Tissue factor pathway inhibitor-1

Overview
NameTissue factor pathway inhibitor-1
Smed IDSMED30015120
Length (bp)400
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tissue factor pathway inhibitor-1 (SMED30015120) t-SNE clustered cells

Violin plots show distribution of expression levels for Tissue factor pathway inhibitor-1 (SMED30015120) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tissue factor pathway inhibitor-1 (SMED30015120) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tissue factor pathway inhibitor-1 (SMED30015120) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015120

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015120SMESG000038002.1 SMESG000038000.1 SMESG000037997.1 SMESG000037996.1 SmedASXL_011684SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30015120SMESG000038000.1 SMESG000037996.1 dd_Smed_v4_2116_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015120SMESG000038000.1 SMESG000037996.1 dd_Smed_v4_2116_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015120SMESG000038002.1 SMESG000038000.1 SMESG000037996.1 Contig16352newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015120SMESG000038002.1 SMESG000038000.1 SMESG000037996.1 Contig16352uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015120SMESG000038000.1 SMESG000037996.1 Contig26885newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015120SMESG000038000.1 SMESG000037996.1 Contig26885uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 93.2041 bits (230), Expect = 5.276e-24
Identity = 46/96 (47.92%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNC---EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            G CKA + R+F+N  + +CE FIYGGC  N N F++L++C+ +C       C   EDP   G C+ YI RYFYN+ +++CERF YGGC  N NNF+
Sbjct:   61 GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTREKPDFCFLEEDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFE 153          

HSP 2 Score: 65.855 bits (159), Expect = 1.409e-13
Identity = 29/52 (55.77%), Postives = 42/52 (80.77%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            EDP   G+C+ YI RYFYN+ +++CERF YGGC  N NNF+TL++C+++CE+
Sbjct:  116 EDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 164          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 89.3521 bits (220), Expect = 3.119e-22
Identity = 46/109 (42.20%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNC----------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            G CKA + R+F+N  + +CE FIYGGC  N N F++L++C+ +C   N                    EDP   G C+ YI RYFYN+ +++CERF YGGC  N NNF+
Sbjct:   61 GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFE 166          

HSP 2 Score: 67.0106 bits (162), Expect = 1.080e-13
Identity = 29/52 (55.77%), Postives = 42/52 (80.77%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            EDP   G+C+ YI RYFYN+ +++CERF YGGC  N NNF+TL++C+++CE+
Sbjct:  129 EDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 177          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 89.3521 bits (220), Expect = 3.119e-22
Identity = 46/109 (42.20%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNC----------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            G CKA + R+F+N  + +CE FIYGGC  N N F++L++C+ +C   N                    EDP   G C+ YI RYFYN+ +++CERF YGGC  N NNF+
Sbjct:   61 GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFE 166          

HSP 2 Score: 67.0106 bits (162), Expect = 1.080e-13
Identity = 29/52 (55.77%), Postives = 42/52 (80.77%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            EDP   G+C+ YI RYFYN+ +++CERF YGGC  N NNF+TL++C+++CE+
Sbjct:  129 EDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 177          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 88.1965 bits (217), Expect = 2.037e-21
Identity = 46/109 (42.20%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNC----------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            G CKA + R+F+N  + +CE FIYGGC  N N F++L++C+ +C   N                    EDP   G C+ YI RYFYN+ +++CERF YGGC  N NNF+
Sbjct:   61 GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFE 166          

HSP 2 Score: 84.7297 bits (208), Expect = 4.605e-20
Identity = 50/132 (37.88%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE-------------ETNKQN---------------------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            EDP   G+C+ YI RYFYN+ +++CERF YGGC  N NNF+TL++C+++CE             + N  N                     C  P  +G C+A   R++YN    KC  F Y GCG N NNF
Sbjct:  129 EDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNF 257          

HSP 3 Score: 48.1358 bits (113), Expect = 7.008e-7
Identity = 22/53 (41.51%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            C  P  +GLC+A   R++YN    KC  F Y GCG N NNF + ++C   C++
Sbjct:  217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKK 269          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 88.1965 bits (217), Expect = 2.037e-21
Identity = 46/109 (42.20%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNC----------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            G CKA + R+F+N  + +CE FIYGGC  N N F++L++C+ +C   N                    EDP   G C+ YI RYFYN+ +++CERF YGGC  N NNF+
Sbjct:   61 GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFE 166          

HSP 2 Score: 84.7297 bits (208), Expect = 4.605e-20
Identity = 50/132 (37.88%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE-------------ETNKQN---------------------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            EDP   G+C+ YI RYFYN+ +++CERF YGGC  N NNF+TL++C+++CE             + N  N                     C  P  +G C+A   R++YN    KC  F Y GCG N NNF
Sbjct:  129 EDP---GICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNF 257          

HSP 3 Score: 48.1358 bits (113), Expect = 7.008e-7
Identity = 22/53 (41.51%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            C  P  +GLC+A   R++YN    KC  F Y GCG N NNF + ++C   C++
Sbjct:  217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKK 269          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Celegans
Match: mec-1 (pep chromosome:WBcel235:V:6956542:6966422:1 gene:WBGene00003165.1 transcript:T07H8.4h.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mec-1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.808e-18
Identity = 40/93 (43.01%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKG-FCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C      +FYN T   C++F+YGGCG N N F T + CQ  CE T    C + L +G +C+A   RY++N  + +C+ F Y GCG +GNNF
Sbjct: 1746 GSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRFDTFEICQKACEVTGTDPCMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNF 1838          

HSP 2 Score: 69.3218 bits (168), Expect = 1.392e-14
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-----CEDPLAKGFCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNF 396
            C +P+  G C+   P ++Y+  S  C  F Y GCG N N F T+  C++LC   N  N     C  P+  G+ K   + +P    R++Y+    KC +  Y GCG N NNF
Sbjct: 1533 CLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNF 1643          

HSP 3 Score: 58.151 bits (139), Expect = 1.158e-10
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  103 EDPLAKGLC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET--NKQNCEDPLA------KGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E P  +G+C    +  P   +   ++KC  F Y GCG N N F T    QD+CE T     N  DP         G C      +FYN T   C++F+YGGCG N N F
Sbjct: 1675 EPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRFAT----QDICENTCNGLMNSNDPRICSFSPDWGSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRF 1779          

HSP 4 Score: 50.447 bits (119), Expect = 6.574e-8
Identity = 27/100 (27.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:  136 YIPRYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            +  +++++ +S  C  F +  C ++  N F   K C   C+            E +K  C +P+  G C+   P ++Y+  S  C  F Y GCG N N F
Sbjct: 1474 WTEKWYFDQSSGDCSSFWWDECTSSSQNIFPDEKSCTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRF 1573          

HSP 5 Score: 50.0618 bits (118), Expect = 7.170e-8
Identity = 39/136 (28.68%), Postives = 60/136 (44.12%), Query Frame = 1
Query:   58 LSFIIFTIESLEQNCEDPLAKGLCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN------------KQNC-EDPLAKGFC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            L F   ++   E +C  P+  G  K   + +P    R++Y+    KC +  Y GCG N NNF + + CQ  C +++             + C E P  +G C    +  P   +   ++KC  F Y GCG N N F
Sbjct: 1582 LCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTRASSEVCFEPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRF 1717          

HSP 6 Score: 48.9062 bits (115), Expect = 2.151e-7
Identity = 30/102 (29.41%), Postives = 50/102 (49.02%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGC-GANGNNFKTLKDCQDLCEETNKQ----NCEDPLAKGFCK-----AYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G  K++  RYFY+  +  C  F   GC  ++ NNF  L+ CQ  CE  + Q    +C D   + + +      +  R++++   +KC  F +GGC +   NF
Sbjct: 1266 GDGKSWSNRYFYDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAGKSCLDKFDERYLEDCRHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNF 1367          

HSP 7 Score: 47.7506 bits (112), Expect = 5.267e-7
Identity = 23/54 (42.59%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  100 CEDPLAKG-LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            C + L +G  C+A   RY++N  + +C+ F Y GCG +GNNF T ++CQ  CE+
Sbjct: 1797 CMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNFLTKEECQTKCEK 1850          

HSP 8 Score: 46.2098 bits (108), Expect = 1.562e-6
Identity = 18/51 (35.29%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C+ P+  G C   + RY+Y+   ++C+RF + GCG N N F     C++ C
Sbjct:   46 CQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRC 96          

HSP 9 Score: 45.4394 bits (106), Expect = 2.837e-6
Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 1
Query:  145 RYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCEETNK---QNCEDPLAKGF---CKAYIPR--YFYNDTSEKCERFIYGGC-GANGNNF 396
            R++++   +KC  F +GGC +   N F  +  CQDLCE   +   Q C  P    +   C A  P+  Y+++ +S  C+ F +G C G N N F
Sbjct: 1342 RFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDLCESPPRELTQACLQPFDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIF 1435          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Celegans
Match: mec-1 (pep chromosome:WBcel235:V:6956537:6966422:1 gene:WBGene00003165.1 transcript:T07H8.4h.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mec-1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.808e-18
Identity = 40/93 (43.01%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKG-FCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C      +FYN T   C++F+YGGCG N N F T + CQ  CE T    C + L +G +C+A   RY++N  + +C+ F Y GCG +GNNF
Sbjct: 1746 GSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRFDTFEICQKACEVTGTDPCMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNF 1838          

HSP 2 Score: 69.3218 bits (168), Expect = 1.392e-14
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-----CEDPLAKGFCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNF 396
            C +P+  G C+   P ++Y+  S  C  F Y GCG N N F T+  C++LC   N  N     C  P+  G+ K   + +P    R++Y+    KC +  Y GCG N NNF
Sbjct: 1533 CLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNF 1643          

HSP 3 Score: 58.151 bits (139), Expect = 1.158e-10
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  103 EDPLAKGLC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET--NKQNCEDPLA------KGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E P  +G+C    +  P   +   ++KC  F Y GCG N N F T    QD+CE T     N  DP         G C      +FYN T   C++F+YGGCG N N F
Sbjct: 1675 EPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRFAT----QDICENTCNGLMNSNDPRICSFSPDWGSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRF 1779          

HSP 4 Score: 50.447 bits (119), Expect = 6.574e-8
Identity = 27/100 (27.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:  136 YIPRYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            +  +++++ +S  C  F +  C ++  N F   K C   C+            E +K  C +P+  G C+   P ++Y+  S  C  F Y GCG N N F
Sbjct: 1474 WTEKWYFDQSSGDCSSFWWDECTSSSQNIFPDEKSCTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRF 1573          

HSP 5 Score: 50.0618 bits (118), Expect = 7.170e-8
Identity = 39/136 (28.68%), Postives = 60/136 (44.12%), Query Frame = 1
Query:   58 LSFIIFTIESLEQNCEDPLAKGLCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN------------KQNC-EDPLAKGFC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            L F   ++   E +C  P+  G  K   + +P    R++Y+    KC +  Y GCG N NNF + + CQ  C +++             + C E P  +G C    +  P   +   ++KC  F Y GCG N N F
Sbjct: 1582 LCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTRASSEVCFEPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRF 1717          

HSP 6 Score: 48.9062 bits (115), Expect = 2.151e-7
Identity = 30/102 (29.41%), Postives = 50/102 (49.02%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGC-GANGNNFKTLKDCQDLCEETNKQ----NCEDPLAKGFCK-----AYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G  K++  RYFY+  +  C  F   GC  ++ NNF  L+ CQ  CE  + Q    +C D   + + +      +  R++++   +KC  F +GGC +   NF
Sbjct: 1266 GDGKSWSNRYFYDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAGKSCLDKFDERYLEDCRHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNF 1367          

HSP 7 Score: 47.7506 bits (112), Expect = 5.267e-7
Identity = 23/54 (42.59%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  100 CEDPLAKG-LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            C + L +G  C+A   RY++N  + +C+ F Y GCG +GNNF T ++CQ  CE+
Sbjct: 1797 CMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNFLTKEECQTKCEK 1850          

HSP 8 Score: 46.2098 bits (108), Expect = 1.562e-6
Identity = 18/51 (35.29%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C+ P+  G C   + RY+Y+   ++C+RF + GCG N N F     C++ C
Sbjct:   46 CQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRC 96          

HSP 9 Score: 45.4394 bits (106), Expect = 2.837e-6
Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 1
Query:  145 RYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCEETNK---QNCEDPLAKGF---CKAYIPR--YFYNDTSEKCERFIYGGC-GANGNNF 396
            R++++   +KC  F +GGC +   N F  +  CQDLCE   +   Q C  P    +   C A  P+  Y+++ +S  C+ F +G C G N N F
Sbjct: 1342 RFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDLCESPPRELTQACLQPFDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIF 1435          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Celegans
Match: mec-1 (pep chromosome:WBcel235:V:6956542:6966422:1 gene:WBGene00003165.1 transcript:T07H8.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mec-1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.882e-18
Identity = 40/93 (43.01%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKG-FCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C      +FYN T   C++F+YGGCG N N F T + CQ  CE T    C + L +G +C+A   RY++N  + +C+ F Y GCG +GNNF
Sbjct: 1747 GSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRFDTFEICQKACEVTGTDPCMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNF 1839          

HSP 2 Score: 69.3218 bits (168), Expect = 1.406e-14
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-----CEDPLAKGFCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNF 396
            C +P+  G C+   P ++Y+  S  C  F Y GCG N N F T+  C++LC   N  N     C  P+  G+ K   + +P    R++Y+    KC +  Y GCG N NNF
Sbjct: 1534 CLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNF 1644          

