SMED30015115

Overview
NameSMED30015115
Smed IDSMED30015115
Length (bp)1681
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015115 (SMED30015115) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015115 (SMED30015115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015115 (SMED30015115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015115 (SMED30015115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015115

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30015115h1SMcG0010279 Contig55656newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015115h1SMcG0010279 Contig55656uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30015115h1SMcG0010279 dd_Smed_v4_773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015115h1SMcG0010279 dd_Smed_v4_773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015115h1SMcG0010279 dd_Smed_v4_773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30015115h1SMcG0010279 MF669566.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30015115h1SMcG0010279 MF669566.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30015115h1SMcG0010279 MF669566.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30015115h1SMcG0010279 MF669566.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogonial stem cellSMED30015115h1SMcG0010279 MF669566.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015115 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000655:128171..129973 +8237
Homology
BLAST of SMED30015115 vs. Ensembl Human
Match: CCT4 (chaperonin containing TCP1 subunit 4 [Source:HGNC Symbol;Acc:HGNC:1617])

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 319/515 (61.94%), Postives = 424/515 (82.33%), Query Frame = -2
Query:   52 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1590
            + D+ K + +R SNI+AAKAVAD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHPAA+M+V+LS++QDIEAGDGTTSVV+IAGSLL +C+KLL KGIHPT+ISE+FQKA E   E+L + S+ +++S+RE LL  A+TSLNSKVV QYSS+L+P++V+AV++ ID  T+ SV+L DIKI  K GGT++D  LV+GL++ + V S   + RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMVIKDIER D+E  CK +  KP+A +D F  DM   A+L EE++  G+ +++K++G  +PG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RA+ADA+E+IP TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:   24 YQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKV-SNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVN 537          
BLAST of SMED30015115 vs. Ensembl Human
Match: CCT4 (chaperonin containing TCP1 subunit 4 [Source:HGNC Symbol;Acc:HGNC:1617])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 296/515 (57.48%), Postives = 395/515 (76.70%), Query Frame = -2
Query:   52 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1590
            + D+ K + +R SNI+AAKAVAD +RTSLGP+GMDKM                              +V+LS++QDIEAGDGTTSVV+IAGSLL +C+KLL KGIHPT+ISE+FQKA E   E+L + S+ +++S+RE LL  A+TSLNSKVV QYSS+L+P++V+AV++ ID  T+ SV+L DIKI  K GGT++D  LV+GL++ + V S   + RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMVIKDIER D+E  CK +  KP+A +D F  DM   A+L EE++  G+ +++K++G  +PG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RA+ADA+E+IP TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:   24 YQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKM------------------------------LVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKV-SNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVN 507          
BLAST of SMED30015115 vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 340.887 bits (873), Expect = 1.915e-110
Identity = 203/505 (40.20%), Postives = 301/505 (59.60%), Query Frame = -2
Query:   58 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQE--MDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1554
            S+I AAKAVA+T+RTSLGP G+DKM+ +  GDVTVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  I++ +++AA +A E L   S    +DI + E L++ A T+L SKVV      +A IAV+AVL   D     V+   IK+  K GG +EDT L+ G+I+D+        K+VE AKIA++     PPK    H + V+       +   E++    + + IK +G N+ + Q         D A H   + N+  ++ +   ++EL   A   + +        +    A LV+EIS GT+  +++ +    N    V+I + G N M++ EA+RSLHDALCVIR L++   ++ GGGA EI+ +  ++  + +   L QY +RA+ADALE+IP  L+ENSG++PIQT+TE+R R  + E+N   GI+      +D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   15 SHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQW-----GFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKN-SRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDI 512          
BLAST of SMED30015115 vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 340.502 bits (872), Expect = 4.638e-110
Identity = 203/505 (40.20%), Postives = 301/505 (59.60%), Query Frame = -2
Query:   58 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQE--MDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1554
            S+I AAKAVA+T+RTSLGP G+DKM+ +  GDVTVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  I++ +++AA +A E L   S    +DI + E L++ A T+L SKVV      +A IAV+AVL   D     V+   IK+  K GG +EDT L+ G+I+D+        K+VE AKIA++     PPK    H + V+       +   E++    + + IK +G N+ + Q         D A H   + N+  ++ +   ++EL   A   + +        +    A LV+EIS GT+  +++ +    N    V+I + G N M++ EA+RSLHDALCVIR L++   ++ GGGA EI+ +  ++  + +   L QY +RA+ADALE+IP  L+ENSG++PIQT+TE+R R  + E+N   GI+      +D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   36 SHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQW-----GFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKN-SRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDI 533          
BLAST of SMED30015115 vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 337.421 bits (864), Expect = 2.417e-109
Identity = 201/501 (40.12%), Postives = 298/501 (59.48%), Query Frame = -2
Query:   58 AAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQE--MDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1542
            AAKAVA+T+RTSLGP G+DKM+ +  GDVTVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  I++ +++AA +A E L   S    +DI + E L++ A T+L SKVV      +A IAV+AVL   D     V+   IK+  K GG +EDT L+ G+I+D+        K+VE AKIA++     PPK    H + V+       +   E++    + + IK +G N+ + Q         D A H   + N+  ++ +   ++EL   A   + +        +    A LV+EIS GT+  +++ +    N    V+I + G N M++ EA+RSLHDALCVIR L++   ++ GGGA EI+ +  ++  + +   L QY +RA+ADALE+IP  L+ENSG++PIQT+TE+R R  + E+N   GI+      +D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:    2 AAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQW-----GFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKN-SRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDI 495          
BLAST of SMED30015115 vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 309/525 (58.86%), Postives = 403/525 (76.76%), Query Frame = -2
Query:   43 AVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHS-VNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEI-SAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1611
            A   +  F DK K  +VR+SNI AAKAVAD VRTSLGPRGMDKMIQ   GDVT+TNDGATIL +M ++HP A+M+V+LS++QDIEAGDGTT+VVV+AG+LL A   LL KGIHPT ISE+FQ AA  A ++L   S  +D+SN  +L K+A+TSLNSKVV Q+S +LAP+AV+AV + I+  + S VNL  IKI  K G TVE++ L++G +ID+         R+EKAKI LI+F ISPPKT+M++ V++++Y+QMDR + EER+Y+L I K IK++GCNVLLIQKSILRDA+ +LALHF +K+ IM IKDIER D+E Y + L C+P+AS+DHFN D    ADLVEEI + G  +++KV+G+ NPG  VSIL+ GSN +VL EA+RS+HDALCVIRCLVKK AL+ GGGAPE+ ++  + N +    G  QYC RA+ADALE+IPYTLAEN+GLSPI TVTELRN HA G  + G+N+++G V+D++ +DV+QPLL+  SAI  A+E V ++LKIDDIV  +R
Sbjct:   16 ASGRERNFKDKDKPESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEAEKILDEMSSPVDLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSENDSNVNLKMIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVIITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIVMAVR 540          
BLAST of SMED30015115 vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 309/525 (58.86%), Postives = 403/525 (76.76%), Query Frame = -2
Query:   43 AVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHS-VNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEI-SAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1611
            A   +  F DK K  +VR+SNI AAKAVAD VRTSLGPRGMDKMIQ   GDVT+TNDGATIL +M ++HP A+M+V+LS++QDIEAGDGTT+VVV+AG+LL A   LL KGIHPT ISE+FQ AA  A ++L   S  +D+SN  +L K+A+TSLNSKVV Q+S +LAP+AV+AV + I+  + S VNL  IKI  K G TVE++ L++G +ID+         R+EKAKI LI+F ISPPKT+M++ V++++Y+QMDR + EER+Y+L I K IK++GCNVLLIQKSILRDA+ +LALHF +K+ IM IKDIER D+E Y + L C+P+AS+DHFN D    ADLVEEI + G  +++KV+G+ NPG  VSIL+ GSN +VL EA+RS+HDALCVIRCLVKK AL+ GGGAPE+ ++  + N +    G  QYC RA+ADALE+IPYTLAEN+GLSPI TVTELRN HA G  + G+N+++G V+D++ +DV+QPLL+  SAI  A+E V ++LKIDDIV  +R
Sbjct:   16 ASGRERNFKDKDKPESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEAEKILDEMSSPVDLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSENDSNVNLKMIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVIITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIVMAVR 540          
BLAST of SMED30015115 vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 348.977 bits (894), Expect = 1.227e-113
Identity = 199/520 (38.27%), Postives = 303/520 (58.27%), Query Frame = -2
Query:   58 VNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHAR-GEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1608
            V  + E   +  G     S+I AA+AVA+T+RTSLGPRG+DKM+    GDVT+TNDGATI+++M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    KL+D+GIHP  I++ F  A + A E L + S +  + NRE L++ A TSL SK+V +     A IAVDAVL   D  S  VN   IK+  K GG +EDT+LV G++ID+ +      K ++ AK+A++     PPK    H + ++       +   ER+    + + +K SG  + + Q         D A H     ++  ++ +   ++EL   A N + +      + +    A LV EI+ G +  R++ +    N    V+I + G N M++ EA+R+LHDALCVIR LV+   ++ GGG+ E+A +  +A  + ++ G+ QY  RA+ADALE IP  LAENSGL+PI  +++L+ +    G+ + GI+      +D+    V++ LL     I+LAT+ V  +LKIDD+
Sbjct:   19 VMREQENQKRITGVEAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDSISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKDVNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQW-----GFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPN-NKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDV 532          
BLAST of SMED30015115 vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 348.977 bits (894), Expect = 1.227e-113
Identity = 199/520 (38.27%), Postives = 303/520 (58.27%), Query Frame = -2
Query:   58 VNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHAR-GEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1608
            V  + E   +  G     S+I AA+AVA+T+RTSLGPRG+DKM+    GDVT+TNDGATI+++M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    KL+D+GIHP  I++ F  A + A E L + S +  + NRE L++ A TSL SK+V +     A IAVDAVL   D  S  VN   IK+  K GG +EDT+LV G++ID+ +      K ++ AK+A++     PPK    H + ++       +   ER+    + + +K SG  + + Q         D A H     ++  ++ +   ++EL   A N + +      + +    A LV EI+ G +  R++ +    N    V+I + G N M++ EA+R+LHDALCVIR LV+   ++ GGG+ E+A +  +A  + ++ G+ QY  RA+ADALE IP  LAENSGL+PI  +++L+ +    G+ + GI+      +D+    V++ LL     I+LAT+ V  +LKIDD+
Sbjct:   19 VMREQENQKRITGVEAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDSISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKDVNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQW-----GFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPN-NKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDV 532          
BLAST of SMED30015115 vs. Ensembl Celegans
Match: cct-2 (T-complex protein 1 subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P47207])

