIQNSYTMETSF 212          
BLAST of ATP/GTP binding protein 1 vs. Ensembl Medaka
Match: agbl5 (ATP/GTP binding protein like 5 [Source:NCBI gene;Acc:101155157])

HSP 1 Score: 112.849 bits (281), Expect = 1.254e-24
Identity = 96/367 (26.16%), Postives = 159/367 (43.32%), Query Frame = 2
Query: 2867 FDSQFECGNLRKAIQVRQ------------------------YEYDLILNPDV----NNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGTSYWKRY----GSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVF------------------LTSRVHPGESNASWVMKGCIDYLLSSN-PISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMM 3814
            F S+F+ GNL +  +V +                        YE+++   PD     + N    WFYF V         + N+ N       ++ GM PL+ S+     G + W+R      +EI    N F  S              FT  +     A   Y ++ YPY+YT          Q+   K D+ +   A+           +   S P   + ++ + LC ++ GN V +LT++N  K       + P +F                  L+SRVHPGE+ +S+V  G + ++L  + P +  LR ++VFK++PMLNPDGV+ G +R    G +LNR++++P   L+P+I+  K L++
Sbjct:   10 FSSKFDSGNLARVEKVERGNLSPASDTASSGSSPSGSHLAPDYEFNVWTQPDCAGTEHENGNRSWFYFSVKGAAPGKLVKINVRNMNNQRKLYSQGMAPLVRSLP----GKNRWERIRDRPTTEII--DNQFVLS--------------FTHRLSEARGATT-YFSFCYPYSYTEC--------QEMLQKLDDSYPNAAQ-----------LSPSSAPST-VYYHRELLCRSLDGNRVDLLTVTNCSKMQEEREARLPKLFPDTNTPRPHRFAGKRVFFLSSRVHPGETPSSFVFNGFLSFILRRDDPRAHMLRSMFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLNPSPELHPSIYAAKTLLL 335          
BLAST of ATP/GTP binding protein 1 vs. Planmine SMEST
Match: SMESG000063805.1 (SMESG000063805.1)

HSP 1 Score: 2721.81 bits (7054), Expect = 0.000e+0
Identity = 1417/1451 (97.66%), Postives = 1420/1451 (97.86%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNXXXXXXXXXXXXXXXXXXXXXXXXXXYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINEXXXXXXXXXXXXXXXXXXXXXXGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMRNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFG-------------------------------MQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID 4384
            SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTP+APRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQM+NENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFG                               MQPLLYSVKEAMLGTSYWKRYGSEIFYY+NHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID
Sbjct:   13 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPSAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMKNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGKILVLYYNFFHFIFILYKPYFHYHIIWISYWMQPLLYSVKEAMLGTSYWKRYGSEIFYYRNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID 1463          
BLAST of ATP/GTP binding protein 1 vs. Planmine SMEST
Match: SMESG000063805.1 (SMESG000063805.1)

HSP 1 Score: 2719.49 bits (7048), Expect = 0.000e+0
Identity = 1417/1460 (97.05%), Postives = 1420/1460 (97.26%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNXXXXXXXXXXXXXXXXXXXXXXXXXXYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINEXXXXXXXXXXXXXXXXXXXXXXGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMRNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNF----------------------------------------GMQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID 4384
            SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTP+APRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQM+NENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNF                                        GMQPLLYSVKEAMLGTSYWKRYGSEIFYY+NHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID
Sbjct:   13 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPSAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMKNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGKILVLYYNFFHFIFILYKPYFHYHIIWISYFNELFLVHSGMQPLLYSVKEAMLGTSYWKRYGSEIFYYRNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID 1472          
BLAST of ATP/GTP binding protein 1 vs. Planmine SMEST
Match: SMESG000063805.1 (SMESG000063805.1)

HSP 1 Score: 2683.29 bits (6954), Expect = 0.000e+0
Identity = 1402/1451 (96.62%), Postives = 1405/1451 (96.83%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNXXXXXXXXXXXXXXXXXXXXXXXXXXYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINEXXXXXXXXXXXXXXXXXXXXXXGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMRNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFG-------------------------------MQPLLYSVKEAMLGTSYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID 4384
            SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTP+APRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQM+NENLNVNSIINDLVDI               DLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFG                               MQPLLYSVKEAMLGTSYWKRYGSEIFYY+NHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID
Sbjct:   13 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPSAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMKNENLNVNSIINDLVDI---------------DLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGKILVLYYNFFHFIFILYKPYFHYHIIWISYWMQPLLYSVKEAMLGTSYWKRYGSEIFYYRNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYIAYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFYSTPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSRVHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGCHRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHGHSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQAFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHLHINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNSRSEKNYQSPIKKVSLTRKSSEID 1448          
BLAST of ATP/GTP binding protein 1 vs. Planmine SMEST
Match: SMESG000063805.1 (SMESG000063805.1)

HSP 1 Score: 1806.57 bits (4678), Expect = 0.000e+0
Identity = 982/988 (99.39%), Postives = 985/988 (99.70%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNXXXXXXXXXXXXXXXXXXXXXXXXXXYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINEXXXXXXXXXXXXXXXXXXXXXXGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMRNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLY 3088
            SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTP+APRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQM+NENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFG   +LY