HSP 3 Score: 58.151 bits (139), Expect = 1.203e-10
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  103 EDPLAKGLC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET--NKQNCEDPLA------KGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E P  +G+C    +  P   +   ++KC  F Y GCG N N F T    QD+CE T     N  DP         G C      +FYN T   C++F+YGGCG N N F
Sbjct: 1676 EPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRFAT----QDICENTCNGLMNSNDPRICSFSPDWGSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRF 1780          

HSP 4 Score: 50.447 bits (119), Expect = 6.574e-8
Identity = 27/100 (27.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:  136 YIPRYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            +  +++++ +S  C  F +  C ++  N F   K C   C+            E +K  C +P+  G C+   P ++Y+  S  C  F Y GCG N N F
Sbjct: 1475 WTEKWYFDQSSGDCSSFWWDECTSSSQNIFPDEKSCTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRF 1574          

HSP 5 Score: 50.0618 bits (118), Expect = 7.309e-8
Identity = 39/136 (28.68%), Postives = 60/136 (44.12%), Query Frame = 1
Query:   58 LSFIIFTIESLEQNCEDPLAKGLCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN------------KQNC-EDPLAKGFC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            L F   ++   E +C  P+  G  K   + +P    R++Y+    KC +  Y GCG N NNF + + CQ  C +++             + C E P  +G C    +  P   +   ++KC  F Y GCG N N F
Sbjct: 1583 LCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTRASSEVCFEPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRF 1718          

HSP 6 Score: 48.9062 bits (115), Expect = 2.151e-7
Identity = 30/102 (29.41%), Postives = 50/102 (49.02%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGC-GANGNNFKTLKDCQDLCEETNKQ----NCEDPLAKGFCK-----AYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G  K++  RYFY+  +  C  F   GC  ++ NNF  L+ CQ  CE  + Q    +C D   + + +      +  R++++   +KC  F +GGC +   NF
Sbjct: 1267 GDGKSWSNRYFYDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAGKSCLDKFDERYLEDCRHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNF 1368          

HSP 7 Score: 47.7506 bits (112), Expect = 5.421e-7
Identity = 23/54 (42.59%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  100 CEDPLAKG-LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            C + L +G  C+A   RY++N  + +C+ F Y GCG +GNNF T ++CQ  CE+
Sbjct: 1798 CMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNFLTKEECQTKCEK 1851          

HSP 8 Score: 46.2098 bits (108), Expect = 1.563e-6
Identity = 18/51 (35.29%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C+ P+  G C   + RY+Y+   ++C+RF + GCG N N F     C++ C
Sbjct:   46 CQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRC 96          

HSP 9 Score: 45.4394 bits (106), Expect = 2.864e-6
Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 1
Query:  145 RYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCEETNK---QNCEDPLAKGF---CKAYIPR--YFYNDTSEKCERFIYGGC-GANGNNF 396
            R++++   +KC  F +GGC +   N F  +  CQDLCE   +   Q C  P    +   C A  P+  Y+++ +S  C+ F +G C G N N F
Sbjct: 1343 RFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDLCESPPRELTQACLQPFDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIF 1436          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Celegans
Match: mec-1 (pep chromosome:WBcel235:V:6956537:6966422:1 gene:WBGene00003165.1 transcript:T07H8.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mec-1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.882e-18
Identity = 40/93 (43.01%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKG-FCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C      +FYN T   C++F+YGGCG N N F T + CQ  CE T    C + L +G +C+A   RY++N  + +C+ F Y GCG +GNNF
Sbjct: 1747 GSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRFDTFEICQKACEVTGTDPCMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNF 1839          

HSP 2 Score: 69.3218 bits (168), Expect = 1.406e-14
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-----CEDPLAKGFCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNF 396
            C +P+  G C+   P ++Y+  S  C  F Y GCG N N F T+  C++LC   N  N     C  P+  G+ K   + +P    R++Y+    KC +  Y GCG N NNF
Sbjct: 1534 CLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNF 1644          

HSP 3 Score: 58.151 bits (139), Expect = 1.203e-10
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  103 EDPLAKGLC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET--NKQNCEDPLA------KGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E P  +G+C    +  P   +   ++KC  F Y GCG N N F T    QD+CE T     N  DP         G C      +FYN T   C++F+YGGCG N N F
Sbjct: 1676 EPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRFAT----QDICENTCNGLMNSNDPRICSFSPDWGSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRF 1780          

HSP 4 Score: 50.447 bits (119), Expect = 6.574e-8
Identity = 27/100 (27.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:  136 YIPRYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            +  +++++ +S  C  F +  C ++  N F   K C   C+            E +K  C +P+  G C+   P ++Y+  S  C  F Y GCG N N F
Sbjct: 1475 WTEKWYFDQSSGDCSSFWWDECTSSSQNIFPDEKSCTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRF 1574          

HSP 5 Score: 50.0618 bits (118), Expect = 7.309e-8
Identity = 39/136 (28.68%), Postives = 60/136 (44.12%), Query Frame = 1
Query:   58 LSFIIFTIESLEQNCEDPLAKGLCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN------------KQNC-EDPLAKGFC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            L F   ++   E +C  P+  G  K   + +P    R++Y+    KC +  Y GCG N NNF + + CQ  C +++             + C E P  +G C    +  P   +   ++KC  F Y GCG N N F
Sbjct: 1583 LCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTRASSEVCFEPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRF 1718          

HSP 6 Score: 48.9062 bits (115), Expect = 2.151e-7
Identity = 30/102 (29.41%), Postives = 50/102 (49.02%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGC-GANGNNFKTLKDCQDLCEETNKQ----NCEDPLAKGFCK-----AYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G  K++  RYFY+  +  C  F   GC  ++ NNF  L+ CQ  CE  + Q    +C D   + + +      +  R++++   +KC  F +GGC +   NF
Sbjct: 1267 GDGKSWSNRYFYDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAGKSCLDKFDERYLEDCRHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNF 1368          

HSP 7 Score: 47.7506 bits (112), Expect = 5.421e-7
Identity = 23/54 (42.59%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  100 CEDPLAKG-LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            C + L +G  C+A   RY++N  + +C+ F Y GCG +GNNF T ++CQ  CE+
Sbjct: 1798 CMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNFLTKEECQTKCEK 1851          

HSP 8 Score: 46.2098 bits (108), Expect = 1.563e-6
Identity = 18/51 (35.29%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C+ P+  G C   + RY+Y+   ++C+RF + GCG N N F     C++ C
Sbjct:   46 CQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRC 96          

HSP 9 Score: 45.4394 bits (106), Expect = 2.864e-6
Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 1
Query:  145 RYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCEETNK---QNCEDPLAKGF---CKAYIPR--YFYNDTSEKCERFIYGGC-GANGNNF 396
            R++++   +KC  F +GGC +   N F  +  CQDLCE   +   Q C  P    +   C A  P+  Y+++ +S  C+ F +G C G N N F
Sbjct: 1343 RFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDLCESPPRELTQACLQPFDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIF 1436          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Celegans
Match: mec-1 (pep chromosome:WBcel235:V:6956542:6966422:1 gene:WBGene00003165.1 transcript:T07H8.4d.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mec-1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.957e-18
Identity = 40/93 (43.01%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKG-FCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C      +FYN T   C++F+YGGCG N N F T + CQ  CE T    C + L +G +C+A   RY++N  + +C+ F Y GCG +GNNF
Sbjct: 1735 GSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRFDTFEICQKACEVTGTDPCMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNF 1827          

HSP 2 Score: 69.3218 bits (168), Expect = 1.433e-14
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-----CEDPLAKGFCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNF 396
            C +P+  G C+   P ++Y+  S  C  F Y GCG N N F T+  C++LC   N  N     C  P+  G+ K   + +P    R++Y+    KC +  Y GCG N NNF
Sbjct: 1522 CLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRFMTVSQCENLCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNF 1632          

HSP 3 Score: 58.151 bits (139), Expect = 1.215e-10
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  103 EDPLAKGLC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET--NKQNCEDPLA------KGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E P  +G+C    +  P   +   ++KC  F Y GCG N N F T    QD+CE T     N  DP         G C      +FYN T   C++F+YGGCG N N F
Sbjct: 1664 EPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRFAT----QDICENTCNGLMNSNDPRICSFSPDWGSCNQLRYVWFYNLTRGTCDQFLYGGCGGNPNRF 1768          

HSP 4 Score: 50.0618 bits (118), Expect = 6.636e-8
Identity = 27/100 (27.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query:  136 YIPRYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            +  +++++ +S  C  F +  C ++  N F   K C   C+            E +K  C +P+  G C+   P ++Y+  S  C  F Y GCG N N F
Sbjct: 1463 WTEKWYFDQSSGDCSSFWWDECTSSSQNIFPDEKSCTSNCKHPGFEISSKLATEESKFRCLEPVEIGSCQETYPAFYYDRASRTCRPFAYSGCGGNSNRF 1562          

HSP 5 Score: 50.0618 bits (118), Expect = 6.964e-8
Identity = 39/136 (28.68%), Postives = 60/136 (44.12%), Query Frame = 1
Query:   58 LSFIIFTIESLEQNCEDPLAKGLCK---AYIP----RYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN------------KQNC-EDPLAKGFC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            L F   ++   E +C  P+  G  K   + +P    R++Y+    KC +  Y GCG N NNF + + CQ  C +++             + C E P  +G C    +  P   +   ++KC  F Y GCG N N F
Sbjct: 1571 LCFAFNSMNEAEVDCHLPMHIGYGKNEDSCLPQAGFRFYYDRNYGKCSQMWYLGCGGNANNFYSYEICQRTCSQSDVPRELERKTRASSEVCFEPPGDRGICGKNSSTNPLKRWTYGNQKCTSFTYSGCGGNRNRF 1706          

HSP 6 Score: 48.521 bits (114), Expect = 2.278e-7
Identity = 30/102 (29.41%), Postives = 50/102 (49.02%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGC-GANGNNFKTLKDCQDLCEETNKQ----NCEDPLAKGFCK-----AYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G  K++  RYFY+  +  C  F   GC  ++ NNF  L+ CQ  CE  + Q    +C D   + + +      +  R++++   +KC  F +GGC +   NF
Sbjct: 1255 GDGKSWSNRYFYDKDTRSCRMFWSNGCFSSSKNNFDDLETCQWKCEGRHPQPAGKSCLDKFDERYLEDCRHGEFTNRFYFDHDRKKCVAFHWGGCQSKSQNF 1356          

HSP 7 Score: 47.7506 bits (112), Expect = 5.579e-7
Identity = 23/54 (42.59%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  100 CEDPLAKG-LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            C + L +G  C+A   RY++N  + +C+ F Y GCG +GNNF T ++CQ  CE+
Sbjct: 1786 CMESLDRGSWCEAMSNRYYFNKRARQCKGFHYTGCGKSGNNFLTKEECQTKCEK 1839          

HSP 8 Score: 46.2098 bits (108), Expect = 1.593e-6
Identity = 18/51 (35.29%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C+ P+  G C   + RY+Y+   ++C+RF + GCG N N F     C++ C
Sbjct:   46 CQLPVDTGKCSQQLVRYYYDAAVDECKRFTFSGCGGNSNRFMRRAHCRNRC 96          

HSP 9 Score: 45.4394 bits (106), Expect = 3.033e-6
Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 1
Query:  145 RYFYNDTSEKCERFIYGGCGANGNN-FKTLKDCQDLCEETNK---QNCEDPLAKGF---CKAYIPR--YFYNDTSEKCERFIYGGC-GANGNNF 396
            R++++   +KC  F +GGC +   N F  +  CQDLCE   +   Q C  P    +   C A  P+  Y+++ +S  C+ F +G C G N N F
Sbjct: 1331 RFYFDHDRKKCVAFHWGGCQSKSQNFFADMTVCQDLCESPPRELTQACLQPFDTTYETSCSAEKPQQYYYFDMSSGICKMFWFGNCKGENQNIF 1424          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301837)

HSP 1 Score: 80.4925 bits (197), Expect = 2.579e-18
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 1
Query:   88 LEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC-EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            L+  C  P   G C   + ++ ++++ ++C  F Y GCG N NNF TL+ C+D C  +  K  CE P   G C  Y+  ++Y+   + C +F YGGCG N N F
Sbjct: 1786 LKDRCALPKQTGDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPRQVAKDICEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRF 1889          

HSP 2 Score: 77.0258 bits (188), Expect = 3.633e-17
Identity = 40/110 (36.36%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE-------TNKQNCEDPLAKGFC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C +P+  G C  +  +Y++N  S+ CE F YGGC   GN F  L +CQ +C         + K+ C  P+A G C     +  R++Y+D +  C  FIY GC  N NNF+
Sbjct: 2253 CNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFSDLFECQTVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRWYYDDEAGNCVSFIYAGCSGNQNNFR 2362          

HSP 3 Score: 76.6406 bits (187), Expect = 5.840e-17
Identity = 37/101 (36.63%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C +P   G C      +FY+  +  C  F Y GCG NGN F+T   C+  C E    + C +P+  G C  +  +Y++N  S+ CE F YGGC   GN F 
Sbjct: 2194 CAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQCGEFKGVDVCNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFS 2294          

HSP 4 Score: 73.559 bits (179), Expect = 5.971e-16
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  109 PLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET-NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            P + G C  +  +++++    +CE F YGGC    N F +L+ CQ  C  + N   CE P+  G C     R++Y++ ++ C  F YGGC  N NN+
Sbjct: 1674 PKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNY 1770          

HSP 5 Score: 71.2478 bits (173), Expect = 4.698e-15
Identity = 37/111 (33.33%), Postives = 50/111 (45.05%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C  P   G C  +   + YN+T  +C+ F YGGCG N N F T ++C   C             E +   C      G C   + R+FYN     C+ F+Y GCG N NN+
Sbjct: 2001 CSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARCSVNIDIRIGADPVEHDTSKCFLAFEPGNCYNNVTRWFYNSAEGLCDEFVYTGCGGNANNY 2111          