HSP 1 Score: 287.345 bits (734), Expect = 4.505e-90
Identity = 184/528 (34.85%), Postives = 291/528 (55.11%), Query Frame = -2
Query:   49 MLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMI----QESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHS-VVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNC 1617
            ML V    +   + +G + R S+   A A+ D V+++LGP+GMDK++     ES G + VTNDGATILK + + +PAA+++V +S +QD E GDGTTSV V+A  LL    KL+++ IHP  I   +++A  IA E LK  S E   + R+ LLKIA T+L SK++ Q+    A +AVDAVLR       S NL+ I+I  K GG++ ++ L +G ++++ +  +   +RVEKAKI +    +   K  +  S V V   +++  + + E+  +      I +  CNV      I R  I +     F+   +M I+  +   +E     L  + +++ D      F   DL+EEI  G  R+++ SG V  G   S+++ G+   +L E+ERSLHDALCV+   VK+   +AG GA EI MS  IA  + +V G     + A+  AL  +P  + +N+GL   + VT LR  HA G  N GI++++G V+D+    V++   +    ++ A E    +L++DDI+  
Sbjct:    1 MLPVQILKDNAQEERGESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGYRRALGIAQESLKKSSIESGDNIRDDLLKIARTTLGSKILSQHKEHFAQLAVDAVLR----LKGSGNLDAIQIIKKLGGSMNESYLDEGFLLEK-LPGMFQPRRVEKAKILIANTPMDTDKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVF-----INRQLIYNYPEQLFADAKVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGEDRLLRFSG-VKLGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEAQKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEVADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDIIKA 517          
BLAST of SMED30015115 vs. Ensembl Fly
Match: CCT4 (gene:FBgn0032444 transcript:FBtr0080411)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 329/527 (62.43%), Postives = 413/527 (78.37%), Query Frame = -2
Query:   52 KMLAVNNK---SEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSH-SVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1620
            K  AVN K     F DKSK + VR SNI AAKAV+D +RTSLGPRGMDKMIQ   G+V++TNDGATILK+M +LHPAA+M+V+LS++QD+ AGDGTTSVVVIAG+LL AC KLL KG+HPT IS++FQ+ +  A E+LK  S  +++ +RE L+K ASTSLNSKVV Q SS+LAPIAVDAVL+  D     SV+L +IK+    GGTVEDT LVDGL+           KR+EKAKI LI+FCIS PKT+MDH+V+VS+Y+ MDRV+ EER YILNI K IK SGCNVLL+QKSILRDA++DLA HF  K+  MV+KD+ER D+E  CK L+C+PIASLDHF  +  + ADLVEE+++GT++ VK++GI N G  VSI+  GSN +VL EA RSLHDALCV+RCLVK  A I GGGAPEI M+  +A  +  V G+  YC RA+ADALE+IP TLAEN+GL+PI TVTELRNRHA+GE NAGIN+++G ++DI A++V+QPLL++ S+ITLATET+ ++LKIDDIVN
Sbjct:    4 KAAAVNIKPTAKAFKDKSKPTDVRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSFQRCSNKAVEILKQMSTPIELDDRETLIKSASTSLNSKVVSQQSSLLAPIAVDAVLKVTDPGKETSVDLKNIKVISSLGGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHNVIVSDYAAMDRVLKEERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDVEREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGTNKFVKITGIQNMGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQTVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGAITDIFAENVVQPLLVSISSITLATETIRSILKIDDIVN 530          
BLAST of SMED30015115 vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087988)

HSP 1 Score: 323.939 bits (829), Expect = 2.955e-104
Identity = 192/507 (37.87%), Postives = 297/507 (58.58%), Query Frame = -2
Query:   58 VRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEM--DISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRH-ARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1563
            V+ ++I AA+ +A T++TSLGP+G+DK++    GDVTVTNDGATI+K M++ H  A++MVQLSQSQD E GDGTT VVV+AG+LL     L+D+GIHP  I++ F+ AA+ A + L   +Q    D  N+E L++IA T+L SK+V +    +A +AVDAVL   D     VN   IKI  K GG +ED++LV G+I+D+ +      K +   K+A++     PPK    H + V+       +   E++    + K +K +G  + + Q         D A H   +  +  ++ +   ++EL   A   + +   +   P+    A LV E++ GTS  +++ +    N    V+I + G N M++ EA+RS+HDA+CV+R LVK   ++ GGGA EI+ S  +A  + Q+  L QY  RA++ ALE IP  LAENSGL PI+T++EL+ R  A  + + G++      SD+ + +V++ L      I L+T+ V  +LKIDD+
Sbjct:    4 VQLTHIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKDVNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQW-----GFDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKN-SKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDV 504          
BLAST of SMED30015115 vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087987)

HSP 1 Score: 323.939 bits (829), Expect = 6.353e-104
Identity = 193/517 (37.33%), Postives = 299/517 (57.83%), Query Frame = -2
Query:   58 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEM--DISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRH-ARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1593
            E   +  G+    ++I AA+ +A T++TSLGP+G+DK++    GDVTVTNDGATI+K M++ H  A++MVQLSQSQD E GDGTT VVV+AG+LL     L+D+GIHP  I++ F+ AA+ A + L   +Q    D  N+E L++IA T+L SK+V +    +A +AVDAVL   D     VN   IKI  K GG +ED++LV G+I+D+ +      K +   K+A++     PPK    H + V+       +   E++    + K +K +G  + + Q         D A H   +  +  ++ +   ++EL   A   + +   +   P+    A LV E++ GTS  +++ +    N    V+I + G N M++ EA+RS+HDA+CV+R LVK   ++ GGGA EI+ S  +A  + Q+  L QY  RA++ ALE IP  LAENSGL PI+T++EL+ R  A  + + G++      SD+ + +V++ L      I L+T+ V  +LKIDD+
Sbjct:   24 ERQKRITGTDAIKTHIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKDVNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQW-----GFDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKN-SKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDV 534          
BLAST of SMED30015115 vs. Ensembl Fly
Match: CCT7 (gene:FBgn0037632 transcript:FBtr0081918)

HSP 1 Score: 261.922 bits (668), Expect = 3.772e-80
Identity = 165/520 (31.73%), Postives = 280/520 (53.85%), Query Frame = -2
Query:   55 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHS----QEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDR---HVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1593
            E  D S+G     SNI A +++ D VRT+LGPRGMDK+I ++ G  T++NDGATI+K ++++HPAA+ +V +++SQD E GDGTTSVV++AG  L      +++G+HP VI +A +KA ++  E +   +    ++     R +L K A+T+++SK++ Q     + I VDAVL ++D+    + LN I I    GG++E++ LV G+   +   +       K  +  KIAL+   +       +  + V    +  +V+  E + + N    I  SG NV+L      +  I D+A  +F+  +I     +   D++   KA     + + +   P++    +  EE   G  R     G  N     ++++ G     L E ERSLHDA+ ++R  +K  +++AGGGA E+ +S+ + +YS  + G  Q  + A A  LEIIP  L +N+G      + +LR +HA+G    G+++ +  +SD     V +P +I  +A+T A E  C +L +D+ +
Sbjct:   10 EGTDSSQGKPQLVSNINACQSIVDAVRTTLGPRGMDKLIVDAHGKATISNDGATIMKLLEIIHPAAKTLVDIAKSQDAEVGDGTTSVVLLAGEFLKQVKPFVEEGVHPRVIIKAIRKALQLCMEKINEMAVQIVEQSKDQQRALLEKCAATAMSSKLIHQQKDFFSRIVVDAVL-SLDEL---LPLNMIGIKKVTGGSLEESQLVSGVAFKKTFSYAGFEMAPKSYDNCKIALLNIELELKAERDNAEIRVDNVKEYQKVVDAEWQILYNKLAKIHESGANVVLS-----KLPIGDVATQYFADRDIFCAGRVPEEDLKRTMKACGGAVMTTANDIKPNVLGLCEHFEERQVGGERFNLFQGCPN-AKTSTLILRGGAEQFLEETERSLHDAIMIVRRTIKHDSVVAGGGAIEMELSKLLRDYSRTIAGKEQLLIAAIAKGLEIIPRQLCDNAGFDATNILNKLRQKHAQGGQWYGVDINKEDISDNYEQCVWEPSIIKINALTAAAEAACMILSVDETI 519          
BLAST of SMED30015115 vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084290)

HSP 1 Score: 258.84 bits (660), Expect = 8.219e-79
Identity = 158/527 (29.98%), Postives = 289/527 (54.84%), Query Frame = -2
Query:   55 KSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNH-SQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAV--LRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASL------DHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVN--------AGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1581
            +  G++VR+ N+ AA ++++ V++SLGP G+DKM+ +  GDVTVTNDGATIL+ +++ HPAA+++V+L+Q QD E GDGTTSVV++A  LL    +L+ + IHPT I   ++ A + AC+ +  H +  +D   R+ L+ IA TS++SK++G  +   + + VDA   ++  D +   + ++  I +    G +  ++VL+ G  ++  + S    K++  AKIA ++F +   K  M   V++++  +++ + + E          I  +G NV+L+        + DL + +F +   M ++ ++++D+++  KA     I SL      + F+  M  +A  V +       ++ + G        SI++ G N     E ERS+HDALCV++ +++   ++AGGG  E A+S Y+ N++T +    Q  +  +A +L +IP TL+ N+       V +LR+ H   +           G+++  G V D     V++P +    ++  ATE    +L+IDD++
Sbjct:   14 RQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVS-----GGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKG-TKARAAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMI 534          
BLAST of SMED30015115 vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 328/520 (63.08%), Postives = 423/520 (81.35%), Query Frame = -2
Query:   52 NNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1605
            N  S + D+ K + +R SNI A KAVAD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHPAA+MMV+LS++QDIEAGDGTTSVVVIAG+LL AC+KLL KGIHPT+ISE+FQKA +   EVL + S  + +S+RE LL  ASTSL SKVV Q SS+LAP++VDAV++ ID  T+ SV+L DI +  K GGT++D  LVDG+++ + V S   V RVEKAKI LI+FC+SPPKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K +K +GC VLLIQKSILRDA++DLALHF +K+ IMVIKDIER ++E  CK +  KPIA +D F P+M   A+LVEE+S  G+ ++VK++G  +PG  VSI++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +A Y+  +GG+  YC+RAYADALE+IP TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:   13 NKGSAYVDRDKPAQIRYSNINAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVLTSISTPLLLSDRESLLNSASTSLCSKVVSQNSSLLAPMSVDAVMKVIDPATATSVDLRDINVVKKLGGTIDDCELVDGMVLTQRVAS-TGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQVKKAGCTVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREEIEFICKTIGTKPIAHIDQFTPEMLGSAELVEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEYARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGETTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDLVN 531          
BLAST of SMED30015115 vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 330.872 bits (847), Expect = 1.991e-106
Identity = 200/504 (39.68%), Postives = 296/504 (58.73%), Query Frame = -2
Query:   58 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLK--NHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA-GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1554
            S+I AAKAVA+T+RTSLGP G+DKM+ +  G+VTVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  I++ + +AA+IA E L     S  +D +N E L++ A T+L SKV+ +    +A IAV+A+L   D     V+   IK+  K GG +EDT L+ G+I+D+        K ++  KIA++     PPK    H + V+       +   E+     + + +K +G N+ + Q         D A H   +  +  I+ +   ++EL   A   + +       P+    A LV+EI  GT+  R++ +    N    V+I + G N M++ EA+R+LHDALCVIR LV+   ++ GGGA EIA +  +   + +   L QY +RA+ADALE+IP  LAENSGL+PIQT+TE+R R  +   +A GI+      +D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   36 SHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQW-----GFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGTAGLVKEICFGTTKDRMLVIEECKN-SRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENNSALGIDCLHLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of SMED30015115 vs. Ensembl Zebrafish
Match: cct3 (chaperonin containing TCP1, subunit 3 (gamma) [Source:ZFIN;Acc:ZDB-GENE-020419-5])