Sbjct:   13 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPSAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMKNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGKILVLY 1000          
BLAST of ATP/GTP binding protein 1 vs. Planmine SMEST
Match: SMESG000063805.1 (SMESG000063805.1)

HSP 1 Score: 1765.36 bits (4571), Expect = 0.000e+0
Identity = 967/988 (97.87%), Postives = 970/988 (98.18%), Query Frame = 2
Query:  125 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNXXXXXXXXXXXXXXXXXXXXXXXXXXYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINEXXXXXXXXXXXXXXXXXXXXXXGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMRNENLNVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLY 3088
            SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTP+APRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQM+NENLNVNSIINDLVDI               DLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFG   +LY
Sbjct:   13 SRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERIYRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQTLVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRARISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYSRNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNSARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKKAFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYGSVMKCPLPNTATFHNKARMLLEDYSKTESTPSAPRSTSPVDINPIIPILNCQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAVNLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSSTAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSIIYQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSENSSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQPKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMKNENLNVNSIINDLVDI---------------DLGLNSPENVSNDNGHLPESFDSFTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSLLINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNIDALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNLDELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNHQIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGKILVLY 985          
The following BLAST results are available for this feature:
BLAST of ATP/GTP binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGTPBP12.220e-15949.14ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:... [more]
AGTPBP16.079e-15949.14ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:... [more]
AGTPBP19.117e-15949.52ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:... [more]
AGTPBP12.562e-15849.24ATP/GTP binding protein 1 [Source:HGNC Symbol;Acc:... [more]
AGBL11.490e-15450.00ATP/GTP binding protein like 1 [Source:HGNC Symbol... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccpp-12.116e-9037.58Cytosolic carboxypeptidase 1 [Source:UniProtKB/Sw... [more]
ccpp-64.972e-5230.25Cytosolic carboxypeptidase 6 [Source:UniProtKB/Sw... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nna12.056e-8134.16gene:FBgn0265726 transcript:FBtr0340677[more]
Nna12.115e-8033.60gene:FBgn0265726 transcript:FBtr0340676[more]
Nna12.115e-8033.60gene:FBgn0265726 transcript:FBtr0340673[more]
Nna13.785e-8034.16gene:FBgn0265726 transcript:FBtr0340672[more]