HSP 6 Score: 70.8626 bits (172), Expect = 5.985e-15
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE-TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E  ++ C  P   G C  Y  +Y+++ +   C RF YGGC  N N F++  +C+D C++ T K  C  P + G C  +  +++++    +CE F YGGC    N F
Sbjct: 1606 EPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQDYTGKHVCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRF 1711          

HSP 7 Score: 70.4774 bits (171), Expect = 6.530e-15
Identity = 34/101 (33.66%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN--KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            CE P+  G C     R++Y++ ++ C  F YGGC  N NN+ T   C   C +    K  C  P   G C   + ++ ++++ ++C  F Y GCG N NNF
Sbjct: 1730 CEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKDRCALPKQTGDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNF 1830          

HSP 8 Score: 70.0922 bits (170), Expect = 1.091e-14
Identity = 33/92 (35.87%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C   + R+FYN     C+ F+Y GCG N NN+ T ++CQ+ C +  +  C  P  +G C     R+++++ S +C  F + GC  N NNF
Sbjct: 2078 GNCYNNVTRWFYNSAEGLCDEFVYTGCGGNANNYATEEECQNECNDA-QTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNF 2168          

HSP 9 Score: 69.3218 bits (168), Expect = 2.047e-14
Identity = 37/125 (29.60%), Postives = 53/125 (42.40%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC---------------------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            S +  C++  A G C  ++ ++ ++     C +F YG CG NGN F+T  DCQ  C                            C  P   G C  +   + YN+T  +C+ F YGGCG N N F
Sbjct: 1917 SRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRCLSQEPPAPTPPRAPAPTRQPDPAPTVAQCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRF 2041          

HSP 10 Score: 68.1662 bits (165), Expect = 4.892e-14
Identity = 38/132 (28.79%), Postives = 61/132 (46.21%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAK---------GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE---------------TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            T+ES E +C   +AK         G C  Y+  ++Y+   + C +F YGGCG N N F T + C   C+                + +  C++  A G C  ++ ++ ++     C +F YG CG NGN F+
Sbjct: 1832 TLESCEDHCPRQVAKDICEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDRKPEPTTTTPATRPQPSRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFE 1963          

HSP 11 Score: 62.003 bits (149), Expect = 7.209e-12
Identity = 33/112 (29.46%), Postives = 49/112 (43.75%), Query Frame = 1
Query:   88 LEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC--------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
             +  C  P  +G C     R+++++ S +C  F + GC  N NNF +  DC + C               C +P   G C      +FY+  +  C  F Y GCG NGN F+
Sbjct: 2124 AQTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNFVSQSDCLNFCIGEPVVEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFE 2235          

HSP 12 Score: 49.2914 bits (116), Expect = 2.108e-7
Identity = 29/88 (32.95%), Postives = 46/88 (52.27%), Query Frame = 1
Query:   28 TKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE-ETNKQNCE 279
            + L  C  + L+     + S ++ C  P+A G C     +  R++Y+D +  C  FIY GC  N NNF++ + C + C  E NKQ+ E
Sbjct: 2294 SDLFECQTVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRWYYDDEAGNCVSFIYAGCSGNQNNFRSFEACTNQCRPEPNKQDNE 2381          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301838)

HSP 1 Score: 80.4925 bits (197), Expect = 2.627e-18
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 1
Query:   88 LEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC-EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            L+  C  P   G C   + ++ ++++ ++C  F Y GCG N NNF TL+ C+D C  +  K  CE P   G C  Y+  ++Y+   + C +F YGGCG N N F
Sbjct: 1786 LKDRCALPKQTGDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPRQVAKDICEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRF 1889          

HSP 2 Score: 73.559 bits (179), Expect = 6.022e-16
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  109 PLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET-NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            P + G C  +  +++++    +CE F YGGC    N F +L+ CQ  C  + N   CE P+  G C     R++Y++ ++ C  F YGGC  N NN+
Sbjct: 1674 PKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNY 1770          

HSP 3 Score: 70.8626 bits (172), Expect = 4.784e-15
Identity = 37/111 (33.33%), Postives = 50/111 (45.05%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C  P   G C  +   + YN+T  +C+ F YGGCG N N F T ++C   C             E +   C      G C   + R+FYN     C+ F+Y GCG N NN+
Sbjct: 2001 CSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARCSVNIDIRIGADPVEHDTSKCFLAFEPGNCYNNVTRWFYNSAEGLCDEFVYTGCGGNANNY 2111          

HSP 4 Score: 70.8626 bits (172), Expect = 6.335e-15
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE-TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E  ++ C  P   G C  Y  +Y+++ +   C RF YGGC  N N F++  +C+D C++ T K  C  P + G C  +  +++++    +CE F YGGC    N F
Sbjct: 1606 EPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQDYTGKHVCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRF 1711          

HSP 5 Score: 70.4774 bits (171), Expect = 6.714e-15
Identity = 34/101 (33.66%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN--KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            CE P+  G C     R++Y++ ++ C  F YGGC  N NN+ T   C   C +    K  C  P   G C   + ++ ++++ ++C  F Y GCG N NNF
Sbjct: 1730 CEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKDRCALPKQTGDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNF 1830          

HSP 6 Score: 70.0922 bits (170), Expect = 1.018e-14
Identity = 33/92 (35.87%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C   + R+FYN     C+ F+Y GCG N NN+ T ++CQ+ C +  +  C  P  +G C     R+++++ S +C  F + GC  N NNF
Sbjct: 2078 GNCYNNVTRWFYNSAEGLCDEFVYTGCGGNANNYATEEECQNECNDA-QTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNF 2168          

HSP 7 Score: 69.3218 bits (168), Expect = 2.084e-14
Identity = 37/125 (29.60%), Postives = 53/125 (42.40%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC---------------------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            S +  C++  A G C  ++ ++ ++     C +F YG CG NGN F+T  DCQ  C                            C  P   G C  +   + YN+T  +C+ F YGGCG N N F
Sbjct: 1917 SRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRCLSQEPPAPTPPRAPAPTRQPDPAPTVAQCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRF 2041          

HSP 8 Score: 68.1662 bits (165), Expect = 5.079e-14
Identity = 38/132 (28.79%), Postives = 61/132 (46.21%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAK---------GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE---------------TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            T+ES E +C   +AK         G C  Y+  ++Y+   + C +F YGGCG N N F T + C   C+                + +  C++  A G C  ++ ++ ++     C +F YG CG NGN F+
Sbjct: 1832 TLESCEDHCPRQVAKDICEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDRKPEPTTTTPATRPQPSRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFE 1963          

HSP 9 Score: 62.003 bits (149), Expect = 7.063e-12
Identity = 33/112 (29.46%), Postives = 49/112 (43.75%), Query Frame = 1
Query:   88 LEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC--------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
             +  C  P  +G C     R+++++ S +C  F + GC  N NNF +  DC + C               C +P   G C      +FY+  +  C  F Y GCG NGN F+
Sbjct: 2124 AQTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNFVSQSDCLNFCIGEPVVEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFE 2235          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301839)

HSP 1 Score: 77.0258 bits (188), Expect = 3.666e-17
Identity = 40/110 (36.36%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE-------TNKQNCEDPLAKGFC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C +P+  G C  +  +Y++N  S+ CE F YGGC   GN F  L +CQ +C         + K+ C  P+A G C     +  R++Y+D +  C  FIY GC  N NNF+
Sbjct: 2196 CNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFSDLFECQTVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRWYYDDEAGNCVSFIYAGCSGNQNNFR 2305          

HSP 2 Score: 76.6406 bits (187), Expect = 6.068e-17
Identity = 37/101 (36.63%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C +P   G C      +FY+  +  C  F Y GCG NGN F+T   C+  C E    + C +P+  G C  +  +Y++N  S+ CE F YGGC   GN F 
Sbjct: 2137 CAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQCGEFKGVDVCNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFS 2237          

HSP 3 Score: 75.0998 bits (183), Expect = 1.646e-16
Identity = 37/103 (35.92%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN----KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            CE P+  G C     R++Y++ ++ C  F YGGC  N NN+ T   C   C +      K  CE P   G C  Y+  ++Y+   + C +F YGGCG N N F
Sbjct: 1730 CEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKAKDICEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRF 1832          

HSP 4 Score: 73.559 bits (179), Expect = 6.387e-16
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  109 PLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET-NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            P + G C  +  +++++    +CE F YGGC    N F +L+ CQ  C  + N   CE P+  G C     R++Y++ ++ C  F YGGC  N NN+
Sbjct: 1674 PKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNY 1770          

HSP 5 Score: 70.8626 bits (172), Expect = 5.173e-15
Identity = 37/111 (33.33%), Postives = 50/111 (45.05%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C  P   G C  +   + YN+T  +C+ F YGGCG N N F T ++C   C             E +   C      G C   + R+FYN     C+ F+Y GCG N NN+
Sbjct: 1944 CSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARCSVNIDIRIGADPVEHDTSKCFLAFEPGNCYNNVTRWFYNSAEGLCDEFVYTGCGGNANNY 2054          

HSP 6 Score: 70.8626 bits (172), Expect = 6.218e-15
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE-TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E  ++ C  P   G C  Y  +Y+++ +   C RF YGGC  N N F++  +C+D C++ T K  C  P + G C  +  +++++    +CE F YGGC    N F
Sbjct: 1606 EPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQDYTGKHVCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRF 1711          

HSP 7 Score: 70.0922 bits (170), Expect = 1.190e-14
Identity = 33/92 (35.87%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C   + R+FYN     C+ F+Y GCG N NN+ T ++CQ+ C +  +  C  P  +G C     R+++++ S +C  F + GC  N NNF
Sbjct: 2021 GNCYNNVTRWFYNSAEGLCDEFVYTGCGGNANNYATEEECQNECNDA-QTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNF 2111          

HSP 8 Score: 69.3218 bits (168), Expect = 2.189e-14
Identity = 37/125 (29.60%), Postives = 53/125 (42.40%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC---------------------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            S +  C++  A G C  ++ ++ ++     C +F YG CG NGN F+T  DCQ  C                            C  P   G C  +   + YN+T  +C+ F YGGCG N N F
Sbjct: 1860 SRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRCLSQEPPAPTPPRAPAPTRQPDPAPTVAQCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRF 1984          

HSP 9 Score: 68.1662 bits (165), Expect = 5.599e-14
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE---------------TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            CE P   G C  Y+  ++Y+   + C +F YGGCG N N F T + C   C+                + +  C++  A G C  ++ ++ ++     C +F YG CG NGN F+
Sbjct: 1792 CEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDRKPEPTTTTPATRPQPSRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFE 1906          

HSP 10 Score: 62.003 bits (149), Expect = 7.710e-12
Identity = 33/112 (29.46%), Postives = 49/112 (43.75%), Query Frame = 1
Query:   88 LEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC--------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
             +  C  P  +G C     R+++++ S +C  F + GC  N NNF +  DC + C               C +P   G C      +FY+  +  C  F Y GCG NGN F+
Sbjct: 2067 AQTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNFVSQSDCLNFCIGEPVVEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFE 2178          

HSP 11 Score: 49.2914 bits (116), Expect = 2.107e-7
Identity = 29/88 (32.95%), Postives = 46/88 (52.27%), Query Frame = 1
Query:   28 TKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLC---KAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE-ETNKQNCE 279
            + L  C  + L+     + S ++ C  P+A G C     +  R++Y+D +  C  FIY GC  N NNF++ + C + C  E NKQ+ E
Sbjct: 2237 SDLFECQTVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRWYYDDEAGNCVSFIYAGCSGNQNNFRSFEACTNQCRPEPNKQDNE 2324          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0300337)

HSP 1 Score: 73.559 bits (179), Expect = 5.976e-16
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  109 PLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET-NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            P + G C  +  +++++    +CE F YGGC    N F +L+ CQ  C  + N   CE P+  G C     R++Y++ ++ C  F YGGC  N NN+
Sbjct: 1674 PKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNY 1770          

HSP 2 Score: 70.4774 bits (171), Expect = 6.793e-15
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE-TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E  ++ C  P   G C  Y  +Y+++ +   C RF YGGC  N N F++  +C+D C++ T K  C  P + G C  +  +++++    +CE F YGGC    N F
Sbjct: 1606 EPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQDYTGKHVCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRF 1711          

HSP 3 Score: 44.2838 bits (103), Expect = 9.259e-6
Identity = 24/67 (35.82%), Postives = 33/67 (49.25%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE-------ETNKQNCE 279
            CE P+  G C     R++Y++ ++ C  F YGGC  N NN+ T   C   C        E NKQ+ E
Sbjct: 1730 CEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKAEPNKQDNE 1796          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Fly
Match: CG34276 (gene:FBgn0085305 transcript:FBtr0112471)

HSP 1 Score: 66.2402 bits (160), Expect = 4.611e-15
Identity = 31/72 (43.06%), Postives = 45/72 (62.50%), Query Frame = 1
Query:   37 IICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            I CL ++L F +    S+++ C  PL  G  KAY+  +FYN TS++C+RFI+ G  +NGNNF T   C  +C
Sbjct:    5 ISCLLILLVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76          

HSP 2 Score: 52.7582 bits (125), Expect = 7.125e-10
Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 1
Query:  265 KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            K+ C  PL  G  KAY+  +FYN TS++C+RFI+ G  +NGNNF
Sbjct:   23 KRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNF 66          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Zebrafish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 94.7449 bits (234), Expect = 1.302e-24
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 1
Query:   73 FTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE--ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            F I  + Q C     +G C+    RYF+N TS +CE F YGGC  N NNF+  ++C + C+  +T    C D L KG C A IPRY+YN  ++ CE F+Y GCG + NNF
Sbjct:   81 FRIPKIPQICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFRNPEECIEYCKPPKTIPVICLDNLDKGRCSASIPRYYYNSATKTCEEFMYTGCGGSNNNF 190          