HSP 1 Score: 285.034 bits (728), Expect = 7.546e-89
Identity = 166/516 (32.17%), Postives = 292/516 (56.59%), Query Frame = -2
Query:   52 KSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKF----GGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNP-DMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHAR-GEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1581
            +  G  V+  NI+AAK +AD +RT LGPR M KM+ +  G + +TNDG  IL+ +++ HPAA+ M+++S++QD E GDGTTSV+++AG +L+   + L++ +HPTV+  A+++A +    +LK+ S  +D+SNR+++LKI ++++N+K + ++S++   IA+DAV R ++   +     DIK   K     GG +ED+ ++ G+++++ V      + ++  +I L++  +   K      + ++      R++  E +Y+  I + I     +++  +K      I+DLA H+  K NI  I+ I + D     +A   +  +  D     D+   A L E    G      V+   +P    +IL+ G++  +L E ER+L DA+ V R ++  P L+ GGGA E+ +S  +   S  + G+ Q+  RA A ALE++P TL +N G S I+ +T LR +H + G  + G+N + G ++D+    + +PL +       A ET   LL+IDDIV+
Sbjct:   15 RESGRKVQIGNISAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVIGAYRQALDDMLNILKDISTPVDVSNRDMMLKIINSAINTKALSRWSTLACNIALDAV-RTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLRGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEIAREEDFARILQMEEEYVQQICEDIIRLKPDLIFTEK-----GISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELTEDDVGTGAGLFEVKKIGDEYFTFVTECKDP-KACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMEVSHRLTERSRAMTGVEQWPYRAVAQALEVVPRTLIQNCGASAIRVLTSLRAKHTQEGNSSWGVNGETGTLADMEQLGIWEPLAVKAQTYKTAVETAILLLRIDDIVS 523          
BLAST of SMED30015115 vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 275.018 bits (702), Expect = 7.014e-85
Identity = 173/532 (32.52%), Postives = 293/532 (55.08%), Query Frame = -2
Query:   55 SEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVL-KNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDA--VLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALN---CKPIASLDH---FNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--------GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1596
            S    ++ G +VRS N+ AA ++A+ V++SLGP G+DKM+ +  GDVT+TNDGATILK +++ HPAA+++ +L++ QD E GDGTTSVV+IA  LL +  +L+ + IHPT I   ++ A + A   + +N +   D   RE LL  A TS++SK++G  +   A + VDA   ++ +D K      +N + +    G + +++ LV+G  ++  V S   VKRV  AKIA ++F +   K  +   VV+++  ++D++   E        + I +SG NV+L         I D+ L +F  +  M ++ + + D++   KA     C  +++L+    F P M  +A+ V +       ++ +          SI++ G+N  +  E ERSLHDALCV++ +++  +++ GGGA E A+S Y+ NY+T +G   Q  +  +A +L +IP TLA N+       V +LR  H   +VN         G+++  G   D     V +P ++   ++  ATE    +L+IDD++
Sbjct:    7 SVLGQRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTT-----GGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKN-TKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 532          
BLAST of SMED30015115 vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 275.018 bits (702), Expect = 7.779e-85
Identity = 173/532 (32.52%), Postives = 293/532 (55.08%), Query Frame = -2
Query:   55 SEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVL-KNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDA--VLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALN---CKPIASLDH---FNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--------GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1596
            S    ++ G +VRS N+ AA ++A+ V++SLGP G+DKM+ +  GDVT+TNDGATILK +++ HPAA+++ +L++ QD E GDGTTSVV+IA  LL +  +L+ + IHPT I   ++ A + A   + +N +   D   RE LL  A TS++SK++G  +   A + VDA   ++ +D K      +N + +    G + +++ LV+G  ++  V S   VKRV  AKIA ++F +   K  +   VV+++  ++D++   E        + I +SG NV+L         I D+ L +F  +  M ++ + + D++   KA     C  +++L+    F P M  +A+ V +       ++ +          SI++ G+N  +  E ERSLHDALCV++ +++  +++ GGGA E A+S Y+ NY+T +G   Q  +  +A +L +IP TLA N+       V +LR  H   +VN         G+++  G   D     V +P ++   ++  ATE    +L+IDD++
Sbjct:    9 SVLGQRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTT-----GGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKN-TKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of SMED30015115 vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 328/522 (62.84%), Postives = 428/522 (81.99%), Query Frame = -2
Query:   52 AVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1611
            ++ NK  + D+ K + +R SNI+A KAVAD VRTSLGP+GMDKMIQ+ KGDVT+TNDGATILK M++LHPAA+M+V+LS++QDIEAGDGTTSVVVIAG+LL AC+KLL KGIHPT ISE+FQ A++   EVL N SQ +++S+RE LL  A+TSLNSKVV QYSS+LAP++VDAV++ ID +T++SV+L DIKI  K GGT++D  +VDGL++ +   +   V RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KP+A +D F  DM A A+L EE+S  G+ ++VK++G  NPG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI +S  +  Y+  + G+  YC+RA+ADALEIIP+TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ S++TLATETV ++LKIDD+VN
Sbjct:    6 SIWNKGAYQDRDKPAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVN 526          
BLAST of SMED30015115 vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 328/522 (62.84%), Postives = 426/522 (81.61%), Query Frame = -2
Query:   52 AVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1611
            A   K  + D+ K + +R SNI+A KAVAD VRTSLGP+GMDKMIQ+ KGDVT+TNDGATILK M++LHPAA+M+V+LS++QDIEAGDGTTSVVVIAG+LL AC+KLL KGIHPT ISE+FQ A++   EVL N SQ +++S+RE LL  A+TSLNSKVV QYSS+LAP++VDAV++ ID +T++SV+L DIKI  K GGT++D  +VDGL++ +   +   V RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KP+A +D F  DM A A+L EE+S  G+ ++VK++G  NPG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI +S  +  Y+  + G+  YC+RA+ADALEIIP+TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ S++TLATETV ++LKIDD+VN
Sbjct:   19 AGKKKGAYQDRDKPAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVN 539          
BLAST of SMED30015115 vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 327/519 (63.01%), Postives = 426/519 (82.08%), Query Frame = -2
Query:   52 NKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1602
            +K  + D+ K + +R SNI+A KAVAD VRTSLGP+GMDKMIQ+ KGDVT+TNDGATILK M++LHPAA+M+V+LS++QDIEAGDGTTSVVVIAG+LL AC+KLL KGIHPT ISE+FQ A++   EVL N SQ +++S+RE LL  A+TSLNSKVV QYSS+LAP++VDAV++ ID +T++SV+L DIKI  K GGT++D  +VDGL++ +   +   V RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KP+A +D F  DM A A+L EE+S  G+ ++VK++G  NPG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI +S  +  Y+  + G+  YC+RA+ADALEIIP+TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ S++TLATETV ++LKIDD+VN
Sbjct:   12 DKGAYQDRDKPAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVN 529          
BLAST of SMED30015115 vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 326/515 (63.30%), Postives = 424/515 (82.33%), Query Frame = -2
Query:   52 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1590
            + D+ K + +R SNI+A KAVAD VRTSLGP+GMDKMIQ+ KGDVT+TNDGATILK M++LHPAA+M+V+LS++QDIEAGDGTTSVVVIAG+LL AC+KLL KGIHPT ISE+FQ A++   EVL N SQ +++S+RE LL  A+TSLNSKVV QYSS+LAP++VDAV++ ID +T++SV+L DIKI  K GGT++D  +VDGL++ +   +   V RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KP+A +D F  DM A A+L EE+S  G+ ++VK++G  NPG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI +S  +  Y+  + G+  YC+RA+ADALEIIP+TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ S++TLATETV ++LKIDD+VN
Sbjct:   22 YQDRDKPAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVN 535          
BLAST of SMED30015115 vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 326/515 (63.30%), Postives = 424/515 (82.33%), Query Frame = -2
Query:   52 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1590
            + D+ K + +R SNI+A KAVAD VRTSLGP+GMDKMIQ+ KGDVT+TNDGATILK M++LHPAA+M+V+LS++QDIEAGDGTTSVVVIAG+LL AC+KLL KGIHPT ISE+FQ A++   EVL N SQ +++S+RE LL  A+TSLNSKVV QYSS+LAP++VDAV++ ID +T++SV+L DIKI  K GGT++D  +VDGL++ +   +   V RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KP+A +D F  DM A A+L EE+S  G+ ++VK++G  NPG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI +S  +  Y+  + G+  YC+RA+ADALEIIP+TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ S++TLATETV ++LKIDD+VN
Sbjct:   27 YQDRDKPAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVN 540          
BLAST of SMED30015115 vs. Ensembl Mouse
Match: Cct4 (chaperonin containing Tcp1, subunit 4 (delta) [Source:MGI Symbol;Acc:MGI:104689])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 321/532 (60.34%), Postives = 427/532 (80.26%), Query Frame = -2
Query:   52 SRNCTPNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1641
            SR+  P        KS + D+ K + +R SNI+AAKAVAD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHPAA+M+V+LS++QDIEAGDGTTSVV+IAGSLL +C+KLL KGIHPT+ISE+FQKA E   E+L + S+ + +S+RE LL  A+TSLNSKVV QYSS+L+P++V+AV++ ID  T+ SV+L DIKI  K GGT++D  LV+GL++ + V +   + RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KD+ER D+E  CK +  KP+A +D F  DM   A+L EE+S  G+ ++ K++G  +PG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RA+ADA+E+IP TLAEN+GL+PI TVTELRNRHA+GE   GIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:    7 SRSGAPTAGPGSRGKSAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVN 537          
BLAST of SMED30015115 vs. Ensembl Mouse
Match: Cct4 (chaperonin containing Tcp1, subunit 4 (delta) [Source:MGI Symbol;Acc:MGI:104689])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 298/532 (56.02%), Postives = 398/532 (74.81%), Query Frame = -2
Query:   52 SRNCTPNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1641
            SR+  P        KS + D+ K + +R SNI+AAKAVAD +RTSLGP+GMDKM                              +V+LS++QDIEAGDGTTSVV+IAGSLL +C+KLL KGIHPT+ISE+FQKA E   E+L + S+ + +S+RE LL  A+TSLNSKVV QYSS+L+P++V+AV++ ID  T+ SV+L DIKI  K GGT++D  LV+GL++ + V +   + RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KD+ER D+E  CK +  KP+A +D F  DM   A+L EE+S  G+ ++ K++G  +PG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RA+ADA+E+IP TLAEN+GL+PI TVTELRNRHA+GE   GIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:    7 SRSGAPTAGPGSRGKSAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKM------------------------------LVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVN 507          
BLAST of SMED30015115 vs. Ensembl Mouse
Match: Cct5 (chaperonin containing Tcp1, subunit 5 (epsilon) [Source:MGI Symbol;Acc:MGI:107185])