Nna13.875e-7934.09gene:FBgn0265726 transcript:FBtr0340675[more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agtpbp11.513e-16349.15ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
agtpbp19.046e-16049.15ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
agbl16.818e-14344.84ATP/GTP binding protein-like 1 [Source:ZFIN;Acc:ZD... [more]
agbl14.365e-14244.84ATP/GTP binding protein-like 1 [Source:ZFIN;Acc:ZD... [more]
agbl28.305e-9639.00ATP/GTP binding protein-like 2 [Source:NCBI gene;A... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agtpbp12.349e-16149.52ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp11.550e-15949.34ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp12.359e-15949.52ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp19.081e-15949.52ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp19.971e-15949.52ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agbl12.081e-15948.03ATP/GTP binding protein-like 1 [Source:MGI Symbol;... [more]
Agtpbp15.507e-15949.05ATP/GTP binding protein 1 [Source:MGI Symbol;Acc:M... [more]
Agtpbp18.206e-15949.05ATP/GTP binding protein 1 [Source:MGI Symbol;Acc:M... [more]
Agbl17.804e-15849.40ATP/GTP binding protein-like 1 [Source:MGI Symbol;... [more]
Agbl18.759e-11848.10ATP/GTP binding protein-like 1 [Source:MGI Symbol;... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4U2V3|CBPC1_DANRE5.338e-15949.15Cytosolic carboxypeptidase 1 OS=Danio rerio OX=795... [more]
sp|Q6DD21|CBPC1_XENLA7.947e-15949.52Cytosolic carboxypeptidase 1 OS=Xenopus laevis OX=... [more]
sp|Q09M05|CBPC4_MOUSE1.681e-15848.03Cytosolic carboxypeptidase 4 OS=Mus musculus OX=10... [more]
sp|Q9UPW5|CBPC1_HUMAN2.919e-15849.14Cytosolic carboxypeptidase 1 OS=Homo sapiens OX=96... [more]
sp|A9JRL3|CBPC1_XENTR5.282e-15849.52Cytosolic carboxypeptidase 1 OS=Xenopus tropicalis... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TRE83.648e-7554.32Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2C9KMQ53.309e-17852.55Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KMQ75.818e-17852.55Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KMW19.071e-17852.55Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3JTA42.423e-17651.49cytosolic carboxypeptidase 1 isoform X1 OS=Lingula... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agtpbp13.097e-16049.90ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp13.565e-16049.90ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agbl17.628e-14745.13ATP/GTP binding protein-like 1 [Source:ZFIN;Acc:ZD... [more]
agbl21.993e-8637.39cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl24.110e-8537.23cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
agtpbp14.200e-15647.74ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428584.078e-9538.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343051.317e-9043.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492706.444e-9037.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474541.212e-5131.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321341.771e-4340.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agtpbp12.452e-15448.41ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp13.147e-15448.41ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp13.180e-15448.41ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000020650.22.297e-4841.38pep primary_assembly:ASM223467v1:6:31072043:310734... [more]