HSP 2 Score: 88.1965 bits (217), Expect = 4.718e-22
Identity = 48/124 (38.71%), Postives = 70/124 (56.45%), Query Frame = 1
Query:   34 LIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK--QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            L++ + ++ S +  T++  E  C   + +G C   I R++YN  S++CE F Y GCG N NNF++  +CQ  C    K  Q C     +G C+    RYF+N TS +CE F YGGC  N NNF+
Sbjct:    9 LLLFISVLESAVGLTLQPKEV-CLLQIEEGTCNDDIQRFYYNTISQQCEEFSYSGCGGNQNNFRSFVECQKTCFRIPKIPQICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFR 131          

HSP 3 Score: 60.077 bits (144), Expect = 1.717e-11
Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C D L KG C A IPRY+YN  ++ CE F+Y GCG + NNF + + C D+C
Sbjct:  150 CLDNLDKGRCSASIPRYYYNSATKTCEEFMYTGCGGSNNNFISKQSCVDVC 200          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Zebrafish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 94.7449 bits (234), Expect = 1.302e-24
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 1
Query:   73 FTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE--ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            F I  + Q C     +G C+    RYF+N TS +CE F YGGC  N NNF+  ++C + C+  +T    C D L KG C A IPRY+YN  ++ CE F+Y GCG + NNF
Sbjct:   81 FRIPKIPQICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFRNPEECIEYCKPPKTIPVICLDNLDKGRCSASIPRYYYNSATKTCEEFMYTGCGGSNNNF 190          

HSP 2 Score: 88.1965 bits (217), Expect = 4.718e-22
Identity = 48/124 (38.71%), Postives = 70/124 (56.45%), Query Frame = 1
Query:   34 LIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK--QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            L++ + ++ S +  T++  E  C   + +G C   I R++YN  S++CE F Y GCG N NNF++  +CQ  C    K  Q C     +G C+    RYF+N TS +CE F YGGC  N NNF+
Sbjct:    9 LLLFISVLESAVGLTLQPKEV-CLLQIEEGTCNDDIQRFYYNTISQQCEEFSYSGCGGNQNNFRSFVECQKTCFRIPKIPQICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFR 131          

HSP 3 Score: 60.077 bits (144), Expect = 1.717e-11
Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C D L KG C A IPRY+YN  ++ CE F+Y GCG + NNF + + C D+C
Sbjct:  150 CLDNLDKGRCSASIPRYYYNSATKTCEEFMYTGCGGSNNNFISKQSCVDVC 200          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Zebrafish
Match: tfpia (tissue factor pathway inhibitor a [Source:ZFIN;Acc:ZDB-GENE-030711-1])

HSP 1 Score: 93.2041 bits (230), Expect = 1.194e-23
Identity = 45/105 (42.86%), Postives = 66/105 (62.86%), Query Frame = 1
Query:   88 LEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET-NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
              Q+C     +G CKA   R++++  + +CE F YGGC  N NNF+TL+DC+++C  T NK  C      G C+  +PRYF++  S++C++F YGGC  N NNFK
Sbjct:   38 FHQSCALKKDEGPCKAMKDRFYFDIDTGRCEPFEYGGCQGNANNFETLQDCEEMCLVTENKSPCHLEDEPGPCRGLVPRYFFDQKSQECKQFFYGGCFGNANNFK 142          

HSP 2 Score: 68.5514 bits (166), Expect = 2.252e-14
Identity = 43/138 (31.16%), Postives = 57/138 (41.30%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC---------EETNKQNCEDP-------------------------------------LAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C+  +PRYF++  S++C++F YGGC  N NNFKT+K CQ  C         EE  K   E P                                     + +G C     RY +N    +C+ F Y GCG N NNF
Sbjct:  108 GPCRGLVPRYFFDQKSQECKQFFYGGCFGNANNFKTIKACQQRCQLTAVLKSEEEEAKPVIESPAIHDDAHLNSSHSALRRVSQPAKQEAEFSPPELCMSAVDRGDCDGSERRYVFNPRIGRCQVFRYSGCGGNKNNF 245          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Zebrafish
Match: tfpia (tissue factor pathway inhibitor a [Source:ZFIN;Acc:ZDB-GENE-030711-1])

HSP 1 Score: 93.2041 bits (230), Expect = 1.291e-23
Identity = 45/108 (41.67%), Postives = 67/108 (62.04%), Query Frame = 1
Query:   79 IESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET-NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +    Q+C     +G CKA   R++++  + +CE F YGGC  N NNF+TL+DC+++C  T NK  C      G C+  +PRYF++  S++C++F YGGC  N NNFK
Sbjct:   34 LRIFHQSCALKKDEGPCKAMKDRFYFDIDTGRCEPFEYGGCQGNANNFETLQDCEEMCLVTENKSPCHLEDEPGPCRGLVPRYFFDQKSQECKQFFYGGCFGNANNFK 141          

HSP 2 Score: 68.5514 bits (166), Expect = 2.446e-14
Identity = 43/138 (31.16%), Postives = 57/138 (41.30%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC---------EETNKQNCEDP-------------------------------------LAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C+  +PRYF++  S++C++F YGGC  N NNFKT+K CQ  C         EE  K   E P                                     + +G C     RY +N    +C+ F Y GCG N NNF
Sbjct:  107 GPCRGLVPRYFFDQKSQECKQFFYGGCFGNANNFKTIKACQQRCQLTAVLKSEEEEAKPVIESPAIHDDAHLNSSHSALRRVSQPAKQEAEFSPPELCMSAVDRGDCDGSERRYVFNPRIGRCQVFRYSGCGGNKNNF 244          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Zebrafish
Match: spint2 (serine peptidase inhibitor, Kunitz type, 2 [Source:ZFIN;Acc:ZDB-GENE-061013-323])

HSP 1 Score: 82.0333 bits (201), Expect = 6.735e-19
Identity = 46/138 (33.33%), Postives = 66/138 (47.83%), Query Frame = 1
Query:   97 NCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC-------------------------------------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +C  P A G C+A  PR+FY+ T + C+ FIYGGCG N NNF +  +C+  C                                      E  ++ C+ P   G C+A I R++YN+    C++FIYGGCG N NN++
Sbjct:  132 HCRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASCLGVKGAVEDARSVSPRSRMSGPEIKNDVDPKALTEMTSEEFQEKCQSPAVTGNCRASIKRFYYNNGV--CQQFIYGGCGGNKNNYE 267          

HSP 2 Score: 75.0998 bits (183), Expect = 1.754e-16
Identity = 40/128 (31.25%), Postives = 62/128 (48.44%), Query Frame = 1
Query:   73 FTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC--------------------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
             T E  ++ C+ P   G C+A I R++YN+    C++FIYGGCG N NN+++   C   C                      + ++ C  P   G C+A    +F+  +S+ C+ FIYGGC  N N +
Sbjct:  219 MTSEEFQEKCQSPAVTGNCRASIKRFYYNNGV--CQQFIYGGCGGNKNNYESEDSCMTACTVKIIPKEQEGPVIPAIPKSAHSFEEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRY 344          

HSP 3 Score: 49.2914 bits (116), Expect = 1.843e-7
Identity = 22/66 (33.33%), Postives = 36/66 (54.55%), Query Frame = 1
Query:   55 VLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            V+  I  +  S E+ C  P   G C+A    +F+  +S+ C+ FIYGGC  N N + + ++C  +C
Sbjct:  289 VIPAIPKSAHSFEEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMSVC 354          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Xenopus
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:548483])

HSP 1 Score: 89.3521 bits (220), Expect = 2.136e-22
Identity = 44/125 (35.20%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   31 KLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK--QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            + ++   L++      ++     C  P  +G CKA IP Y+Y+  ++ C+ F+YGGC  N N F +++DC+  C +  K  + C     +G C+ ++ RY YN  + KCE+F YGGC  N NNFK
Sbjct:    6 QALMAASLLIQVFGSPMQGNTTVCLLPPDEGPCKALIPHYYYDRYTQTCQEFLYGGCDGNSNKFLSMEDCEKFCWKIKKVPKACRMDPDEGPCRGFLKRYAYNMQTMKCEQFYYGGCYGNDNNFK 130          

HSP 2 Score: 87.8113 bits (216), Expect = 6.606e-22
Identity = 44/110 (40.00%), Postives = 60/110 (54.55%), Query Frame = 1
Query:   73 FTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN--CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            + I+ + + C     +G C+ ++ RY YN  + KCE+F YGGC  N NNFK    C D C         C  P  +G C A + RY++N  S+ CE F+Y GCG N NNF
Sbjct:   80 WKIKKVPKACRMDPDEGPCRGFLKRYAYNMQTMKCEQFYYGGCYGNDNNFKDKASCMDFCSPRRDAPSFCYSPKDEGSCSASVTRYYFNIESKACEEFVYTGCGGNSNNF 189          

HSP 3 Score: 57.7658 bits (138), Expect = 1.738e-10
Identity = 24/57 (42.11%), Postives = 37/57 (64.91%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQ 270
            C  P  +G C A + RY++N  S+ CE F+Y GCG N NNF  ++DC  +C++ +K+
Sbjct:  149 CYSPKDEGSCSASVTRYYFNIESKACEEFVYTGCGGNSNNFVKMEDCDSVCKKGSKR 205          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Xenopus
Match: WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:NCBI gene;Acc:100486381])

HSP 1 Score: 77.7962 bits (190), Expect = 3.067e-17
Identity = 39/100 (39.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P     C     R++++     C  FIYG C +N N+F T + C   C       C  P  +G CKAY PR+ YN   ++C+ FIYGGCG N NNF+
Sbjct:  312 CLKPPDSDDCGEEQTRWYFDAKKNNCFIFIYGNCNSNYNHFDTYESCMLTCMNGPVNVCNFPALQGMCKAYKPRWAYNKQLKQCQSFIYGGCGGNDNNFE 411          

HSP 2 Score: 69.707 bits (169), Expect = 2.144e-14
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCE-----DPLAKGFCKA 309
            C  P  +G+CKAY PR+ YN   ++C+ FIYGGCG N NNF+T + C+D+C     Q C+       L   FCK+
Sbjct:  370 CNFPALQGMCKAYKPRWAYNKQLKQCQSFIYGGCGGNDNNFETKETCEDMCPFPKNQKCKICKPRQKLVTSFCKS 444          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Xenopus
Match: ENSXETT00000014273.1 (collagen type VI alpha 5 chain [Source:NCBI gene;Acc:100486063])

HSP 1 Score: 76.2554 bits (186), Expect = 1.366e-16
Identity = 38/118 (32.20%), Postives = 55/118 (46.61%), Query Frame = 1
Query:   79 IESLEQNCEDPLAKGL-CKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-----------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            I  +  NC   +  G  C+ Y   ++Y  + + C +F YGGC  NGN F +  +C   C   +K+            C     +G C  YI ++ YN   + C +F YGGCG NGN F
Sbjct: 2642 INKVADNCLLDVNHGTACRGYQRMWYYIKSIDACSQFWYGGCDGNGNRFSSETECLQTCSSKSKKANGEVRSLKKDVCTMKQEEGKCADYILKWSYNQGKKACVQFWYGGCGGNGNRF 2759          

HSP 2 Score: 53.1434 bits (126), Expect = 1.702e-8
Identity = 23/59 (38.98%), Postives = 34/59 (57.63%), Query Frame = 1
Query:   79 IESLEQN-CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            + SL+++ C     +G C  YI ++ YN   + C +F YGGCG NGN F T + C+  C
Sbjct: 2711 VRSLKKDVCTMKQEEGKCADYILKWSYNQGKKACVQFWYGGCGGNGNRFDTQEQCEATC 2769          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Xenopus
Match: spint2 (serine peptidase inhibitor, Kunitz type, 2 [Source:NCBI gene;Acc:733874])

HSP 1 Score: 73.1738 bits (178), Expect = 1.114e-15
Identity = 36/106 (33.96%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN--------------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C+A  PR++++  S+ C  F YGGCG   NN K++++C D C  +  +               C  P   G C+A   R++Y+ T+  C  F YGGC  N NN+
Sbjct:  203 GNCRASFPRWYFDAESQNCISFTYGGCGGTENNHKSVQECADRCIVSKPEPAKVQAPMTGSFSEYCAAPSLTGPCRASFRRWYYDVTTATCVAFTYGGCRGNKNNY 308          

HSP 2 Score: 66.6254 bits (161), Expect = 2.441e-13
Identity = 39/129 (30.23%), Postives = 55/129 (42.64%), Query Frame = 1
Query:   70 IFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAK-------------------GFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            I    +L+  C      G C+A   R++YN  ++ CE F YGGC  N NN    + C + C     +   D L                     G C+A  PR++++  S+ C  F YGGCG   NN K
Sbjct:  109 IGPTPTLKDFCLPEAVTGPCRAAFERWWYNPNTQTCENFTYGGCKGNLNNHIGEEVCMNKCAGVTAEMSNDILPPSKRMAEANSDPACTGKGVIGNCRASFPRWYFDAESQNCISFTYGGCGGTENNHK 237          