HSP 1 Score: 332.028 bits (850), Expect = 7.597e-107
Identity = 200/505 (39.60%), Postives = 299/505 (59.21%), Query Frame = -2
Query:   58 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQE--MDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1554
            S+I AAKAVA+T+RTSLGP G+DKM+ +  GDVT+TNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  I++ +++AA IA + L   S +  +DI+N E L++ A T+L SKV+      +A IAV+AVL   D     V+   IK+  K GG +EDT L+ G+I+D+        K+V  AKIA++     PPK    H + V        +   E++    + K IK +G N+ + Q         D A H   +  +  ++ +   ++EL   A   + +        +    A +V+EIS GT+  +++ +    N    V+I + G N M++ EA+RSLHDALCVIR L++   ++ GGGA EI+ +  ++  + +   L QY +RA+ADALE+IP  L+ENSG++PIQT+TE+R R  + E N   GI+      +D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   36 SHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVVDAKIAILTCPFEPPKPKTKHKLDVMSVEDYKALQKYEKEKFEEMIKQIKETGANLAICQW-----GFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKN-SRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-ESNPALGIDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDI 533          
BLAST of SMED30015115 vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 276.174 bits (705), Expect = 2.423e-85
Identity = 163/521 (31.29%), Postives = 289/521 (55.47%), Query Frame = -2
Query:   52 SEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKF----GGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNP-DMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA-GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1596
            S+   +  G  V+S NI AAK +AD +RT LGP+ M KM+ +  G + +TNDG  IL+ +++ HPAA+ M+++S++QD E GDGTTSV+++AG +L+     L++ +HPTV+  A++ A +     LK  S  +D++NRE++L I ++S+ +KV+ ++SS+   IA+DAV + +    +     DIK   +     GG +ED+ ++ G++I++ V      + ++  +I L++  +   K      + ++      R++  E +YI  + + I     +V++ +K      I+DLA H+  + N+  I+ + + D     +A   + ++  +     D+   A L+E    G      ++   +P    +IL+ G++  +L E ER+L DA+ V R ++  P L+ GGGA E+A++  +   S  + G+ Q+  RA A ALE+IP TL +N G S I+ +T LR +H +      G+N + G + D+    + +PL +       A ET   LL+IDDIV+
Sbjct:   11 SQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAV-KTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEK-----GISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDP-KACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVS 524          
BLAST of SMED30015115 vs. Ensembl Mouse
Match: Cct7 (chaperonin containing Tcp1, subunit 7 (eta) [Source:MGI Symbol;Acc:MGI:107184])

HSP 1 Score: 266.544 bits (680), Expect = 1.195e-81
Identity = 166/526 (31.56%), Postives = 282/526 (53.61%), Query Frame = -2
Query:   43 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHS----QEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDR---HVESICNVKRVEKAKIAL--IEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1593
            E  D S+G     SNI+A + +A+ VRT+LGPRGMDK+I + +G  T++NDGATILK + ++HPAA+ +V +++SQD E GDGTTSV ++A   L      +++G+HP +I  AF+ A ++A   +K  +    ++  +  R++L K A T+L+SK++ Q     A + VDAV+  +D+    + L  I I    GG +E++ LV G+   +   +       K+ +  KIAL  +E  +   K N +  V   E  Q   ++  E   + +  + I  SG  V+L +       I D+A  +F+  ++     +   D++    A       S++   PD+     + EE   G  R    +G        +I++ G     + E ERSLHDA+ ++R  +K  +++AGGGA E+ +S+Y+ +YS  + G  Q  + AYA ALEIIP  L +N+G      + +LR RHA+G +  G+++    ++D     V +P ++  +A+T A+E  C ++ +D+ +   R
Sbjct:   11 EGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKQDKVEQRKMLEKCAMTALSSKLISQQKVFFAKMVVDAVM-MLDEL---LQLKMIGIKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELELKAEKDNAEIRVHTVEDYQA--IVDAEWNILYDKLEKIHQSGAKVILSKLP-----IGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALVPDVLGHCQVFEETQIGGERYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDETIKNPR 524          
BLAST of SMED30015115 vs. UniProt/SwissProt
Match: sp|P53451|TCPD_TAKRU (T-complex protein 1 subunit delta OS=Takifugu rubripes OX=31033 GN=cct4 PE=2 SV=1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 325/520 (62.50%), Postives = 427/520 (82.12%), Query Frame = -2
Query:   52 NNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1605
            N    + D+ K + +R SNI+AAKAVAD VRTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHP+A+M+V+LS++QDIEAGDGTTSVVVIAG+LL +C++LL +GIHPT+ISE+FQKA +   EVL   SQ + + +RE LL  A+TSL SKVV QYSS+LAP++VDAV+R ID  T+ SV+L+DIKI  K GGT++D  LV+GL++ + V +  +V RVEKAKI LI+FC+SPPKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVL IQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KPIA +DHF P+M   A+L EE+S  G+ ++VK++G  +PG  VSI++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +A YS  +GG+  YC+RAY+DALE+IP TLAEN+GL+PI TVTELRNRHA+G+  AGIN+++G +S+I+ + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:   16 NKGGAYQDRDKPAQIRYSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDIEAGDGTTSVVVIAGALLDSCNRLLQRGIHPTIISESFQKAVDKGVEVLTAMSQPVQLGDRETLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATSVDLHDIKIIKKLGGTIDDCELVEGLVLTQRVAN-SSVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYTQMDRVLREERAYILNMVKQIKKAGCNVLFIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLAEYSRTLGGMEAYCVRAYSDALEVIPSTLAENAGLNPISTVTELRNRHAQGDKMAGINVRKGGISNIMEELVVQPLLVSISALTLATETVRSILKIDDVVN 534          
BLAST of SMED30015115 vs. UniProt/SwissProt
Match: sp|Q7TPB1|TCPD_RAT (T-complex protein 1 subunit delta OS=Rattus norvegicus OX=10116 GN=Cct4 PE=1 SV=3)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 322/532 (60.53%), Postives = 427/532 (80.26%), Query Frame = -2
Query:   52 SRNCTPNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1641
            SR+  P        K  + D+ K + +R SNI+AAKAVAD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHPAA+M+V+LS++QDIEAGDGTTSVV+IAGSLL +C+KLL KGIHPT+ISE+FQKA E   E+L + S+ + +S+RE LL  A+TSLNSKVV QYSS+L+P++V+AV++ ID  T+ SV+L DIKI  K GGT++D  LV+GL++ + V +   + RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KP+A +D F PDM   A+L EE+S  G+ ++ K++G  +PG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RA+ADA+E+IP TLAEN+GL+PI TVTELRNRHA+GE   GIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:    7 SRSGPPAAGPGNRGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTPDMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVN 537          
BLAST of SMED30015115 vs. UniProt/SwissProt
Match: sp|Q2T9X2|TCPD_BOVIN (T-complex protein 1 subunit delta OS=Bos taurus OX=9913 GN=CCT4 PE=1 SV=3)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 320/519 (61.66%), Postives = 423/519 (81.50%), Query Frame = -2
Query:   52 NKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1602
             KS + D+ K + +R SNI+AAKAVAD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHPAA+M+V+LS++QDIEAGDGTTSVV+IAGSLL +C+KLL KGIHPT+ISE+FQKA E   E+L + S+  ++S+RE LL  A+TSLNSKVV QYSS+L+P++VDAV++ ID  T+ SV+L DIKI  K GGT++D  LV+GL++ + V +   + RVEKAKI LI+FC+S PKT+MD+ +VVS+Y QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KP+A +D F  DM   A+L EE+S  G+ +++K++G  +PG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RA+ADA+E+IP TLAEN+GL+PI TVTELRNRHA+GE   GIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:   23 GKSAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPEELSDRETLLNSAATSLNSKVVSQYSSLLSPMSVDAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYVQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHVDQFTADMLGSAELAEEVSLNGSGKLIKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCIRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEQVVQPLLVSVSALTLATETVRSILKIDDVVN 540          
BLAST of SMED30015115 vs. UniProt/SwissProt
Match: sp|Q9NB32|TCPD_OCHTR (T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus OX=7162 PE=2 SV=1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 324/517 (62.67%), Postives = 419/517 (81.04%), Query Frame = -2
Query:   43 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHS-VNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1590
            + DKSK + +R SNI AAKAV+D +RTSLGPRGMDKMIQ + G+VT+TNDGATILK+M ++HPAA+M+V+LS++QD+EAGDGTTSVVV+AG+LL A  KLL  GIHPT IS+AFQK +  A ++L   S  +++++RE L+K ASTSLNSKVV Q+SS LAPIAV+AVL+  +    S V+L ++KI    GGT++DT LVDGL+  +    +   KRVEKAKI LI+FCIS PKT+MDHSV+VS+Y+ MDRV+ EER YILNI K IK +GCNVLL+QKSILRDA++DLA+HF  K+ +MV+KDIE  D+E  CK LNC+PIASLDHF P+    ADLVEE+S+G+S+ VKV+GI N G  VSI++ GSN +VL EAERSLHDALCV+RCLVKK A IAGGGAPEI M+  +A ++  + G+  YC RA+A+ALE+IP TLAEN+GL+PI TVTELRNRHA+GE NAGIN+++G ++DILA++V+QPLL++ S+ITLA+ETV ++LKIDDI+N M+
Sbjct:   17 YKDKSKPADIRQSNINAAKAVSDAIRTSLGPRGMDKMIQAANGEVTITNDGATILKQMNVIHPAAKMLVELSRAQDVEAGDGTTSVVVVAGALLKAVEKLLQMGIHPTAISDAFQKCSAKAVDILTEMSTPIELTDRESLVKSASTSLNSKVVSQHSSQLAPIAVEAVLKVTEAGHESGVDLKNVKIIRSLGGTIDDTELVDGLVFTQRSCGVNGPKRVEKAKIGLIQFCISAPKTDMDHSVIVSDYAAMDRVLKEERAYILNIVKQIKKAGCNVLLVQKSILRDAVSDLAMHFLDKIKVMVVKDIEHEDIEFVCKTLNCRPIASLDHFLPEHLVNADLVEEVSSGSSKFVKVTGIQNMGQTVSIVVRGSNKLVLEEAERSLHDALCVVRCLVKKRAQIAGGGAPEIEMAIQLAAHAQTLEGVDAYCFRAFANALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGAITDILAENVVQPLLVSTSSITLASETVRSILKIDDIINTMQ 533          
BLAST of SMED30015115 vs. UniProt/SwissProt
Match: sp|P80315|TCPD_MOUSE (T-complex protein 1 subunit delta OS=Mus musculus OX=10090 GN=Cct4 PE=1 SV=3)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 321/532 (60.34%), Postives = 427/532 (80.26%), Query Frame = -2
Query:   52 SRNCTPNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1641
            SR+  P        KS + D+ K + +R SNI+AAKAVAD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHPAA+M+V+LS++QDIEAGDGTTSVV+IAGSLL +C+KLL KGIHPT+ISE+FQKA E   E+L + S+ + +S+RE LL  A+TSLNSKVV QYSS+L+P++V+AV++ ID  T+ SV+L DIKI  K GGT++D  LV+GL++ + V +   + RVEKAKI LI+FC+S PKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KD+ER D+E  CK +  KP+A +D F  DM   A+L EE+S  G+ ++ K++G  +PG  V+I++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RA+ADA+E+IP TLAEN+GL+PI TVTELRNRHA+GE   GIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+VN
Sbjct:    7 SRSGAPTAGPGSRGKSAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVN 537          
BLAST of SMED30015115 vs. TrEMBL
Match: A0A0R3SAK2 (T-complex protein 1 subunit delta OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1385 PE=3 SV=1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 354/518 (68.34%), Postives = 447/518 (86.29%), Query Frame = -2
Query:   43 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1593
            EF+D+SK  A+R SNI AAKAVAD +RTSLGPRGMDKMI E+KGDVT+TNDGATILK+MKLLHPAA+M+V+LS++QDIEAGDGTTSVV++AGSLL ACSKLL+KG+HPTVIS AFQ AA+ +CEV+   +Q +DI++RE+LLKIASTSLNSKVV QYSS+L+PIAVD+VL   D +   +VNL DI+I  K GGTVED  L+DGL++++ VES C V+RVEKAKIAL++FCISPPKT+M+++VVV++Y+QMDR++ EER+YILNI K++K SG NV+LIQKSILRDAI DLALHFFSKL IMV+KDIER+++E  CK L C P+AS+DH  P++  KADLVEEI +G S+IVK++GI N G  VS+L+ GSN +VL EA+RSLHDALCVIRCLVK+ ALIAGGGAPEI +SQ +A+ + +  GL QYCLRA+ADA+E+IPYTLAEN+GL+PIQTVTELR RH+ GEVN GIN+++G VSD++A++V+QPL + HSA+TLATETV ++LKIDD+VN +R
Sbjct:   16 EFSDRSKPQAIRESNIIAAKAVADAIRTSLGPRGMDKMILEAKGDVTITNDGATILKQMKLLHPAAKMLVELSKAQDIEAGDGTTSVVILAGSLLDACSKLLNKGLHPTVISGAFQVAAKKSCEVITAMAQPIDINDREMLLKIASTSLNSKVVSQYSSILSPIAVDSVLAVTDMEDPDAVNLKDIRIVKKLGGTVEDAQLIDGLLLNQRVESNCGVRRVEKAKIALVQFCISPPKTDMENNVVVTDYTQMDRIMKEERQYILNIVKSVKKSGANVILIQKSILRDAINDLALHFFSKLKIMVVKDIERDEIEFICKTLKCIPVASVDHLTPEVLGKADLVEEIESGGSKIVKITGIQNRGRTVSVLLRGSNKLVLEEADRSLHDALCVIRCLVKRRALIAGGGAPEIEISQKMAHMANESTGLDQYCLRAFADAMEVIPYTLAENAGLNPIQTVTELRARHSNGEVNCGINVRKGFVSDMIAENVLQPLQVTHSAVTLATETVRSILKIDDVVNAVR 533          
BLAST of SMED30015115 vs. TrEMBL
Match: A0A0R3TC91 (T-complex protein 1 subunit delta OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4678 PE=3 SV=1)