agbl51.254e-2426.16ATP/GTP binding protein like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of ATP/GTP binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063805.10.000e+097.66SMESG000063805.1[more]
SMESG000063805.10.000e+097.05SMESG000063805.1[more]
SMESG000063805.10.000e+096.62SMESG000063805.1[more]
SMESG000063805.10.000e+099.39SMESG000063805.1[more]
SMESG000063805.10.000e+097.87SMESG000063805.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015121 ID=SMED30015121|Name=ATP/GTP binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4677bp
GTTTAATTGTTTCAAATTTTTAATTGTTACTAAATACAACAGTTACCGTA
TTTAAATTATTTTATTTTTGTAATTGAACTTTAATGTTTTGATATTTTAT
TTTGAATTCTATTTAATGGATAAAAGTCGACTTATATCTCAACTAGATAT
ATTAGAAAAGATTTACGCTAATAAAAGTGCCTTTAAATCGAAAGAAGAAG
AAATCAGTACTTTTCGAGTGACAACGAGCAAAATATTAAGTCTAATTGAA
GGCCCTGAACGTATTTATCGTGATGTTATTATCAAACATGTTGGACAAAT
TGATGCCTTAGTAAATACATTGCAGACTGTCAACGATTCACAGACGTCTT
ATAACATAATCAAAATCATCAATGAGCTCGTTGGGAAATCGAATACTGGG
AAAAGAGCACAAACCCTTGTGCATCACGGTGTTTCGAAAGCTCTGTTGCA
ATGTATTTATTTAGAATCCAAAGAACAATATCCATGTGAAGATTTTCTAT
TTTTATTACATCAAGTTTTATACAAAATTGCTGCCAAAGATAAAAGAATA
GGAGTGAGAGCCCGTATTAGTCAATGTCTTCCAGTGCTAGTAAGCTTAAT
GAGAACTCAGGTCAATCTTGTGCCACACAATCGCGGATCACTGGGCAGTG
TTCCGATTTCTGGTTCTTTGGCAAAAAATATTCTCACCTTACTTTATGTG
TTACGATTGTACAGCCGAAATCTCATCAATACGTCGAGATTAGGACGGAT
TGGTGCAATAAATCTTCTTTTGAAAATTATTAATTATTGTGCAAAGAACA
ATATGAATATTTTGAAAGTCAGCATTGAGACTCTGAATCTATGCGTTAGA
ACAAAGAACAATTCAGCCAGGGCTGTCAACCAAGGTGCAATGGCCATGCT
GCTAGAATTATTTCTGGATTGGTATAGAATAGATAGCAAGGATAAGCACT
TAAATTTGCGAAAGTCAATTTTGTGTGTCATTAAAAGCCTAATTAATTTA
AGGTCTGGAAAAAAGGCTTTTTTGGAAGCCGATGGCCTTCACACATTGTA
CGGGTTTTGTGACACAAACAAAACCCACAACAACCTAGAATCATTGGTAA
CCATTTCCAGCTTAATTTTGAGAAAATGCTTCCCGAAAAATAGACTTCCG
TTAACTCACTACGGATCAGTCATGAAATGTCCTTTACCAAATACGGCTAC
TTTTCATAATAAAGCTCGGATGCTATTGGAAGATTACAGTAAAACCGAAA
GTACACCAAATGCTCCTCGAAGTACCTCTCCAGTTGACATTAACCCAATT
ATTCCTATACTAAACTGTCAAGGAGATAACGAGAAACCTGCTTATAGTCA
TATTAGCAAATATGACGGAGAAGAATTCTTCCAAGAGTTGGTTACAGATG
ACTCGTTAATAATTGAAGCAAAACAAATGCCATTAGATAAACAAAGTAAC
CGACAAAGAGCCGTGAACTTATTTCGTTCATTAGATCGGAAACTGTCGAT
TTCTAGAAAAGATTCACTTGTCCAACAGCGCCATCAAACGTATTTAAATA
GGTTTTGCAATTTCACCACAAACAACAGTCCAACCAATCTGTTATCGTCA
CCACAACTATCATCGACGGCTCCGCTTCCACCGCCGCAACCTCCAAAATC
ACCCATTCTGCAACCATATGATCGAATGGTTTGTCCATCTCCAGATTGCA
TTAATGAGAAAAAAGATAAAACCGATCAGCTTTATGTCGAAGATATGTTG
GATAACTCCATCATCTATCAGCCATCTGATGACCGGCCAGTGGAACGACT
AAAATTCTGTTATGATAAATTTCTACTGGAAAGAGAAACCTTGAATAAAG
GAATTAATGAATTAAAAAAAAAGTTATCATTTGAAGATTCGGATAAATCT
GATAAAAGTGAAAATTCCTCCGATAACGGAATCGGATACAATGAAAAAAA
TAGTTTAAAAGCCAAAGAATCTCTCAATCTGCCAATTGTGACAGTGCAAC
TAAAGATGTTATCAACAGAAAGAAAACTTAATCGAACAACTTTGAGGAGA
AATGAAATTGTTCAGCCGAAAAATTTGGAAACTAATGAAGAAAAATCCAT
CAATTTTATTTGTTCACCTATCAATATCCAAAAACGAGATTCGATCCCAT
TTCAATGTTCTGGAATGTATATGAGGAGCAAGCGAGGGTCGAATCAAATG
AGAAACGAAAATTTAAATGTCAACTCGATTATCAACGATTTAGTGGACAT