HSP 3 Score: 47.3654 bits (111), Expect = 1.314e-6
Identity = 23/74 (31.08%), Postives = 35/74 (47.30%), Query Frame = 1
Query:   31 KLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            + I+  P           S  + C  P   G C+A   R++Y+ T+  C  F YGGC  N NN+ +++DC   C
Sbjct:  245 RCIVSKPEPAKVQAPMTGSFSEYCAAPSLTGPCRASFRRWYYDVTTATCVAFTYGGCRGNKNNYLSVEDCVKNC 318          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Xenopus
Match: chst1 (carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 [Source:Xenbase;Acc:XB-GENE-1001308])

HSP 1 Score: 67.3958 bits (163), Expect = 1.728e-13
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  145 RYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +++Y+  S +C  F++ GC  NGN F T ++C+  C       C  P  +G CK    R+ Y+    +C  F+YGGC  N NNF+
Sbjct:  318 QWYYDSQSGECHTFVHRGCQGNGNTFYTYEECRSSCHARPPDLCSLPPVRGPCKVPEWRWAYSTMMRQCFSFVYGGCQGNLNNFE 402          

HSP 2 Score: 49.2914 bits (116), Expect = 2.737e-7
Identity = 21/60 (35.00%), Postives = 33/60 (55.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCE 279
            C  P  +G CK    R+ Y+    +C  F+YGGC  N NNF++ + C+D C +   + C+
Sbjct:  361 CSLPPVRGPCKVPEWRWAYSTMMRQCFSFVYGGCQGNLNNFESKQACEDRCPQPQVKQCQ 420          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 87.8113 bits (216), Expect = 6.748e-22
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC----EETNKQNC------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +++ L   C      G CKA I  YF+N  + +CE FIYGGC  N N F TL++C+  C    E+T  +              EDP   G C+ Y+ RY YN+ +++CERF+YGGC  N NNF+
Sbjct:   42 SMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFE 162          

HSP 2 Score: 65.4698 bits (158), Expect = 2.214e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            EDP   GLC+ Y+ RY YN+ +++CERF+YGGC  N NNF+TL +C+ +CE
Sbjct:  125 EDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 172          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 87.8113 bits (216), Expect = 6.748e-22
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC----EETNKQNC------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +++ L   C      G CKA I  YF+N  + +CE FIYGGC  N N F TL++C+  C    E+T  +              EDP   G C+ Y+ RY YN+ +++CERF+YGGC  N NNF+
Sbjct:   42 SMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFE 162          

HSP 2 Score: 65.4698 bits (158), Expect = 2.214e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            EDP   GLC+ Y+ RY YN+ +++CERF+YGGC  N NNF+TL +C+ +CE
Sbjct:  125 EDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 172          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 87.8113 bits (216), Expect = 6.748e-22
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC----EETNKQNC------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +++ L   C      G CKA I  YF+N  + +CE FIYGGC  N N F TL++C+  C    E+T  +              EDP   G C+ Y+ RY YN+ +++CERF+YGGC  N NNF+
Sbjct:   42 SMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFE 162          

HSP 2 Score: 65.4698 bits (158), Expect = 2.214e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            EDP   GLC+ Y+ RY YN+ +++CERF+YGGC  N NNF+TL +C+ +CE
Sbjct:  125 EDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 172          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 87.4261 bits (215), Expect = 1.294e-21
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC----EETNKQNC------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +++ L   C      G CKA I  YF+N  + +CE FIYGGC  N N F TL++C+  C    E+T  +              EDP   G C+ Y+ RY YN+ +++CERF+YGGC  N NNF+
Sbjct:   42 SMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFE 162          

HSP 2 Score: 65.0846 bits (157), Expect = 2.720e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            EDP   GLC+ Y+ RY YN+ +++CERF+YGGC  N NNF+TL +C+ +CE
Sbjct:  125 EDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 172          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 87.4261 bits (215), Expect = 1.355e-21
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC----EETNKQNC------------EDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +++ L   C      G CKA I  YF+N  + +CE FIYGGC  N N F TL++C+  C    E+T  +              EDP   G C+ Y+ RY YN+ +++CERF+YGGC  N NNF+
Sbjct:   35 SMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFE 155          

HSP 2 Score: 65.0846 bits (157), Expect = 2.891e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  103 EDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            EDP   GLC+ Y+ RY YN+ +++CERF+YGGC  N NNF+TL +C+ +CE
Sbjct:  118 EDP---GLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 165          
BLAST of Tissue factor pathway inhibitor-1 vs. UniProt/SwissProt
Match: sp|P86733|KCP_HALAI (BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 6.856e-27
Identity = 48/112 (42.86%), Postives = 66/112 (58.93%), Query Frame = 1
Query:   64 FIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            F+  T       C+ P   G C+AYIP Y++N  +  CE+F+YGGC  N N F T++DC+  C   +   C  P   G C+A IPR++YN  + +C+RF YGGC  N NNFK
Sbjct:    2 FVGLTSAKYHDVCQLPRDPGPCRAYIPLYYFNSRTCLCEKFVYGGCQGNANRFDTVEDCRRRCGGGDL--CSLPRDSGPCEAAIPRWWYNKRTNRCQRFTYGGCEGNANNFK 111          

HSP 2 Score: 60.077 bits (144), Expect = 2.421e-11
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN 264
            C  P   G C+A IPR++YN  + +C+RF YGGC  N NNFKTL +C+  C + +
Sbjct:   70 CSLPRDSGPCEAAIPRWWYNKRTNRCQRFTYGGCEGNANNFKTLDECRFQCRKRS 124          
BLAST of Tissue factor pathway inhibitor-1 vs. UniProt/SwissProt
Match: sp|Q8WPI3|BOOG2_RHIMP (Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN=G2 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.187e-25
Identity = 49/126 (38.89%), Postives = 68/126 (53.97%), Query Frame = 1
Query:   52 LVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN----------KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            ++L+ +          C  P  +G+CKA IPR+++N  + KC  F YGGCG N NNF+T++DCQ  C              K  CE     G C   + R+FYN  S +CE F+YGGCG N NN++
Sbjct:    5 ILLAVLGTAFAQRNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEDCQKACGAPERVSDFEGADFKTGCEPAADSGSCAGQLERWFYNVRSGECETFVYGGCGGNDNNYE 130          

HSP 2 Score: 53.5286 bits (127), Expect = 1.088e-8
Identity = 23/61 (37.70%), Postives = 36/61 (59.02%), Query Frame = 1
Query:   73 FTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            F     +  CE     G C   + R+FYN  S +CE F+YGGCG N NN+++ ++C+ +C+
Sbjct:   80 FEGADFKTGCEPAADSGSCAGQLERWFYNVRSGECETFVYGGCGGNDNNYESEEECELVCK 140          
BLAST of Tissue factor pathway inhibitor-1 vs. UniProt/SwissProt
Match: sp|Q8WPI2|BOOH2_RHIMP (Boophilin-H2 OS=Rhipicephalus microplus OX=6941 GN=H2 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.541e-25
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC---EETN-------KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P  +G+CKA IPR+++N  + KC  F YGGCG N NNF+T+++CQ  C   E  N       K  CE     G C   + R+FYN  S +CE F+YGGCG N NN++
Sbjct:   21 CRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVNDFESADFKTGCEPAADSGSCAGQLERWFYNVQSGECETFVYGGCGGNDNNYE 130          

HSP 2 Score: 53.9138 bits (128), Expect = 6.851e-9
Identity = 23/61 (37.70%), Postives = 36/61 (59.02%), Query Frame = 1
Query:   73 FTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            F     +  CE     G C   + R+FYN  S +CE F+YGGCG N NN+++ ++C+ +C+
Sbjct:   80 FESADFKTGCEPAADSGSCAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECELVCK 140          
BLAST of Tissue factor pathway inhibitor-1 vs. UniProt/SwissProt
Match: sp|Q6T269|VKT3_BITGA (Kunitz-type serine protease inhibitor bitisilin-3 (Fragment) OS=Bitis gabonica OX=8694 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.163e-23
Identity = 49/100 (49.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P   G CK Y  R++Y+  S KCE FIYGGC  N NNFKT ++C+  C E     C  P   G C  Y  R++Y+  S KCE FIYGGC  N NNFK
Sbjct:   18 CNLPADLGPCKNYTGRFYYDSASNKCEVFIYGGCPGNANNFKTREECRKTCVEI----CILPAELGPCDEYTGRFYYDSASNKCEVFIYGGCQGNANNFK 113          

HSP 2 Score: 56.225 bits (134), Expect = 1.212e-9
Identity = 32/74 (43.24%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPR 321
            C  P   G C  Y  R++Y+  S KCE FIYGGC  N NNFKT  +C+  C E     C  P   G C  Y  R
Sbjct:   72 CILPAELGPCDEYTGRFYYDSASNKCEVFIYGGCQGNANNFKTRDECRKTCVEI----CILPAELGPCDEYTGR 141          
BLAST of Tissue factor pathway inhibitor-1 vs. UniProt/SwissProt
Match: sp|P62757|IATR_SHEEP (Inter-alpha-trypsin inhibitor (Fragment) OS=Ovis aries OX=9940 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.330e-22
Identity = 46/102 (45.10%), Postives = 58/102 (56.86%), Query Frame = 1
Query:   91 EQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            E +C+   ++G C     RYFYN TS  CE F YGGC  NGNNF + K+C   C     Q C  P+ +G C+A I  + ++    KC RFIYGGC  NGN F
Sbjct:    2 EDSCQLGYSQGPCLGMFKRYFYNGTSMACETFYYGGCMGNGNNFPSEKECLQTCRTV--QACNLPIVRGPCRAGIELWAFDAVKGKCVRFIYGGCNGNGNQF 101          

HSP 2 Score: 52.373 bits (124), Expect = 1.947e-8
Identity = 23/53 (43.40%), Postives = 33/53 (62.26%), Query Frame = 1
Query:   94 QNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            Q C  P+ +G C+A I  + ++    KC RFIYGGC  NGN F + K+C++ C
Sbjct:   59 QACNLPIVRGPCRAGIELWAFDAVKGKCVRFIYGGCNGNGNQFYSQKECKEYC 111          
BLAST of Tissue factor pathway inhibitor-1 vs. TrEMBL
Match: I1ZIG7 (Tissue factor pathway inhibitor-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 8.901e-59
Identity = 90/92 (97.83%), Postives = 91/92 (98.91%), Query Frame = 1
Query:  124 LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +CKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK
Sbjct:    1 MCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEERNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 92          

HSP 2 Score: 114.775 bits (286), Expect = 1.904e-30
Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN 264
            E  +QNCEDPLAKG CKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK LKDCQD CEETN
Sbjct:   45 ERNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKILKDCQDFCEETN 105          
BLAST of Tissue factor pathway inhibitor-1 vs. TrEMBL
Match: B7P3L9 (Serine protease inhibitor, putative OS=Ixodes scapularis OX=6945 GN=8024111 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.261e-30
Identity = 54/136 (39.71%), Postives = 84/136 (61.76%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDC----------QDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            MKT +++CL + ++F +  +   E  C  P+ +G C+A I R+F+N T+  CERF+YGGC  N NNF++ ++C          Q + E + +++C+     G C AY+PR+F+N  +  CERFIYGGCG N NN+ 
Sbjct:    1 MKTNIVVCL-VGVAFGLAFVRGQEDVCHLPVVRGPCRAVILRWFFNSTTGNCERFMYGGCRGNANNFESQEECRLSCKNARSMQQVVEASFEESCKPAAEAGVCDAYMPRWFFNVHTGACERFIYGGCGGNANNYH 135          

HSP 2 Score: 67.3958 bits (163), Expect = 3.354e-11
Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            S E++C+     G+C AY+PR+F+N  +  CERFIYGGCG N NN+ +  +C+  C
Sbjct:   89 SFEESCKPAAEAGVCDAYMPRWFFNVHTGACERFIYGGCGGNANNYHSFAECESTC 144          
BLAST of Tissue factor pathway inhibitor-1 vs. TrEMBL
Match: A0A131Y5D8 (Putative serine protease inhibitor OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.561e-29
Identity = 54/135 (40.00%), Postives = 83/135 (61.48%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDC----------QDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            MKT +++CL + ++F +  +   E  C  P+  G C+A +PR+F+N T+  CERF+YGGC  N NNF++ + C          Q + E + +++C+     G C AY+PR+F+N  +  CERFIYGGCG N NN+
Sbjct:    1 MKTNVVVCL-VGVAFGLALVRGQEDVCLLPVEIGPCRAMVPRWFFNSTTGDCERFVYGGCRGNANNFESQQQCRLSCKDARSMQQVVESSFEESCKPAAEPGVCDAYMPRWFFNVDTGACERFIYGGCGGNANNY 134          

HSP 2 Score: 105.531 bits (262), Expect = 7.866e-25
Identity = 50/119 (42.02%), Postives = 70/119 (58.82%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC--------------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            S E++C+     G+C AY+PR+F+N  +  CERFIYGGCG N NN+ T  +C+  C              E + +++C+     G C AY+PR F+N  +  CERFIYGGCG N NN+ 
Sbjct:   89 SFEESCKPAAEPGVCDAYMPRWFFNVDTGACERFIYGGCGGNANNYLTFAECERTCLRRDGTPRSMQQVVEASFEESCKPAAEPGVCDAYMPRCFFNVDTGACERFIYGGCGGNANNYH 207          

HSP 3 Score: 95.9005 bits (237), Expect = 3.423e-21
Identity = 48/119 (40.34%), Postives = 67/119 (56.30%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC-------------EETN-KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            S E++C+     G+C AY+PR F+N  +  CERFIYGGCG N NN+ +  +C+  C               TN ++ C      G C A+I R+F+N  +  CE F+YGGCG N NN+K
Sbjct:  161 SFEESCKPAAEPGVCDAYMPRCFFNVDTGACERFIYGGCGGNANNYHSFAECERTCLRRAVTPRRSPQTTGTNFEEGCRPEADSGVCDAHIRRWFFNVKTGHCETFVYGGCGGNENNYK 279          