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 352/515 (68.35%), Postives = 443/515 (86.02%), Query Frame = -2
Query:   52 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1593
            EF+DKSK  A+R SNI AAKAV+D +RTSLGPRGMDKMI E+KGDVT+TNDGATILK+MKLLHPAA+M+V+LS++QDIEAGDGTTSVV++AGSLL ACSKLL+KG+HPTVISEAFQ AA+ ACEV+ + +Q +DI++RE+LLKIASTSLNSKVV QYSS+L+PIAVD+VL   D     +VNL DI+I  K GGTVED  L+DGL++ + VES C V+RVEKAKIAL++FCISPPKT+M+++VVV++Y+QMDR++ EER+YILNI K +K SG NV+LIQKSILRDA+ DLALHFF KL IMV+KDIER+++E  CK L C P+AS+DH  PD+  KADLVEE+ +G S+IVK++GI N G  VS+L+ GSN +VL EA+RSLHDALCVIRCLVK+ ALIAGGGAPEI +SQ +A+ + +  GL QYCLRA+ADA+E+IPYTLAEN+GL+PIQTVTELR RH+ GEVN GIN+++G VSD++A++V+QPL + HSA+TLATETV ++LKIDD+V+
Sbjct:   16 EFSDKSKPQAIRESNIVAAKAVSDAIRTSLGPRGMDKMILEAKGDVTITNDGATILKQMKLLHPAAKMLVELSKAQDIEAGDGTTSVVILAGSLLDACSKLLNKGLHPTVISEAFQLAAKKACEVITSMAQPIDINDREMLLKIASTSLNSKVVSQYSSILSPIAVDSVLAVTDMDDPDAVNLKDIRIVKKLGGTVEDAQLIDGLLLSQRVESGCGVRRVEKAKIALVQFCISPPKTDMENNVVVTDYTQMDRIMKEERQYILNIVKAVKKSGANVILIQKSILRDAVNDLALHFFGKLKIMVVKDIERDEIEFICKTLRCVPVASVDHLTPDVLGKADLVEEMESGGSKIVKITGIQNRGRTVSVLLRGSNKLVLEEADRSLHDALCVIRCLVKRRALIAGGGAPEIEISQKMAHMANESTGLDQYCLRAFADAMEVIPYTLAENAGLNPIQTVTELRARHSNGEVNCGINVRKGFVSDMMAENVLQPLQVTHSAVTLATETVRSILKIDDVVS 530          
BLAST of SMED30015115 vs. TrEMBL
Match: A0A068YGI4 (T-complex protein 1 subunit delta OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000909400 PE=3 SV=1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 351/524 (66.98%), Postives = 441/524 (84.16%), Query Frame = -2
Query:   43 AVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1611
            A     EF DKSK  A+R SNI AAKAVAD +RTSLGPRGMDKMI E KGDVT+TNDGATILK+MKLLHPAA+M+V+LS++QDIEAGDGTTSVVV+AGSLL A +KLL+KG+HPTVISEAFQ AA  ACE++   SQ ++++N+++LLKIASTSLNSKVV QYSS+L+PIAVD+VL   D     SV+LNDI+I  K GGTVED  L+DGL++++ VES C V RVEKAKIAL++FCISPPKT+M+++VVV++Y+QMDR++ EER+YILNI K +K SG NV+L+QKSILRDA+ DLALH+F KL IMV+KD+ER++VE  CK LNC P AS+DH  P++  KADLVEEI +G S+IVKV+GI N G  VS+L+ GSN +VL EA+RSLHDALCVIRCLVK+ ALIAGGGAPEI +SQ +A  + Q  GL QYCLRA++DA+E+IPYTLAEN+GL+PIQTVTELR RH+ GEVN GIN+++G VSD++A++V+QPL + +SA+TLATETV ++LKIDD++N +R
Sbjct:    5 APKKSQEFADKSKPQAIRDSNIVAAKAVADAIRTSLGPRGMDKMILEPKGDVTITNDGATILKQMKLLHPAAKMLVELSKAQDIEAGDGTTSVVVLAGSLLDASAKLLNKGLHPTVISEAFQLAASKACEIISAMSQPIELANKDVLLKIASTSLNSKVVSQYSSILSPIAVDSVLAVTDLNDPESVSLNDIRIVKKLGGTVEDAQLIDGLLLNQKVESGCGVHRVEKAKIALVQFCISPPKTDMENNVVVTDYTQMDRIMKEERQYILNIVKAVKKSGANVILVQKSILRDAVNDLALHYFGKLKIMVVKDVERDEVEFICKTLNCVPAASVDHLTPEVLGKADLVEEIESGGSKIVKVTGIQNKGRTVSVLLRGSNKLVLEEADRSLHDALCVIRCLVKRRALIAGGGAPEIEISQKLARLANQTTGLEQYCLRAFSDAMEVIPYTLAENAGLNPIQTVTELRARHSNGEVNCGINVRKGFVSDMMAENVLQPLQVTYSAVTLATETVRSILKIDDVINAVR 528          
BLAST of SMED30015115 vs. TrEMBL
Match: A0A0V0J9B1 (T-complex protein 1 subunit delta OS=Schistocephalus solidus OX=70667 GN=TCPD PE=3 SV=1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 353/533 (66.23%), Postives = 446/533 (83.68%), Query Frame = -2
Query:   43 RNCTPNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTS-HSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1638
            RN  P +        EF DKSK  A+R SNI AAKAVAD +RTSLGPRGMDKMI E+KGDVT+TNDGATILK+MKLLHPAA+M+V+LS++QDIEAGDGTT+VVV+AGSLL   +KLL++G+HPTVISE+FQ AA  ACEVL + S  +D++++E+LLKIASTSLNSKVV QYSS+L+PIAV++VL A+D  S  +V+LNDI+I  K GGTVED  L+ GL++++ VES C V+RVEKAKIAL +FCISPPKT+M+++VVV++YSQMDR++ EER+YILNI K +K SGCNVLL+QKSILRDA+ DLALH+F K+ +MVIKDIER +VE  CK L C P AS+DH  P++   ADLVEEI +G S+IVK+SGI N G  VS+L+ GSN +VL EA+RSLHDALCVIRCLVK+ AL+AGGGAPEI +SQ +A  +    GL QYCLRAYADA+E+IPYTLAEN+GL+PIQTVTELR+RHA GEVNAGIN+++G V+D++A++V+QPL ++HSAITLATETV ++LKIDD+++ +R
Sbjct:    7 RNDAPKR------SQEFTDKSKPQAIRDSNIVAAKAVADAIRTSLGPRGMDKMIVEAKGDVTITNDGATILKQMKLLHPAAKMLVELSKAQDIEAGDGTTTVVVLAGSLLDVSAKLLNRGLHPTVISESFQVAAAKACEVLTSMSHPIDLADKEVLLKIASTSLNSKVVSQYSSILSPIAVESVLAAVDPASPETVSLNDIRIVKKLGGTVEDAQLISGLLLNQKVESGCGVRRVEKAKIALAQFCISPPKTDMENNVVVTDYSQMDRIMKEERQYILNIVKAVKKSGCNVLLVQKSILRDAVNDLALHYFGKMKVMVIKDIEREEVEFICKTLKCVPAASVDHLTPEVLGSADLVEEIESGGSKIVKISGIHNQGRTVSVLLRGSNKLVLDEADRSLHDALCVIRCLVKRRALVAGGGAPEIEISQKLAALAATSTGLEQYCLRAYADAMEVIPYTLAENAGLNPIQTVTELRSRHANGEVNAGINVRKGFVTDMIAENVLQPLQVSHSAITLATETVRSILKIDDVISAVR 533          
BLAST of SMED30015115 vs. TrEMBL
Match: A0A564YM55 (T-complex protein 1 subunit delta OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7212 PE=3 SV=1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 351/513 (68.42%), Postives = 443/513 (86.35%), Query Frame = -2
Query:   58 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1593
            EF+D+SK  A+R SNI AAKAVAD +RTSLGPRGMDKMI E+KGDVT+TNDGATILK+MKLLHPAA+M+V+LS++QDIEAGDGTTSVV++AGSLL ACSKLL+KG+HPTVIS AFQ AA+ +CEV+   +Q +DI++RE+LLKIASTSLNSKVV QYSS+L+PIAVD+VL   D +   +VNL DI+I  K GGTVED  L+DGL++++ VES C V+RVEKAKIAL++FCISPPKT+M+++VVV++Y+QMDR++ EER+YILNI K++K SG NV+LIQKSILRDAI DLALHFFSKL IMV+KDIER+++E  CK L C P+AS+DH  P++  KADLVEEI +G S+IVK++GI N G  VS+L+ GSN +VL EA+RSLHDALCVIRCLVK+ ALIAGGGAPEI +SQ +A+ + +  GL QYCLRA+ADA+E+IPYTLAEN+GL+PIQTVTELR RH+ GEVN GIN+++G VSD++A++V+QPL + HSA+TLATETV ++LKIDD+
Sbjct:   16 EFSDRSKPQAIRESNIIAAKAVADAIRTSLGPRGMDKMILEAKGDVTITNDGATILKQMKLLHPAAKMLVELSKAQDIEAGDGTTSVVILAGSLLDACSKLLNKGLHPTVISGAFQVAAKKSCEVITAMAQPIDINDREMLLKIASTSLNSKVVSQYSSILSPIAVDSVLAVTDMEDPDAVNLKDIRIVKKLGGTVEDAQLIDGLLLNQRVESNCGVRRVEKAKIALVQFCISPPKTDMENNVVVTDYTQMDRIMKEERQYILNIVKSVKKSGANVILIQKSILRDAINDLALHFFSKLKIMVVKDIERDEIEFICKTLKCIPVASVDHLTPEVLGKADLVEEIESGGSKIVKITGIQNRGRTVSVLLRGSNKLVLEEADRSLHDALCVIRCLVKRRALIAGGGAPEIEISQKMAHMANESTGLDQYCLRAFADAMEVIPYTLAENAGLNPIQTVTELRARHSNGEVNCGINVRKGFVSDMIAENVLQPLQVTHSAVTLATETVRSILKIDDV 528          
BLAST of SMED30015115 vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 328/528 (62.12%), Postives = 427/528 (80.87%), Query Frame = -2
Query:   25 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVE--LYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV--NCMR*FFIFL 1590
            + D+ K + +R SNI+A KAVAD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHPAA+M+V+LS++QDIEAGDGTTSVVVIAG+LL AC+KLL KGIHPT ISE+FQKA +   EVL + SQ +++S+RE LL  A+TSL SKVV QYSS+LAP++VDAV+R ID  T+ SV+L DI I  K GGT++D  LVDGL++ + V +   V RVEKAKI LI+FC+SPPKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K IK +GCNVLLIQKSILRDA++DLA+HF +K+ IMV+KDIER ++E  L    +  KPIA +D F P+M   A+L EE+S  G+ ++VK++G  +PG  VSI++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +A ++  +GG+  YC+RAYADALE+IP TLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ SA+TLATETV ++LKIDD+V  N    +FI L
Sbjct:   18 YVDRDKPAQIRYSNISAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTSISQPVELSDRETLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATSVDLRDIHIVKKLGGTIDDCELVDGLVLTQRVVN-TGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLIKQIKKAGCNVLLIQKSILRDALSDLAVHFLNKMKIMVVKDIEREEIEEQLNICTIGTKPIAHIDQFTPEMLGLAELAEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEFARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDVVSSNINSEYFIAL 544          
BLAST of SMED30015115 vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 330.487 bits (846), Expect = 1.839e-106
Identity = 198/506 (39.13%), Postives = 297/506 (58.70%), Query Frame = -2
Query:   52 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLK--NHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA-GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1554
            S+I AAKAVA+T++TSLGP G+DKM+ +  G+VTVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  I++ + +AA IA E L     S  +D SN E L++ A T+L SKV+ +    +A IAV+A+L   D     V+   IK+  K GG +EDT L+ G+I+D+        K ++  KIA++     PPK    H + ++       +   E++    + + +K +G N+ + Q         D A H   +  +  ++ +   ++EL   A   + +       P+    A LV E+  GT+  R++ +    N    V+I + G N M++ EA+R+LHDALCVIR LV+   ++ GGGA EI+ +  +   + +   L QY +RA+ADALE+IP  LAENSGL+PIQT+TE+R R  +   +A GI+  R   +D+    V++ L+     I+LAT+ V  +LKIDDI N
Sbjct:   36 SHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQW-----GFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKN-SRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIRN 535          
BLAST of SMED30015115 vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 300.442 bits (768), Expect = 2.116e-95
Identity = 194/506 (38.34%), Postives = 282/506 (55.73%), Query Frame = -2
Query:   52 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLK--NHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA-GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1554
            S+I AAKAVA+T++TSLGP G+DKM+ +  G+VTVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  I++ + +AA IA E L     S  +D SN E L++ A T+L SKV+ +    +A IAV+A+L   D     V+   IK+  K GG +EDT L+ G+I+D+                   EF                 + QM +V               K +G N+ + Q         D A H   +  +  ++ +   ++EL   A   + +       P+    A LV E+  GT+  R++ +    N    V+I + G N M++ EA+R+LHDALCVIR LV+   ++ GGGA EI+ +  +   + +   L QY +RA+ADALE+IP  LAENSGL+PIQT+TE+R R  +   +A GI+  R   +D+    V++ L+     I+LAT+ V  +LKIDDI N
Sbjct:   36 SHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKVGGKLEDTQLIKGVIVDK-------------------EFS----------------HPQMPKV---------------KENGANLAICQW-----GFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKN-SRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIRN 485          
BLAST of SMED30015115 vs. Ensembl Cavefish
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:103023813])