TGATAACAAACCAATTGATCCATTACCAAAATTAGATTTGATTGCAGATC
TTGGTTTAAATTCGCCGGAAAACGTATCAAATGACAATGGGCATCTTCCT
GAGAGTTTCGATAGTTTTACAGACACATATATAAAAATCTCCAGCCTCGT
TACTCGAAGTCTAGGACGATTCAGTAGAATTGGTTATCCAGATTTGATGG
AAAATTCGGTAAAAATGAACCAGGCCGAACCGTTATCAGATTCATTCCTT
CAAAATCTTTCCTTATTAATAAATGATGAAATGAAATCTAAAAACAACAA
TAACGCAACTAAAAAAGGTTCAAAACCTCCAATAAAGAAACCATCAACAA
GATCTAACAAAAACAACACCAAATCTAGCTCAATTCCTCGGCCGTCTTCT
GCTGTGTCTAATATTGACGCTTTAGCTCAAAATAAAATTCTTGACGATCT
ACGACGAATAATTGACGGTGAAGATATTTTAGATAAAACTGTCTTTGATC
TTGAAGCTATTATCCAAAGCACAATGAACTCCTATAACATGGAAAATTCT
ATTCATACAAATTTGGATGAATTAGAAGTTGACAAATCGACACCCCTTCA
ATCACCTTCACTTCAGTTCGATTCGCAATTTGAATGCGGAAATTTACGGA
AAGCCATTCAAGTTCGCCAATATGAATATGACTTAATTTTGAATCCTGAT
GTCAACAATAATCATCAAATACAGTGGTTCTATTTCCGGGTTTCGGCCAT
GGAGTCCAGGGTGCCTTATCGATTCAATATTATCAATTGTGAAAAGCCAA
ACAGTCAATTCAATTTTGGGATGCAGCCGCTTCTTTATTCGGTGAAAGAG
GCAATGCTTGGAACTTCGTATTGGAAAAGATACGGATCAGAGATTTTTTA
CTATAAAAATCATTTTGCAAGAAGTGCAGCGACATGTGGTGGGAATATAG
GAAGATCTTATTATACATTTACGTTTGTAATTGAATTCCCATATTCGGCA
GATGTATGCTACATCGCATATCATTATCCCTATACTTATACTCGTTTACT
CACTGACCTCCATCAAGCAACTCAGAAATTCAAATTCAAAGCAGATGAAA
AATTCGACGTCGATGCTGAAGGAGATTCAAAAGAAAAGTTTCTCACTCAT
AAAATAGAATTTTATTCAACTCCCGAAGACGGTATCTTATTTTACATTCA
GGAATTGTGTACGACAATTCTTGGTAATCCAGTACCGGTTCTTACTATTT
CTAATTGGTTAAAAGATGGTTCCAGTTCAACAAGGCAAAAACCTTATGTA
TTTCTCACGAGTCGCGTGCACCCAGGTGAAAGTAATGCTAGTTGGGTAAT
GAAGGGCTGTATAGATTATTTGTTGAGTTCCAATCCAATCTCAGAACAAT
TGAGAGATCTTTATGTGTTCAAGATTGTTCCTATGCTCAATCCAGACGGT
GTCATTAATGGCTGTCATCGTTGCTCAATGGCCGGACAAGACCTCAACAG
ACGATGGATGGATCCATGTGAAGTGCTCAATCCGACAATATTTCATACCA
AAGGTCTTATGATGCTGTTATCAAAATATGGACAGAGCCCCATGGTCTTT
TGCGATTTCCATGGTCATTCGCGGCGTAAGAACATTTTTATGTTTGGTTG
CAGTCCTCTCTTGTCTTGGATAAACGAAGACACAAATAATCCAACTTTTG
TTGATCAGAAAACTGAAGACAAAAGCTATTTACTCCTTCCTCATATACTA
AATAATATATCTCAAGCGTTTTCCATAGAAAGTTGCAGTTTCAATGTTGA
AAAATCCAAAGAGTCAACCGCTCGAGTTGTTGTGTGGCGGCAATTCGGTG
TACAGAGGAGTTACACAATGGAATCAACTTATTGTAGTTTCGATCAAGGA
AATTACAAACATCTCCACATCAATGTACCAATGCTCCAGGAAATAGGATG
CCAATTTGCAGAAGCACTTTTACACATCAATGAATCAGTGATTAATCATT
CCAATAAAAATGCAGTTTTTCCTAAATTTATTCAAGAATACAATTTTAAT
ACTATCTCAAATAGTAGATCTGAAAAAAATTATCAATCTCCGATAAAAAA
AGTGTCACTGACAAGAAAATCTAGTGAAATTGATTCCAGTGAAGTGCTTG
TTAAAAAAGAGGAAGAAGATGAAGATCAGCTGAGTAGCAATGATGAATTT
GAGGACGAAGAAGATGAAGAGGAAGAATCAGAGTCAGATAAAGATGTAGA
ATTTAATGACGAAGACGAAGTGGAAGATTCTGATTAAATTATTAAATAAA
GATAATCTTATTTTCTATTAAAGTAGTCCGATGATTATTTTTATGCCATT
TACTGATTTATGAATCTGTATATTTGTTAGTTGATCTTTGATTAAATATG
CATTTGAATGATAAAAAAATATGAAAC
back to top

protein sequence of SMED30015121-orf-1

>SMED30015121-orf-1 ID=SMED30015121-orf-1|Name=SMED30015121-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1474bp
MDKSRLISQLDILEKIYANKSAFKSKEEEISTFRVTTSKILSLIEGPERI
YRDVIIKHVGQIDALVNTLQTVNDSQTSYNIIKIINELVGKSNTGKRAQT
LVHHGVSKALLQCIYLESKEQYPCEDFLFLLHQVLYKIAAKDKRIGVRAR
ISQCLPVLVSLMRTQVNLVPHNRGSLGSVPISGSLAKNILTLLYVLRLYS
RNLINTSRLGRIGAINLLLKIINYCAKNNMNILKVSIETLNLCVRTKNNS
ARAVNQGAMAMLLELFLDWYRIDSKDKHLNLRKSILCVIKSLINLRSGKK
AFLEADGLHTLYGFCDTNKTHNNLESLVTISSLILRKCFPKNRLPLTHYG
SVMKCPLPNTATFHNKARMLLEDYSKTESTPNAPRSTSPVDINPIIPILN
CQGDNEKPAYSHISKYDGEEFFQELVTDDSLIIEAKQMPLDKQSNRQRAV
NLFRSLDRKLSISRKDSLVQQRHQTYLNRFCNFTTNNSPTNLLSSPQLSS