HSP 4 Score: 58.5362 bits (140), Expect = 2.423e-7
Identity = 25/59 (42.37%), Postives = 37/59 (62.71%), Query Frame = 1
Query:   76 TIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            T  + E+ C      G+C A+I R+F+N  +  CE F+YGGCG N NN+K+ K+C+  C
Sbjct:  230 TGTNFEEGCRPEADSGVCDAHIRRWFFNVKTGHCETFVYGGCGGNENNYKSRKECEIAC 288          

HSP 5 Score: 54.299 bits (129), Expect = 6.787e-6
Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 1
Query:  274 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P+  G C+A +PR+F+N T+  CERF+YGGC  N NNF+
Sbjct:   26 CLLPVEIGPCRAMVPRWFFNSTTGDCERFVYGGCRGNANNFE 67          
BLAST of Tissue factor pathway inhibitor-1 vs. TrEMBL
Match: A0A4Q8K3J5 (U52-Liphistoxin-Lth1a_1 OS=Liphistius thaleban OX=1905330 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.959e-29
Identity = 55/137 (40.15%), Postives = 80/137 (58.39%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQ------NCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC-----EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            MK K+ +   L+L+  +   +S  +      +C     +GLCK Y+ RY+Y+   E C  F+YGGCG N NNF++L+DCQ  C     + ++   C  P+  GFCKA I R+ +N  S +CE F+YGGCG N NNF+
Sbjct:    1 MKMKIALSTILLLTISVVGADSRSKRAIRRSSCGMAAEQGLCKGYMTRYYYDSKGEVCRDFVYGGCGGNENNFRSLEDCQSHCSGFRKKRSSWDRCALPVLSGFCKAAIKRFHFNPDSLRCESFLYGGCGGNQNNFR 137          

HSP 2 Score: 63.5438 bits (153), Expect = 4.766e-10
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
             S    C  P+  G CKA I R+ +N  S +CE F+YGGCG N NNF++L+DC++ C++
Sbjct:   90 RSSWDRCALPVLSGFCKAAIKRFHFNPDSLRCESFLYGGCGGNQNNFRSLEDCRNACKD 148          
BLAST of Tissue factor pathway inhibitor-1 vs. TrEMBL
Match: A0A4D5RV45 (Putative serine protease inhibitor OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.007e-28
Identity = 54/135 (40.00%), Postives = 83/135 (61.48%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDC----------QDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            MKT +++CL + ++F +  +   E  C  P+ +G C+A I R+F+N T+  CERF+YGGC  N NNF++ ++C          Q + E +  ++C+     G C AY+PR+F+N  +  CERFIYGGCG N NN+
Sbjct:    1 MKTNIVVCL-VGVAFGLAFVRGQEDVCHLPVVRGPCRAVILRWFFNSTTGNCERFMYGGCRGNANNFESQEECRLSCKNAHSTQQMVETSFDESCKPAAEPGVCDAYMPRWFFNVHTGACERFIYGGCGGNLNNY 134          

HSP 2 Score: 100.138 bits (248), Expect = 1.030e-22
Identity = 48/119 (40.34%), Postives = 69/119 (57.98%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC------EETNKQ--------NCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            S E++C+     G+C AY+PR+F+N  +  CERFIYGGCG N NN+ +  +C+  C         + Q         C+     G C A+I R+F+N  + +CERF+YGGCG N NN+K
Sbjct:  183 SFEESCKPAAEPGVCDAYMPRWFFNVHTGACERFIYGGCGGNANNYHSFAECERTCLRRVVTPHRSPQMAGVDFEVGCKPEADSGVCDAHIRRWFFNVKTGQCERFVYGGCGGNENNYK 301          

HSP 3 Score: 95.5153 bits (236), Expect = 6.908e-21
Identity = 48/141 (34.04%), Postives = 71/141 (50.35%), Query Frame = 1
Query:   85 SLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC------------------------------------EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            S +++C+     G+C AY+PR+F+N  +  CERFIYGGCG N NN+ +  +C+  C                                    E + +++C+     G C AY+PR+F+N  +  CERFIYGGCG N NN+ 
Sbjct:   89 SFDESCKPAAEPGVCDAYMPRWFFNVHTGACERFIYGGCGGNLNNYLSSAECERTCLRRAETLDSAYRSGCSTCGWTPHWYPFPARSMQQVVEASFEESCKPAAEPGVCDAYMPRWFFNVHTGACERFIYGGCGGNANNYH 229          

HSP 4 Score: 60.077 bits (144), Expect = 7.459e-8
Identity = 25/55 (45.45%), Postives = 37/55 (67.27%), Query Frame = 1
Query:   88 LEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
             E  C+     G+C A+I R+F+N  + +CERF+YGGCG N NN+K+ K+C+  C
Sbjct:  256 FEVGCKPEADSGVCDAHIRRWFFNVKTGQCERFVYGGCGGNENNYKSRKNCEIAC 310          

HSP 5 Score: 53.9138 bits (128), Expect = 9.277e-6
Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 1
Query:  274 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P+ +G C+A I R+F+N T+  CERF+YGGC  N NNF+
Sbjct:   26 CHLPVVRGPCRAVILRWFFNSTTGNCERFMYGGCRGNANNFE 67          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Cavefish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:103023332])

HSP 1 Score: 99.7525 bits (247), Expect = 9.250e-27
Identity = 47/102 (46.08%), Postives = 63/102 (61.76%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK--QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P  +G C+  + RYFYN  +++CE F YGGCG N NNF T ++C  +C    K  Q C  P   G C+A + RYF+N T+ +CE+F YGGC  N NNF+
Sbjct:   27 CLLPAVEGPCRGLVSRYFYNTLTQRCEEFSYGGCGGNANNFVTFQECHKMCYTIPKIPQICRFPSEVGPCRALLSRYFFNMTTMQCEQFYYGGCQGNENNFQ 128          

HSP 2 Score: 99.3673 bits (246), Expect = 1.686e-26
Identity = 48/112 (42.86%), Postives = 66/112 (58.93%), Query Frame = 1
Query:   67 IIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN--KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            + +TI  + Q C  P   G C+A + RYF+N T+ +CE+F YGGC  N NNF++ + C + C  +      C+  L KG C A IPRY+YN   + CE F Y GCG + NNF
Sbjct:   76 MCYTIPKIPQICRFPSEVGPCRALLSRYFFNMTTMQCEQFYYGGCQGNENNFQSHQSCMEYCRPSKLIPVICQGVLDKGKCSASIPRYYYNSAKKTCEEFTYTGCGGSSNNF 187          

HSP 3 Score: 60.4622 bits (145), Expect = 1.042e-11
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK 267
            C+  L KG C A IPRY+YN   + CE F Y GCG + NNF + + C D+C   +K
Sbjct:  147 CQGVLDKGKCSASIPRYYYNSAKKTCEEFTYTGCGGSSNNFVSKQSCMDVCARKSK 202          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Cavefish
Match: spint1b (kunitz-type protease inhibitor 1-like [Source:NCBI gene;Acc:103024868])

HSP 1 Score: 90.8929 bits (224), Expect = 4.819e-22
Identity = 49/155 (31.61%), Postives = 69/155 (44.52%), Query Frame = 1
Query:   58 LSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET-------------------NKQNCE----------------------DPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            ++ ++ T E  EQ+C  P   G C+   PR+ YN  S KCE F +GGC  NGNN+ +  DC D C  T                   +++NC+                      DP   G C+A   R++Y+   + C RF YGGC  N NNF+
Sbjct:  221 VTVLVLTAEQAEQHCLTPKKVGPCRGAFPRWHYNAASNKCEEFTFGGCLENGNNYLSSDDCVDACNGTIVMPGARKVMPITEDCDGSDEENCQRLNRTLSRLLQIPVNEGKARCVDPPVTGPCRASFTRWYYDPLQQDCHRFTYGGCTGNKNNFE 375          

HSP 2 Score: 56.6102 bits (135), Expect = 5.600e-10
Identity = 25/66 (37.88%), Postives = 35/66 (53.03%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKG 297
            C DP   G C+A   R++Y+   + C RF YGGC  N NNF+    C D C +  ++   D  A+G
Sbjct:  334 CVDPPVTGPCRASFTRWYYDPLQQDCHRFTYGGCTGNKNNFEGQDKCMDACRDVTEK---DVFARG 396          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Cavefish
Match: ENSAMXT00000015806.2 (tissue factor pathway inhibitor-like [Source:NCBI gene;Acc:103025270])

HSP 1 Score: 87.8113 bits (216), Expect = 9.486e-22
Identity = 42/95 (44.21%), Postives = 59/95 (62.11%), Query Frame = 1
Query:  118 KGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC-EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +G CKA   R++++  S +CE F YGGC  N NNF+TL  C+++C  + NK  C      G C+  +PRYF++   ++C RF YGGC  N NNFK
Sbjct:   42 EGPCKAVKDRFYFDIDSGRCESFEYGGCQGNANNFQTLDQCEEMCVVKENKSPCHLEDEPGPCRGLVPRYFFDSRKQECRRFFYGGCFGNANNFK 136          

HSP 2 Score: 74.7146 bits (182), Expect = 9.876e-17
Identity = 42/135 (31.11%), Postives = 57/135 (42.22%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-------------------------------------------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C+  +PRYF++   ++C RF YGGC  N NNFKTLK+C+D C   N  +                                           C  P+ +G C     RY +N   ++C+ F Y GCG N NNF
Sbjct:  102 GPCRGLVPRYFFDSRKQECRRFFYGGCFGNANNFKTLKECRDRCHPGNDTDGPRPDTSTEKSPKPDELIDSAPNRQPQRQPRPEPSKEFTPPELCLSPVDRGNCDRAERRYAFNPRVKRCQMFQYSGCGGNRNNF 236          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Cavefish
Match: ENSAMXT00000053313.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:41013858:41018376:-1 gene:ENSAMXG00000036709.1 transcript:ENSAMXT00000053313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 3.705e-17
Identity = 35/92 (38.04%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  124 LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +C +Y PR+FY+  + KC  F YGGC  N N F T  +C + C   +   C+ P   G C  +  ++ ++ + ++C RF YGGCG NGN F+
Sbjct:   47 VCTSYEPRWFYDRRTGKCTHFWYGGCDGNSNRFLTEAECFETCGGLDV--CQLPHDLGKCYNFALKWHFDTSIQECTRFWYGGCGGNGNRFE 136          

HSP 2 Score: 45.8246 bits (107), Expect = 1.595e-6
Identity = 18/48 (37.50%), Postives = 31/48 (64.58%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQ 243
            C+ P   G C  +  ++ ++ + ++C RF YGGCG NGN F+T ++C+
Sbjct:   95 CQLPHDLGKCYNFALKWHFDTSIQECTRFWYGGCGGNGNRFETQEECE 142          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Cavefish
Match: ENSAMXT00000043406.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:41013520:41016723:-1 gene:ENSAMXG00000036709.1 transcript:ENSAMXT00000043406.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.259e-16
Identity = 36/101 (35.64%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  124 LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK---------QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +C +Y PR+FY+  + KC  F YGGC  N N F T  +C + C    K           C+ P   G C  +  ++ ++ + ++C RF YGGCG NGN F+
Sbjct:   59 VCTSYEPRWFYDRRTGKCTHFWYGGCDGNSNRFLTEAECFETCGGLGKLALKAIVCSDVCQLPHDLGKCYNFALKWHFDTSIQECTRFWYGGCGGNGNRFE 159          

HSP 2 Score: 49.2914 bits (116), Expect = 9.305e-8
Identity = 20/65 (30.77%), Postives = 39/65 (60.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAK 294
            C+ P   G C  +  ++ ++ + ++C RF YGGCG NGN F+T ++C+ L +  +++     L++
Sbjct:  118 CQLPHDLGKCYNFALKWHFDTSIQECTRFWYGGCGGNGNRFETQEECEALDQSRSRRTAAVALSQ 182          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Sea Lamprey
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 106.686 bits (265), Expect = 6.502e-30
Identity = 53/123 (43.09%), Postives = 73/123 (59.35%), Query Frame = 1
Query:   37 IICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK--QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            + C+ L  S  +FT+E     C  P   G C+A  PRYF+N ++ +CE FIYGGC +N NNF+T+++C+  C    K  + C      G C+A+I RYFYN T   C  F+YGGCG N N F+
Sbjct:    6 VQCMYLSESQCVFTLEDQRVTCTLPAKPGDCRAAFPRYFFNRSTLRCESFIYGGCHSNENNFETMQECRAACSFIKKIPKLCRPDAETGRCRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFE 128          

HSP 2 Score: 76.6406 bits (187), Expect = 2.504e-18
Identity = 41/108 (37.96%), Postives = 54/108 (50.00%), Query Frame = 1
Query:   79 IESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE--TNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            I+ + + C      G C+A+I RYFYN T   C  F+YGGCG N N F+ ++ C   C E     + C      G C+    R++YN     C  F Y GCG N NNF
Sbjct:   80 IKKIPKLCRPDAETGRCRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFEDMESCVFSCIEKPNTPRECLSRHDTGNCQGNFRRFYYNIQKRSCLPFSYSGCGGNNNNF 187          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 3.874e-23
Identity = 48/115 (41.74%), Postives = 63/115 (54.78%), Query Frame = 1
Query:   97 NCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE--------------ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +C   L  G C+AY+PR FYN  +++CE F YGGC  NGNNF++L +C   C               +   + C   +  G C+A + RYF+N TS  CE F YGGC  N NNFK
Sbjct:    2 SCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKCAWIPDHRLQLRRKQTDIAPKACRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFK 116          