HSP 1 Score: 282.722 bits (722), Expect = 5.294e-88
Identity = 167/516 (32.36%), Postives = 291/516 (56.40%), Query Frame = -2
Query:   52 KSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKF----GGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFN-PDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHAR-GEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1581
            +  G  V++ NI AAK +AD +RT LGPR M KM+ +  G + +TNDG  IL+ +++ HPAA+ M+++S++QD E GDGTTSV+++AG +L+   + L++ +HPTV+  A+++A +    +LK  S  +D ++R ++LKI ++++N+K + ++SS+   IA+DAV R ++   +     DIK   K     GG +ED+ ++ G+++++ V      + ++  +I L++  +   K      + ++      +++  E +YI  I + I     +++  +K      I+DLA H+  K NI  I+ I + D     +A   +  +  D     D+   A L E    G      V+   +P    +IL+ G++  +L E ER+L DA+ V R ++  P L+ GGGA E+A+S  +   S  + G+ Q+  RA A ALE+IP TL +N G S I+ +T LR +H + G  + G+N + G ++D++   + +PL +       A ET   LL+IDDIV+
Sbjct:   15 RESGRKVQTGNINAAKTIADVIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVISAYRQALDDMLSMLKEISTPVDQNDRSMMLKIINSAINTKALSRWSSLACNIALDAV-RTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLKGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEITREEDFAKILQMEEEYIQLICEDIIRLKPDLIFTEK-----GISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELREEDVGTGAGLFEVKKIGDEYFTFVTECKDP-KACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMAVSHRLTERSRALTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGSTSWGVNGETGTLADMVELGIWEPLAVKAQTYKTAVETAILLLRIDDIVS 523          
BLAST of SMED30015115 vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 269.24 bits (687), Expect = 1.185e-82
Identity = 172/530 (32.45%), Postives = 289/530 (54.53%), Query Frame = -2
Query:   55 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVL-KNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVL--RAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALN---CKPIASLDH---FNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--------GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1590
               ++ G +VR+ N+ AA ++A+ V++SLGP G+DKM+ +  GDVT+TNDGATILK +++ HPAA+++ +L+  QD E GDGTTSVV+IA  LL +  +L+ + IHPT I   ++ A + A   + +N +   D   RE L+  A TS++SK++G  S   A + VDA L  + +D K      +N + +    G + +++ LV+G  ++  V S   +KRV+ AKIA ++F +   K  +   VV+S+  ++D++   E        + I +SG NV+L         I D+ L +F     M ++ +   D++   KA     C  +++L+    F   M  +A+ V +       ++ V          SI++ G+N  +  E ERSLHDALCV++ +++  +++ GGGA E A+S Y+ NY+T +G   Q  +  +A +L +IP TLA N+       V +LR  H   +VN         G+++  G   D     V +P ++   ++  ATE    +L+IDD++
Sbjct:   11 LGQRTTGESVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGADDLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMKLGVQVVISDPEKLDQIRQRESDITKERIQKILASGANVVLTT-----GGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATICPSLSNLEGEETFEATMLGQAEEVVQERVCDDELILVKN-TKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of SMED30015115 vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 323/514 (62.84%), Postives = 428/514 (83.27%), Query Frame = -2
Query:   52 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1590
            + D+ K + +RSSNI AAKA+AD +RTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++ HPAA+M+V+LS++QDIEAGDGTTSVVVIAG+LL A +KLL KGIHPT+ISE+FQKA E A E+L++ S  +++S+R+ LL  A+T+LNSKVV QY+S+LAP++VDAV++ ID  T+ SV+LNDIK+  K GGT++D  LV+GL++ + + S   + RVEKAKI LI+FC+SPPKT+M++ +V+S+Y+QMDRV+ EER Y LN+ K +K +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER D+E  CK +  KPIAS+DHF  +M A A+LVEE+S G+S++VKV+G  NPG  +SIL+ GSN +VL EAERSLHDALCVIRCLVKK ALIAGGGAPEI +S  +  Y+  +  +  YC+RAY +A+E+IPYTLAEN+GL+PI TVTELRNRHA+GE  AGIN+++G +S+IL + V+QPLL++ SA++L+TETV ++LKIDDIVN
Sbjct:   31 YQDREKPAMIRSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILESMSLPLELSDRQSLLNSATTALNSKVVSQYASLLAPMSVDAVMKVIDPATATSVDLNDIKLIRKLGGTIDDCELVEGLVLTQRI-SNTGIIRVEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIASVDHFTAEMLASAELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDIVN 543          
BLAST of SMED30015115 vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 322.783 bits (826), Expect = 4.914e-104
Identity = 193/505 (38.22%), Postives = 295/505 (58.42%), Query Frame = -2
Query:   58 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKN--HSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSR--IVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRH-ARGEVNAGIN-MKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1554
            S+I AAK+VA T+RTSLGP+G+DKM+    GD+TVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD+GIHP  IS+ +++AA +A   L +   S  +D +N E L+  A T+L SK+V +   ++A IAV+AVL   D     V+   IK+  K GG ++DT L+ G+++D+        K V  AKIA++     PPK    H + V+       ++  E++    + + +K +G N+ + Q         D A H   +  +  ++ +  +++EL   A   + +        D    A +V E+S GT++  ++ +    N    V+I + G N M++ EA+RS+HDALCVIR LV+   ++ GGG+ EI+ S  ++  + +   L QY +RA+ADALE+IP  LAENSGL+ I  + E+R+R  A  +   GIN M+     D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   36 SHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLERKDVDFELIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKTKHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQW-----GFDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADKLGHAGIVRELSFGTTKDHMLVIEQCHN-SRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVRSRQLAEKKPYLGINCMQSSSKGDMKEQHVIETLIGKKQQISLATQMVKMILKIDDI 534          
BLAST of SMED30015115 vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 228.794 bits (582), Expect = 4.410e-69
Identity = 149/455 (32.75%), Postives = 238/455 (52.31%), Query Frame = -2
Query:  250 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHS----QEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDR---HVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGL 1593
            E  D S+G     SNI A   VAD VRT+LGPRGMDK+I + +G  T++NDGATILK ++++HPA + +V +++SQD E GDGTTSV ++A  LL    + +++G+HP +I+ AF+KA  +A E +K  S    +E     R +L+K A+T+L+SK+V Q     A + VDAV          + LN I +    GG +ED+ LV G+   +   +       K   + KIAL+   +       +  V V+       ++  E   + +    I++SG  V+L +       I D+A  +F+  ++     +   D++    A       S+     D+  + +L EE+  G  R     G        +I++ G     + E ERSLHDA+ ++R  +K  +++ GGGA E+ +S+Y+ + S  + G  Q  L AYA ALE+ P  L +N+G 
Sbjct:   10 EGTDTSQGIPQLLSNITACLVVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIKEISVPVKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVDAV----SMLDELMPLNMIGMKKVQGGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVELELKAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKLP-----IGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDDVLGRCELFEEVQIGGDRYNFFKGCPQ-AKTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAGF 454          
BLAST of SMED30015115 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 1.034e-52
Identity = 120/391 (30.69%), Postives = 212/391 (54.22%), Query Frame = -2
Query:  469 PNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKN-HSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVL--RAIDKTSHSVNL-NDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIA-SLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVL 1626
            P  +L+ N K E      G  V+  NI+AAK +AD +RT LGPR M KM+ +  G + +TNDG  IL+ +++ HPAA+ M+++S++QD E GDGTTSV+++AG +L    + L++ +HPTVI  A++KA E     LK+  S  +D+++R ++L+I  +++++K + + S +   IA+DAVL  +  D     +++ N  KI    GG +E++ ++ G+++++ V      +R+E  +I L++  +   K      + +S      +++  E  YI  I   I     ++L  +K      I+DLA HF  K NI  I+ I + D     +A   + ++ + D    D+   A L E    G      ++   +P    +IL+ G++  +L
Sbjct:    8 PVLVLSQNTKRE-----SGRKVQQGNISAAKMIADVIRTCLGPRAMMKMLMDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDISSVAVDVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDNGRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKDVTHPRMRRRIETPRILLLDCSLEFKKGESQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEK-----GISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSRTSDAKEEDVGTGAGLFEVKKIGDDYFTFITECKDPKA-CTILLRGASKDIL 387          
BLAST of SMED30015115 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.79 bits (312), Expect = 3.552e-33
Identity = 81/208 (38.94%), Postives = 124/208 (59.62%), Query Frame = -2
Query:  985 DKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMI--QESKGD--VTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLK----NHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDG 1584
            D+ K    R S+   A  + D V+++LGP+GMDK++    S G+  VTVTNDGATILK + + +PAA+++V +S+ QD E GDGTTSV V+A  LL     L+ K IHP  I   ++K+   A + L+    +H  + +  + + LL I+ T+L+SK++  +    A +AV+AVLR   K +    L  I +  K GGT+ D+ L +G
Sbjct:   15 DEEKAETARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALELAAVDHGHDKEKFHVD-LLNISRTTLSSKLLTHHKDHFAKLAVEAVLRLRGKGT----LEAIHVIKKLGGTLLDSYLDEG 217          
BLAST of SMED30015115 vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 274/520 (52.69%), Postives = 398/520 (76.54%), Query Frame = -2
Query:   58 VNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRH-VESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPG--PIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1608
            V + + F +K K   VR +NI AA++VAD +RTSLGP+GMDKMI+ S+G++ ++NDG TILK+M +LHP A+M+V++S +QD EAGDGTTSVV++ G+LL A  +LL+KGIHPT+I+++FQ AA+ + ++L     ++ +S+RE L++ ASTSL+SK+V QYSS LAP+AVD+VL+  D+ S +V+LNDI++  K GGT++DT ++DG+++ +  ++S     R EKAKI LI+F ISPPK + +++++V++Y QMD+++ EER Y+LNI K IK + CNVLLIQKSILRDA+ DLALHF SKLNIMV+KDIER ++E   K L CKPIA ++ F  D    ADLVEEI +  S+IV+V+GI N    P VS+++ G+N+M++ E ERSLHDALCVIRCLVK+  LIAGGGAPEI +S+ ++  +  + G+  +  + +A ALE+IP TLAEN+GL+ I+ VTELR++H  GE+N GI+++R   ++   + ++QP+L++ SAITLA+E V ++L+IDDI
Sbjct:    5 VPSNATFKNKEKPQEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDI 524          
BLAST of SMED30015115 vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 290.426 bits (742), Expect = 1.288e-91
Identity = 175/531 (32.96%), Postives = 300/531 (56.50%), Query Frame = -2
Query:   55 KSEFNDKSK-GSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISN----REILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHV------ESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSR----IVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEV-NAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1599
            K + N K + G   + S+I AA++VA  ++TSLGPRG+DK++    G++T+TNDGATIL +M+L +  A+++VQLS+SQD E GDGTT VVV+A +LL    +L+ KGIHP  I+  F +AA++A   L+    ++  SN    R+ LL+ A TSL SK+V +     A +AV+AV+  +DK    V+ + IK+  + GG++ D+ L++G+I+D+        + +   +  +  K+A++     PPK    H + +S   +  ++ + E+     +   +K +G +V++ Q         D A H   + ++  ++ +   ++E    + N + +      + D       + E   GT++    I++ S        V+  + GSN M++ EAER+LHD+LCV+R LVK   ++ GGGA E+ MS  ++  + +  G+ QY  R +A AL+ IP TLAENSGL PI T++ L+++  + ++ N G++      +D+    V+ P +     I LAT+    +LKID+++
Sbjct:   33 KDQGNKKRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQW-----GFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQS---KETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVI 555          
BLAST of SMED30015115 vs. Ensembl Yeast
Match: CCT3 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; capable of binding Q/N rich proteins and mediating their folding [Source:SGD;Acc:S000003551])