TAPLPPPQPPKSPILQPYDRMVCPSPDCINEKKDKTDQLYVEDMLDNSII
YQPSDDRPVERLKFCYDKFLLERETLNKGINELKKKLSFEDSDKSDKSEN
SSDNGIGYNEKNSLKAKESLNLPIVTVQLKMLSTERKLNRTTLRRNEIVQ
PKNLETNEEKSINFICSPINIQKRDSIPFQCSGMYMRSKRGSNQMRNENL
NVNSIINDLVDIDNKPIDPLPKLDLIADLGLNSPENVSNDNGHLPESFDS
FTDTYIKISSLVTRSLGRFSRIGYPDLMENSVKMNQAEPLSDSFLQNLSL
LINDEMKSKNNNNATKKGSKPPIKKPSTRSNKNNTKSSSIPRPSSAVSNI
DALAQNKILDDLRRIIDGEDILDKTVFDLEAIIQSTMNSYNMENSIHTNL
DELEVDKSTPLQSPSLQFDSQFECGNLRKAIQVRQYEYDLILNPDVNNNH
QIQWFYFRVSAMESRVPYRFNIINCEKPNSQFNFGMQPLLYSVKEAMLGT
SYWKRYGSEIFYYKNHFARSAATCGGNIGRSYYTFTFVIEFPYSADVCYI
AYHYPYTYTRLLTDLHQATQKFKFKADEKFDVDAEGDSKEKFLTHKIEFY
STPEDGILFYIQELCTTILGNPVPVLTISNWLKDGSSSTRQKPYVFLTSR
VHPGESNASWVMKGCIDYLLSSNPISEQLRDLYVFKIVPMLNPDGVINGC
HRCSMAGQDLNRRWMDPCEVLNPTIFHTKGLMMLLSKYGQSPMVFCDFHG
HSRRKNIFMFGCSPLLSWINEDTNNPTFVDQKTEDKSYLLLPHILNNISQ
AFSIESCSFNVEKSKESTARVVVWRQFGVQRSYTMESTYCSFDQGNYKHL
HINVPMLQEIGCQFAEALLHINESVINHSNKNAVFPKFIQEYNFNTISNS
RSEKNYQSPIKKVSLTRKSSEIDSSEVLVKKEEEDEDQLSSNDEFEDEED
EEEESESDKDVEFNDEDEVEDSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040626Pepdidase_M14_N
IPR011989ARM-like
IPR000834Peptidase_M14
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0004181metallocarboxypeptidase activity
GO:0008270zinc ion binding
GO:0005488binding
GO:0004180carboxypeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0015631tubulin binding
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0001754eye photoreceptor cell differentiation
GO:0007005mitochondrion organization
GO:0021702cerebellar Purkinje cell differentiation
GO:0021772olfactory bulb development
GO:0035609C-terminal protein deglutamylation
GO:0035610protein side chain deglutamylation
GO:0050905neuromuscular process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 566..586
NoneNo IPR availableGENE3DG3DSA:2.60.40.3120coord: 906..1056
e-value: 1.1E-11
score: 46.5
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 1096..1376
e-value: 7.0E-76
score: 257.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1437..1473
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 589..609
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 807..846
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1421..1473
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1421..1436
NoneNo IPR availablePANTHERPTHR12756ATP/GTP-BINDING MOTIF CONTAINING PROTEIN RELATEDcoord: 1095..1400
NoneNo IPR availablePANTHERPTHR12756:SF24CYTOSOLIC CARBOXYPEPTIDASE 1coord: 855..1068
NoneNo IPR availablePANTHERPTHR12756:SF24CYTOSOLIC CARBOXYPEPTIDASE 1coord: 1095..1400
coord: 72..360
NoneNo IPR availablePANTHERPTHR12756ATP/GTP-BINDING MOTIF CONTAINING PROTEIN RELATEDcoord: 72..360
coord: 855..1068
NoneNo IPR availableCDDcd06906M14_Nna1coord: 1107..1371
e-value: 2.64952E-143
score: 437.195
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 1046..1364
IPR000834Peptidase M14, carboxypeptidase APFAMPF00246Peptidase_M14coord: 1111..1220
e-value: 4.8E-14
score: 52.9
IPR040626Cytosolic carboxypeptidase, N-terminalPFAMPF18027Pepdidase_M14_Ncoord: 918..1052
e-value: 8.0E-11
score: 42.3
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 43..341