HSP 2 Score: 73.1738 bits (178), Expect = 4.072e-17
Identity = 47/133 (35.34%), Postives = 56/133 (42.11%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC----------------------------EETNKQN------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C   +  G+C+A + RYF+N TS  CE F YGGC  N NNFK    C   C                             E+N +       C      G C A IPR+ YN  +  CE F YGGCG N NNF
Sbjct:   75 CRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFVLPRICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNF 207          

HSP 3 Score: 53.5286 bits (127), Expect = 7.879e-10
Identity = 22/47 (46.81%), Postives = 28/47 (59.57%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET 261
            G C A IPR+ YN  +  CE F YGGCG N NNF + + C  +C + 
Sbjct:  174 GECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVCGQV 220          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 4.903e-23
Identity = 48/115 (41.74%), Postives = 62/115 (53.91%), Query Frame = 1
Query:   94 QNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQ-------------DLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
             +C   L  G C+AY+PR FYN  +++CE F YGGC  NGNNF++L +C                C     + C   +  G C+A + RYF+N TS  CE F YGGC  N NNFK
Sbjct:    1 SSCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKCAWIPDNKRLASPCPLVAPKACRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFK 115          

HSP 2 Score: 72.7886 bits (177), Expect = 4.406e-17
Identity = 47/134 (35.07%), Postives = 56/134 (41.79%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC----------------------------EETNKQN------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C   +  G+C+A + RYF+N TS  CE F YGGC  N NNFK    C   C                             E+N +       C      G C A IPR+ YN  +  CE F YGGCG N NNF 
Sbjct:   74 CRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFVLPRICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFS 207          

HSP 3 Score: 53.5286 bits (127), Expect = 7.138e-10
Identity = 22/47 (46.81%), Postives = 28/47 (59.57%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEET 261
            G C A IPR+ YN  +  CE F YGGCG N NNF + + C  +C + 
Sbjct:  173 GECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVCGQV 219          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 71.633 bits (174), Expect = 6.212e-16
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C +P     C +   +++Y+     C+ F+YGGC +N N F T + C+  C+      C  P  +G C+ +   + YN   ++C+  +YGGC  N NNF+
Sbjct:  341 CHEPPDVTHCGSARTKWYYDSGLNACDTFVYGGCDSNRNRFDTYEGCKRWCQNQTVNICHLPPVQGPCRDWERHWAYNPLIKQCQLLVYGGCEGNENNFE 440          

HSP 2 Score: 50.0618 bits (118), Expect = 2.268e-8
Identity = 24/74 (32.43%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPR 321
            C  P  +G C+ +   + YN   ++C+  +YGGC  N NNF++ + C+D        NC  P     CK+  PR
Sbjct:  399 CHLPPVQGPCRDWERHWAYNPLIKQCQLLVYGGCEGNENNFESREACED--------NCPFPTKAALCKSCKPR 464          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009465.1 (pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 gene:ENSPMAG00000008558.1 transcript:ENSPMAT00000009465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 8.997e-12
Identity = 34/107 (31.78%), Postives = 47/107 (43.93%), Query Frame = 1
Query:  115 AKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-------------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
              G C+    R+ Y+  +  C+ F YGGC  N NNF    +C   C  ++ +              C    A G C+    R+ Y+  S  C+ F YGGCG N NNF
Sbjct:    6 TTGPCRGSFTRWTYDAATSTCKEFTYGGCRGNQNNFLEEAECLMDCGRSDVKMAVYCWQFGSWPYICLLEEAVGPCRGSFTRWIYDAESSNCKEFTYGGCGGNFNNF 112          

HSP 2 Score: 51.9878 bits (123), Expect = 3.074e-9
Identity = 38/130 (29.23%), Postives = 49/130 (37.69%), Query Frame = 1
Query:  115 AKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF--------------KTLKDCQ-----------------DLCEETNK-----QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            A G C+    R+ Y+  S  C+ F YGGCG N NNF               TL+ C+                   C  T +       C        C+    R+ Y+  S  C+ F YGGCG N NNF
Sbjct:   77 AVGPCRGSFTRWIYDAESSNCKEFTYGGCGGNFNNFLEETECMVTCGRSLGTLRTCRYHRTLNYLVVNNSCFLISSCWMTRRLFHVQDVCLLEAVTSPCRGSFTRWTYDAESGHCKEFTYGGCGGNFNNF 206          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Nematostella
Match: EDO29819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J6])

HSP 1 Score: 62.7734 bits (151), Expect = 2.154e-14
Identity = 27/51 (52.94%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C  P   G C+A +PR F+N  S KCE FIYGGCG N NNF T+++C+  C
Sbjct:   14 CTLPKKVGDCRAAMPRVFFNSQSGKCEDFIYGGCGGNANNFHTMEECKKAC 64          

HSP 2 Score: 53.5286 bits (127), Expect = 7.938e-11
Identity = 24/41 (58.54%), Postives = 27/41 (65.85%), Query Frame = 1
Query:  274 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C  P   G C+A +PR F+N  S KCE FIYGGCG N NNF
Sbjct:   14 CTLPKKVGDCRAAMPRVFFNSQSGKCEDFIYGGCGGNANNF 54          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Nematostella
Match: EDO47795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL41])

HSP 1 Score: 60.077 bits (144), Expect = 1.708e-13
Identity = 22/52 (42.31%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            C+ P   G C AY+PR++YN    +C++F+YGGC  N N FK+ + C+  C+
Sbjct:    2 CQLPKLPGPCSAYVPRWYYNAKHRRCQKFVYGGCRGNANRFKSHRSCERSCK 53          

HSP 2 Score: 53.1434 bits (126), Expect = 1.074e-10
Identity = 20/42 (47.62%), Postives = 28/42 (66.67%), Query Frame = 1
Query:  274 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C+ P   G C AY+PR++YN    +C++F+YGGC  N N FK
Sbjct:    2 CQLPKLPGPCSAYVPRWYYNAKHRRCQKFVYGGCRGNANRFK 43          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Nematostella
Match: EDO41696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 60.077 bits (144), Expect = 1.776e-13
Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C  P   G C+AY  R+FYN TS KC++F+YGGC  N NNF++  +C+  C
Sbjct:    2 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          

HSP 2 Score: 54.299 bits (129), Expect = 3.575e-11
Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 1
Query:  274 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P   G C+AY  R+FYN TS KC++F+YGGC  N NNF+
Sbjct:    2 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFE 43          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Nematostella
Match: EDO26263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 60.077 bits (144), Expect = 1.776e-13
Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C  P   G C+AY  R+FYN TS KC++F+YGGC  N NNF++  +C+  C
Sbjct:    2 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          

HSP 2 Score: 54.299 bits (129), Expect = 3.575e-11
Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 1
Query:  274 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            C  P   G C+AY  R+FYN TS KC++F+YGGC  N NNF+
Sbjct:    2 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFE 43          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Nematostella
Match: EDO31759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX08])

HSP 1 Score: 59.3066 bits (142), Expect = 3.323e-13
Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C+ P A G C+A +P+++YN    +C RFIYGGCG N NNF T  +C+  C
Sbjct:    2 CKMPAAAGPCRAAMPQWYYNFKRHRCIRFIYGGCGGNPNNFDTKNECKSAC 52          

HSP 2 Score: 51.9878 bits (123), Expect = 2.447e-10
Identity = 22/41 (53.66%), Postives = 29/41 (70.73%), Query Frame = 1
Query:  274 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C+ P A G C+A +P+++YN    +C RFIYGGCG N NNF
Sbjct:    2 CKMPAAAGPCRAAMPQWYYNFKRHRCIRFIYGGCGGNPNNF 42          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Medaka
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:101174930])

HSP 1 Score: 100.908 bits (250), Expect = 1.600e-26
Identity = 48/110 (43.64%), Postives = 65/110 (59.09%), Query Frame = 1
Query:   73 FTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC--EETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            F I  + Q C  P  +G C+A  P YF+N ++ +CE F YGGCG N N F+ L  C D C  +++    C DPL KG C A + R++YN  ++ CE F Y GCG + NNF
Sbjct:  135 FRIPKVPQICRFPKEEGHCRALFPSYFFNMSTMQCEPFSYGGCGGNSNRFRDLTSCMDFCSPQKSVPILCLDPLDKGKCSASMRRFYYNKATKTCEEFAYSGCGGSSNNF 244          

HSP 2 Score: 94.3597 bits (233), Expect = 3.934e-24
Identity = 45/96 (46.88%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  118 KGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNK--QNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +G C+  I RYFYN  ++KCE F YGGC  N NNF + + CQ  C    K  Q C  P  +G C+A  P YF+N ++ +CE F YGGCG N N F+
Sbjct:   90 EGPCRGQIERYFYNTITQKCEVFYYGGCHGNANNFMSFQKCQKTCFRIPKVPQICRFPKEEGHCRALFPSYFFNMSTMQCEPFSYGGCGGNSNRFR 185          

HSP 3 Score: 59.6918 bits (143), Expect = 2.677e-11
Identity = 25/58 (43.10%), Postives = 38/58 (65.52%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN 273
            C DPL KG C A + R++YN  ++ CE F Y GCG + NNF + + C+D+C +  K++
Sbjct:  204 CLDPLDKGKCSASMRRFYYNKATKTCEEFAYSGCGGSSNNFVSRESCEDVCLKGAKKH 261          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Medaka
Match: ENSORLT00000018112.2 (tissue factor pathway inhibitor [Source:NCBI gene;Acc:101174546])

HSP 1 Score: 90.1225 bits (222), Expect = 2.348e-22
Identity = 41/93 (44.09%), Postives = 60/93 (64.52%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN-CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            G C+A   RYF+N ++ +CE F YGGC  N NNF TL++C++ C  ++++N C    A G C+  + RYF++  + +C RF YGGC  N NNF
Sbjct:   47 GPCRAIKDRYFFNVSTARCEEFEYGGCSGNSNNFVTLQECEETCVVSDEKNPCHLEEAPGPCRGLLSRYFFDSKTRQCRRFFYGGCFGNANNF 139          

HSP 2 Score: 53.1434 bits (126), Expect = 8.148e-9
Identity = 24/60 (40.00%), Postives = 36/60 (60.00%), Query Frame = 1
Query:   79 IESLEQN-CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            + S E+N C    A G C+  + RYF++  + +C RF YGGC  N NNF ++ +CQ  C+
Sbjct:   91 VVSDEKNPCHLEEAPGPCRGLLSRYFFDSKTRQCRRFFYGGCFGNANNFWSMAECQAKCQ 150          

HSP 3 Score: 45.8246 bits (107), Expect = 2.259e-6
Identity = 21/51 (41.18%), Postives = 27/51 (52.94%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C  P+  G C     RYFY+  +++C  F Y GCG N NNF+  K C   C
Sbjct:  229 CLSPVDPGDCDGQERRYFYHPKAKRCYSFWYTGCGGNKNNFRIRKHCVHKC 279          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Medaka
Match: ENSORLT00000042019.1 (pep primary_assembly:ASM223467v1:12:15740119:15780496:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000042019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 1.662e-20
Identity = 49/99 (49.49%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C      GLC  Y  RYFYN    +CE FIYGGC  N NNF T K+C  LC  T       P   G C  Y  RYFYN    +CE FIYGGC  N NNF
Sbjct:   25 CAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKEC--LCILTKLPQPHIPPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNF 121          

HSP 2 Score: 76.2554 bits (186), Expect = 1.622e-17
Identity = 45/97 (46.39%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  109 PLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            P   GLC  Y  RYFYN    +CE FIYGGC  N NNF T K+C        +  C      G C+ Y  RYFYN    +CE FIYG C  N NNF+
Sbjct:   84 PPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKEC------LQRYVCTLDPDPGPCECYSERYFYNFKKRRCEIFIYGCCNGNQNNFE 174          

HSP 3 Score: 45.4394 bits (106), Expect = 2.683e-6
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 1
Query:  121 GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE 255
            G C+ Y  RYFYN    +CE FIYG C  N NNF+T ++C   C 
Sbjct:  140 GPCECYSERYFYNFKKRRCEIFIYGCCNGNQNNFETEQECLRRCR 184          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Medaka
Match: ENSORLT00000012975.2 (pep primary_assembly:ASM223467v1:12:15740273:15760140:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000012975.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 2.097e-20
Identity = 46/99 (46.46%), Postives = 50/99 (50.51%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNF 396
            C      GLC  Y  RYFYN    +CE FIYGGC  N NNF T K+C        +  C      G C  Y  RYFYN    +CE FIYGGC  N NNF
Sbjct:   73 CAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKEC------LQRWVCAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNF 165          

HSP 2 Score: 51.6026 bits (122), Expect = 1.174e-8
Identity = 26/51 (50.98%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 252
            C      GLC  Y  RYFYN    +CE FIYGGC  N NNF T K+C   C
Sbjct:  125 CAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQRC 175          
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Medaka
Match: ENSORLT00000019748.2 (pep primary_assembly:ASM223467v1:24:12107119:12114066:1 gene:ENSORLG00000015771.2 transcript:ENSORLT00000019748.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 3.113e-18
Identity = 49/147 (33.33%), Postives = 65/147 (44.22%), Query Frame = 1
Query:   58 LSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCE---------------ETNKQN------------------CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            +S I+ T E     C  PL  G C+A  PR+ Y+ T   C  F +GGC AN NN+ +  DC   C+                TN ++                  C D    G C+A IPR+FY+    KC  FI+GGC  N NNF+
Sbjct:  213 VSVIVITPEMSISYCMAPLKVGPCRAAFPRWQYDATQGLCTEFHFGGCNANENNYLSENDCMSACQGVKGKPLKISPKKTSVTNDKDCLDDCTNTTDGESCIKFQCTDAPRTGPCRASIPRWFYDPLKLKCYSFIFGGCNGNENNFE 359          