HSP 1 Score: 260.766 bits (665), Expect = 1.553e-80
Identity = 156/526 (29.66%), Postives = 292/526 (55.51%), Query Frame = -2
Query:   43 NDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSK-LLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLN-----DIKITMKF----GGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNP-DMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1587
             +++ G   + SNI AAKAVAD +RT LGP+ M KM+ +  G + +TNDG  IL+ + + HPAA+ M++LS++QD E GDGTT+V+++AG +L  C+  L++K IHP +I +A +KA   A EV+K  S+ +D+ N   + K+   S+ +K V  +S  +  +A+DAV         +V        DIK  ++     GG V D+ ++ G+++++ V      + +E  ++ L++  +   K     ++ + +    +R++  E + +  + + I +    +++ +K      ++DLA H+  K    V++ ++++D     +      +  ++     D+     L +    G      +     P    +I++ G +  +L+E +R+L DA+ V R ++  P+L  GGGA E+A+S  +A  + Q+ G+ Q+  +A ADA+E IP TL +N+G  PI+ +++LR +HA+G    GI+  +G + D+++  + +P +I   ++  A E+ C LL++DDIV+ +R
Sbjct:   12 QERTTGRQAQISNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIKQVSKPVDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTVRKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEK-----GVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIGDEYFSFLDNCKEP-KACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKHAQGNFTTGIDGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDIVSGVR 531          
BLAST of SMED30015115 vs. Ensembl Yeast
Match: TCP1 (Alpha subunit of chaperonin-containing T-complex; complex mediates protein folding in the cytosol; involved in actin cytoskeleton maintenance; overexpression in neurons suppresses formation of pathogenic conformations of huntingtin protein [Source:SGD;Acc:S000002620])