HSP 2 Score: 53.5286 bits (127), Expect = 5.295e-9
Identity = 24/58 (41.38%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  100 CEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQN 273
            C D    G C+A IPR+FY+    KC  FI+GGC  N NNF+    C + C++ +  N
Sbjct:  318 CTDAPRTGPCRASIPRWFYDPLKLKCYSFIFGGCNGNENNFEDETTCMETCKDVSGTN 375          
BLAST of Tissue factor pathway inhibitor-1 vs. Planmine SMEST
Match: SMESG000037996.1 (SMESG000037996.1)

HSP 1 Score: 253.832 bits (647), Expect = 1.502e-88
Identity = 125/126 (99.21%), Postives = 125/126 (99.21%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE NKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK
Sbjct:    1 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEERNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 126          

HSP 2 Score: 115.161 bits (287), Expect = 8.252e-34
Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN 264
            E  +QNCEDPLAKG CKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK LKDCQD CEETN
Sbjct:   79 ERNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKILKDCQDFCEETN 139          
BLAST of Tissue factor pathway inhibitor-1 vs. Planmine SMEST
Match: SMESG000038000.1 (SMESG000038000.1)

HSP 1 Score: 243.817 bits (621), Expect = 4.231e-82
Identity = 119/126 (94.44%), Postives = 122/126 (96.83%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            MKTKLIICLPLVLSFIIFTIESLE NC+DPLA+GLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE NKQNCEDPLA+G C AYIPRYFYNDTSEKCERFIYGGCGANGNNFK
Sbjct:    1 MKTKLIICLPLVLSFIIFTIESLEPNCKDPLAQGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEERNKQNCEDPLAQGLCMAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 126          

HSP 2 Score: 207.608 bits (527), Expect = 6.484e-68
Identity = 100/106 (94.34%), Postives = 104/106 (98.11%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            E+ +QNCEDPLA+ LCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLA+GFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK
Sbjct:  190 ETNKQNCEDPLAQSLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAQGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 295          

HSP 3 Score: 178.333 bits (451), Expect = 2.081e-56
Identity = 98/159 (61.64%), Postives = 101/159 (63.52%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCG-----------------------------------------------------ANGNNFKTLKDCQDLCEETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            E  +QNCEDPLA+GLC AYIPRYFYNDTSEKCERFIYGGCG                                                     ANGNNFKTLKDCQDLCEETNKQNCEDPLA+  CKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK
Sbjct:   79 ERNKQNCEDPLAQGLCMAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEERNRSISYTLVHGLYSRYFYNDTTEKCEKFFYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAQSLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 237          

HSP 4 Score: 115.546 bits (288), Expect = 4.749e-32
Identity = 54/61 (88.52%), Postives = 58/61 (95.08%), Query Frame = 1
Query:   82 ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN 264
            E+ +QNCEDPLA+G CKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK+LKDCQD CEETN
Sbjct:  248 ETNKQNCEDPLAQGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKSLKDCQDFCEETN 308          
BLAST of Tissue factor pathway inhibitor-1 vs. Planmine SMEST
Match: SMESG000038002.1 (SMESG000038002.1)

HSP 1 Score: 155.606 bits (392), Expect = 2.072e-50
Identity = 76/83 (91.57%), Postives = 77/83 (92.77%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQ 270
            MKTKLIICL LVLSFIIFTIESLE NCEDPL KGLC+AY PRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN  
Sbjct:    1 MKTKLIICLALVLSFIIFTIESLEPNCEDPLVKGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNSD 83          

HSP 2 Score: 88.9669 bits (219), Expect = 3.436e-24
Identity = 40/48 (83.33%), Postives = 43/48 (89.58%), Query Frame = 1
Query:  256 ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            E+ + NCEDPL KG C+AY PRYFYNDTSEKCERFIYGGCGANGNNFK
Sbjct:   21 ESLEPNCEDPLVKGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFK 68          
BLAST of Tissue factor pathway inhibitor-1 vs. Planmine SMEST
Match: SMESG000037997.1 (SMESG000037997.1)

HSP 1 Score: 153.295 bits (386), Expect = 1.682e-49
Identity = 75/83 (90.36%), Postives = 76/83 (91.57%), Query Frame = 1
Query:   22 MKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQ 270
            MKTKLII L LVLSFIIFTIESLE NCEDPL KGLC+AY PRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETN  
Sbjct:    1 MKTKLIIWLALVLSFIIFTIESLEPNCEDPLVKGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNSD 83          

HSP 2 Score: 89.3521 bits (220), Expect = 2.398e-24
Identity = 40/48 (83.33%), Postives = 43/48 (89.58%), Query Frame = 1
Query:  256 ETNKQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            E+ + NCEDPL KG C+AY PRYFYNDTSEKCERFIYGGCGANGNNFK
Sbjct:   21 ESLEPNCEDPLVKGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFK 68          
BLAST of Tissue factor pathway inhibitor-1 vs. Planmine SMEST
Match: SMESG000038004.1 (SMESG000038004.1)

HSP 1 Score: 87.8113 bits (216), Expect = 9.166e-24
Identity = 41/76 (53.95%), Postives = 52/76 (68.42%), Query Frame = 1
Query:   31 KLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEE 258
            K++I    +   + F I+ LE NC+DP   G C  YI RY+YN+ + KCE+FIYGGC  NGNNFKTL+ CQD CEE
Sbjct:    2 KVLIKFIPLSCLMFFAIQCLEHNCDDPKTSGPCYGYILRYYYNNNTTKCEKFIYGGCKPNGNNFKTLEACQDFCEE 77          

HSP 2 Score: 62.003 bits (149), Expect = 1.379e-13
Identity = 27/45 (60.00%), Postives = 33/45 (73.33%), Query Frame = 1
Query:  265 KQNCEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK 399
            + NC+DP   G C  YI RY+YN+ + KCE+FIYGGC  NGNNFK
Sbjct:   22 EHNCDDPKTSGPCYGYILRYYYNNNTTKCEKFIYGGCKPNGNNFK 66          
The following BLAST results are available for this feature:
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TFPI5.276e-2447.92tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI3.119e-2242.20tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI3.119e-2242.20tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI2.037e-2142.20tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI2.037e-2142.20tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mec-13.808e-1843.01pep chromosome:WBcel235:V:6956542:6966422:1 gene:W... [more]
mec-13.808e-1843.01pep chromosome:WBcel235:V:6956537:6966422:1 gene:W... [more]
mec-13.882e-1843.01pep chromosome:WBcel235:V:6956542:6966422:1 gene:W... [more]
mec-13.882e-1843.01pep chromosome:WBcel235:V:6956537:6966422:1 gene:W... [more]
mec-13.957e-1843.01pep chromosome:WBcel235:V:6956542:6966422:1 gene:W... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppn2.579e-1836.54gene:FBgn0003137 transcript:FBtr0301837[more]
Ppn2.627e-1836.54gene:FBgn0003137 transcript:FBtr0301838[more]
Ppn3.666e-1736.36gene:FBgn0003137 transcript:FBtr0301839[more]
Ppn5.976e-1634.02gene:FBgn0003137 transcript:FBtr0300337[more]
CG342764.611e-1543.06gene:FBgn0085305 transcript:FBtr0112471[more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi21.302e-2444.55tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
tfpi21.302e-2444.55tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
tfpia1.194e-2342.86tissue factor pathway inhibitor a [Source:ZFIN;Acc... [more]
tfpia1.291e-2341.67tissue factor pathway inhibitor a [Source:ZFIN;Acc... [more]
spint26.735e-1933.33serine peptidase inhibitor, Kunitz type, 2 [Source... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi22.136e-2235.20tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
WFIKKN23.067e-1739.00WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
ENSXETT00000014273.11.366e-1632.20collagen type VI alpha 5 chain [Source:NCBI gene;A... [more]
spint21.114e-1533.96serine peptidase inhibitor, Kunitz type, 2 [Source... [more]
chst11.728e-1335.29carbohydrate (keratan sulfate Gal-6) sulfotransfer... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tfpi6.748e-2239.52tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi6.748e-2239.52tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi6.748e-2239.52tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi1.294e-2139.52tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi1.355e-2139.52tissue factor pathway inhibitor [Source:MGI Symbol... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P86733|KCP_HALAI6.856e-2742.86BPTI/Kunitz domain-containing protein (Fragment) O... [more]
sp|Q8WPI3|BOOG2_RHIMP1.187e-2538.89Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN... [more]
sp|Q8WPI2|BOOH2_RHIMP1.541e-2544.55Boophilin-H2 OS=Rhipicephalus microplus OX=6941 GN... [more]
sp|Q6T269|VKT3_BITGA1.163e-2349.00Kunitz-type serine protease inhibitor bitisilin-3 ... [more]
sp|P62757|IATR_SHEEP1.330e-2245.10Inter-alpha-trypsin inhibitor (Fragment) OS=Ovis a... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIG78.901e-5997.83Tissue factor pathway inhibitor-1 OS=Schmidtea med... [more]
B7P3L92.261e-3039.71Serine protease inhibitor, putative OS=Ixodes scap... [more]
A0A131Y5D83.561e-2940.00Putative serine protease inhibitor OS=Ixodes ricin... [more]
A0A4Q8K3J53.959e-2940.15U52-Liphistoxin-Lth1a_1 OS=Liphistius thaleban OX=... [more]
A0A4D5RV453.007e-2840.00Putative serine protease inhibitor OS=Ixodes scapu... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi29.250e-2746.08tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
spint1b4.819e-2231.61kunitz-type protease inhibitor 1-like [Source:NCBI... [more]
ENSAMXT00000015806.29.486e-2244.21tissue factor pathway inhibitor-like [Source:NCBI ... [more]
ENSAMXT00000053313.13.705e-1738.04pep primary_assembly:Astyanax_mexicanus-2.0:25:410... [more]
ENSAMXT00000043406.11.259e-1635.64pep primary_assembly:Astyanax_mexicanus-2.0:25:410... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi26.502e-3043.09tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000005038.13.874e-2341.74pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005043.14.903e-2341.74pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
WFIKKN16.212e-1631.00WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
ENSPMAT00000009465.18.997e-1231.78pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 ... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298192.154e-1452.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477951.708e-1342.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416961.776e-1349.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262631.776e-1349.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317593.323e-1349.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi21.600e-2643.64tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
ENSORLT00000018112.22.348e-2244.09tissue factor pathway inhibitor [Source:NCBI gene;... [more]
ENSORLT00000042019.11.662e-2049.49pep primary_assembly:ASM223467v1:12:15740119:15780... [more]
ENSORLT00000012975.22.097e-2046.46pep primary_assembly:ASM223467v1:12:15740273:15760... [more]
ENSORLT00000019748.23.113e-1833.33pep primary_assembly:ASM223467v1:24:12107119:12114... [more]
back to top
BLAST of Tissue factor pathway inhibitor-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037996.11.502e-8899.21SMESG000037996.1[more]
SMESG000038000.14.231e-8294.44SMESG000038000.1[more]
SMESG000038002.12.072e-5091.57SMESG000038002.1[more]
SMESG000037997.11.682e-4990.36SMESG000037997.1[more]
SMESG000038004.19.166e-2453.95SMESG000038004.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015120 ID=SMED30015120|Name=Tissue factor pathway inhibitor-1|organism=Schmidtea mediterranea sexual|type=transcript|length=400bp
ATTATTATTATTATTATTATTATGAAAACGAAACTAATAATATGTCTTCC
TTTGGTATTGAGTTTCATAATTTTTACTATTGAAAGTTTAGAACAAAACT
GCGAGGATCCATTAGCTAAAGGCTTGTGCAAGGCTTATATTCCCCGATAT
TTTTACAATGATACTTCGGAAAAATGTGAGAGGTTTATTTATGGAGGATG
TGGAGCCAATGGAAATAATTTCAAAACTCTAAAAGACTGTCAAGATCTTT
GTGAAGAAACTAACAAACAAAACTGTGAGGATCCATTAGCTAAAGGCTTC
TGCAAGGCTTATATTCCCCGATATTTTTACAATGATACTTCGGAAAAATG
TGAGAGGTTTATTTATGGAGGATGTGGAGCCAATGGAAATAATTTCAAAA
back to top

protein sequence of SMED30015120-orf-1

>SMED30015120-orf-1 ID=SMED30015120-orf-1|Name=SMED30015120-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
IIIIIIIMKTKLIICLPLVLSFIIFTIESLEQNCEDPLAKGLCKAYIPRY
FYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLCEETNKQNCEDPLAKGF
CKAYIPRYFYNDTSEKCERFIYGGCGANGNNFK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR002223Kunitz_BPTI
IPR020901Prtase_inh_Kunz-CS
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainPRINTSPR00759BASICPTASEcoord: 59..69
score: 59.19
coord: 31..45
score: 30.5
coord: 69..84
score: 41.98
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 32..85
e-value: 3.0E-20
score: 83.3
coord: 90..133
e-value: 4.7E-7
score: 39.4
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 92..133
e-value: 2.8E-13
score: 49.9
coord: 34..85
e-value: 1.5E-18
score: 66.8
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 92..133
score: 12.16
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 34..84
score: 15.009
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 92..133
e-value: 5.61218E-15
score: 62.6526
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 34..84
e-value: 8.54739E-20
score: 74.5938
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 90..133
e-value: 1.3E-16
score: 62.2
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 31..89
e-value: 1.2E-22
score: 81.4
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 90..132
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 26..85
NoneNo IPR availablePANTHERPTHR10083:SF344coord: 31..87
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 88..133
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 31..87
NoneNo IPR availablePANTHERPTHR10083:SF344coord: 88..133
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 62..80