HSP 1 Score: 238.039 bits (606), Expect = 1.084e-71
Identity = 170/538 (31.60%), Postives = 277/538 (51.49%), Query Frame = -2
Query:   55 DKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKN-HSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMK-------FGGTVEDTVLVDGLIIDRHVESICNVKRVEKA--KIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDH------FNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHA------------RGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1584
            +K  G  +R+ N+ A  AVA+ V++SLGP G+DKM+ +  GD TVTNDGATIL  + + HPA +++V+L+Q QD E GDGTTSVV+IA  LL   ++L+   IHPT I   F+ A   A   +    S  +D   +E L+ IA TS++SK++G  S   + + VDA+L    KT +S    +IK  +K        G +  +++LV G  ++  V S    KR+     KIA ++  +   +  M   + + +  Q++++   E   +L   K I  +G  V+L  K      I DL L  F +  IM ++  ++ D+    +A     ++S+ +      F        D V +        + + G  +     SI++ G+N   L E ERSLHD+L V++  ++   ++ GGG  E A++ Y+ N++T VG   Q  +  +A AL IIP TLA N+     + V +LR+ HA            R   N G+++ RG + D +   V++P +    ++  A E   A+L+ID ++
Sbjct:   18 EKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAV--KTQNSK--GEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTK-----GIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKG-TSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMI 545          
BLAST of SMED30015115 vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 237.269 bits (604), Expect = 1.414e-71
Identity = 159/525 (30.29%), Postives = 273/525 (52.00%), Query Frame = -2
Query:   55 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDI-----SNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKF--GGTVEDTVLVDGLIIDRHVESIC---NVKRVEKAKIAL--IEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1593
            E  D S+G     SNI A  AV + ++ +LGP G D +I  S    T++NDGATILK + ++HPAA+ +V +S++QD E GDGTTSV ++AG L+      L++GI   +I + ++KA  +A E  K +   +DI     S RE+L + A T+++SK++   +     + VDAVL ++D+     +L+D  I +K   GG +E+++ ++G+   +           K+    KI    +E  +   K N +  V V        ++  E + I    + ++ +G N++L      +  I DLA  FF+  NI     +  +D+    +A+     ++     P+      L EE+  G+ R     G        ++L+ G    V+ E ERSLHDA+ +++  ++   ++AGGGA E+ +S+ + +YS  + G  Q  + A+A ALE+IP  L EN+G   I+ + +LR  H++GE   G+  +   + D  A  V +P L+  +A+  ATE    +L +D+ +
Sbjct:   15 EGTDASQGKGQIISNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVE--KINELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVL-SLDRN----DLDDKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELELKAEKDNAE--VRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLS-----KLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCALFEEMQIGSERYNLFQGCPQ-AKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSKGEKWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETI 524          
BLAST of SMED30015115 vs. Ensembl Nematostella
Match: EDO29932 (T-complex protein 1 subunit delta [Source:UniProtKB/TrEMBL;Acc:A7T288])

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 304/478 (63.60%), Postives = 401/478 (83.89%), Query Frame = -2
Query:   52 IQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTS-HSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICN-VKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1479
            IQ   GDVT+TNDGATILK+M++LHPAA+M+V+LS++QDIEAGDGTT+VVVIAGSLL A +KLL++GIHPT +SE+F+ A+  A E+L   S  + +++RE LLK A+TSLNSKVV QYS++LAPI+VDAVL+ I+ +   +V+L DI+I  K GGTVEDT LV+GL++ + +  +   + +VEKAKI L++FCISPPKT+M++ V+VS+Y+QMDRV+ EER+YIL I K IK +GCNVLLIQKSILRDA+ DLALHF SK+ I+V++DIER+++E  CK++ CKPIASLDHFNPDM A A+LVEE+S GTS++VK++G+ NPG  VS+L+ GSN +VL EA+RSLHDALCVIRCLVKK ALIAGGGAPEI ++  +A YS  +  +  YC+RA+A+ALEIIPYTLAEN+GL+PI TVTELRNRHA+GEV AGIN+++G V++IL ++V+QPLL++ SA+ LA+ETV ++LKIDDIVN
Sbjct:    7 IQGGNGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTTVVVIAGSLLNAAAKLLERGIHPTTVSESFELASRKAVEILSGMSTPLALNDRESLLKSATTSLNSKVVSQYSNLLAPISVDAVLKVINPSVVDNVDLRDIRIVKKLGGTVEDTELVEGLVLQQKISHLAGGISQVEKAKIGLLQFCISPPKTDMENQVIVSDYAQMDRVLREERQYILEICKKIKKAGCNVLLIQKSILRDAVNDLALHFLSKMKILVVRDIERDEIEFICKSIGCKPIASLDHFNPDMLASAELVEEVSVGTSKVVKITGVSNPGNTVSVLVRGSNKLVLEEADRSLHDALCVIRCLVKKRALIAGGGAPEIEVALRLAEYSQTLTSMDAYCVRAFAEALEIIPYTLAENAGLNPIATVTELRNRHAQGEVTAGINVRKGTVTNILEENVLQPLLVSTSAVQLASETVRSILKIDDIVN 484          
BLAST of SMED30015115 vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 330.102 bits (845), Expect = 1.352e-106
Identity = 198/520 (38.08%), Postives = 305/520 (58.65%), Query Frame = -2
Query:   58 NKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEM--DISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRH-ARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1602
             + E   +  G   + S+I AA+AVA  ++TSLGP+GMDKM+    G+VTVTNDGATIL  M++ H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD GIHP  I++ ++ AA+IA E + + +     D  N+E L++ A T+L SK+V +    LA IAVDAVL   D     V+   IK+  K GG ++DTVLV G+++D+ +      K V+ AKIA++     PPK    H + V+      ++   ER+    + K +K +G N+ + Q         D A H   + ++  ++ +   ++EL   A   + +        +   KA +V E+S GT+  +++ +    N    V+I + G N M++ EA+RS+HDALCV+R LV+   ++ GGGA E++ S  IA  + ++  + QY +RAYADAL+ IP  LAENSGL+PIQTV ++++R  A      G++     ++D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   26 KEQEEQKRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPVDKDNKESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLERKDVDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQW-----GFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHN-SRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 539          
BLAST of SMED30015115 vs. Ensembl Nematostella
Match: EDO27411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B6])

HSP 1 Score: 308.145 bits (788), Expect = 1.558e-98
Identity = 192/518 (37.07%), Postives = 293/518 (56.56%), Query Frame = -2
Query:   58 NKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRH-ARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1602
             + E   +  G   + S+I AA+AVA  ++TSLGP+GMDKM+    G+VTVTNDGATIL  M++ H  A++MV+LS+SQD E GDGTT VVV+AG+LL    +LLD GIHP  I++ ++ AA+IA E        MD       L +  +      V +    LA IAVDAVL   D     V+   IK+  K GG ++DTVLV G+++D+ +      K V+ AKIA++     PPK    H + V+      ++   ER+    + K +K +G N+ + Q         D A H   + ++  ++ +   ++EL   A   + +        +   KA +V E+S GT+  +++ +    N    V+I + G N M++ EA+RS+HDALCV+R LV+   ++ GGGA E++ S  IA  + ++  + QY +RAYADAL+ IP  LAENSGL+PIQTV ++++R  A      G++     ++D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   14 KEQEEQKRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALE-------HMDSIADNFPLPLGYS------VSRCHRPLAEIAVDAVLSVADLERKDVDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQW-----GFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHN-SRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKIATIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 512          
BLAST of SMED30015115 vs. Ensembl Nematostella
Match: EDO48692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF0])

HSP 1 Score: 269.626 bits (688), Expect = 2.297e-83
Identity = 165/524 (31.49%), Postives = 278/524 (53.05%), Query Frame = -2
Query:   55 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAA--------EIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDR---HVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1593
            E  D S+G     SNI A + +AD VRT+LGPRGMDK+I + +G  T++NDGATI+  + ++HPAA+ +V +++SQD E GDGTTSV ++ G  L    + +++G+HP +I ++++KAA        E+A  V KN + EM    R++L + A+T+L+SK++       A + VDAV+  +D+    + L+ I +    GG +ED++L++G+   +   +       K     KIAL+   +       +  V +        ++  E   + +    +  SG  V+L +       I D+A  +F+  ++     +   D++   KA       S++    D+  + DL EE   G  R    SG        +I+M G     + E ERSLHDA+ ++R  +K  A++AGGGA E+ +S+Y+ +YS  + G  Q  + A A A EIIP  L +N+G      + +LR +H +G    G+++ R  ++D     V +P ++  +AIT ATE  C +L +D+ +
Sbjct:   10 EGTDASQGIPQLISNIDACQFIADAVRTTLGPRGMDKLIVDGRGKATISNDGATIINLLDIVHPAAKTLVDIAKSQDAEVGDGTTSVTLLTGEFLKQVKQFVEEGVHPQIIVKSYRKAANLAIKRIKELAVHVKKNDAGEM----RQLLERCAATALSSKLIATQKEFFAKMVVDAVM-MLDEL---LPLDMIGMKKVSGGALEDSMLIEGVAFKKTFSYAGFEMQPKTYNHCKIALLNVELELKAEKENAEVRLDNVKDYQSIVDAEWDILYDKLDKVVKSGAKVVLSKLP-----IGDVATQYFADRDMFCAGRVTEEDLKRTMKACGGAIQTSVNSMTDDVLGRCDLFEEKQVGGERYNFFSG-CKQSTTCTIIMRGGAEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIEMELSKYLRDYSRTIAGKEQLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQKHFQGGQWYGVDINREDIADNFEACVWEPAVVKINAITAATEASCLILSVDETI 519          
BLAST of SMED30015115 vs. Ensembl Nematostella
Match: EDO35415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL4])

HSP 1 Score: 267.314 bits (682), Expect = 1.307e-82
Identity = 166/516 (32.17%), Postives = 284/516 (55.04%), Query Frame = -2
Query:   52 KSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNH-SQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLR-AIDKTSH-SVNL-NDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHF-NPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRH-ARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1581
            +  G  V+  N+ AAK +AD +RT LGPR M KM+ +  G + +TNDG  IL+ +++ HPAA+ M+++S++QD E GDGTTSV+++AG  ++     L++ +HPT I  A++ A +   ++LK   S  +DI NRE +LKI  +S+ +K + ++  +   IA+DAV   A+D+     +++ N  K+    GG +ED+ ++ G++I++ V      +R+E  +I L++  +   K     S+ +S  +   RV+  E ++I  +   + +   ++++ +K      I+DLA HF  K NI  I+ + + D     +A     +   +     D+   A L E    G      ++   NP    +IL+ G++  VL+E ER+L DA+ V R ++  P L+ GGGA E+A++  +   +  V G+ Q+  +A A  LE+IP TL +N G + I+T+T LR +H A G  + GI+ + G + D+    V     +       A ET   LL+IDDIV+
Sbjct:   12 RESGRKVQLGNVQAAKTIADIIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISVPVDIDNREEMLKIIRSSVGTKFINKWGDLACNIALDAVKTVALDRGDRKEIDIKNYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEK-----GISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITECNNP-KACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRAKHAAEGNTSWGIDGESGQIVDMQELGVWDTYAVKAQTFKTALETAMLLLRIDDIVS 521          
BLAST of SMED30015115 vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 325/520 (62.50%), Postives = 426/520 (81.92%), Query Frame = -2
Query:   52 NNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1605
            NN   + D+ K + +R SNI+AAKAVAD VRTSLGP+GMDKMIQ+ KGDVT+TNDGATILK+M++LHP+A+M+V+LS++QD+EAGDGTTSVV+IAG+LL ACSKLL KGIHPT+ISE+FQKA +   EVL   S+ +++S+RE LL  A+TSL SKVV QYSS+LAP++VDAV+R ID  T+  V+LN+IKI  K GGT++D  LV+GL++ + V S   V RVEKAKI LI+FC+SPPKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K +K +GCNVLLIQKSILRDA++DLALHF +K+ IMV+KDIER ++E  CK +  KPIA +DHF P+M   A+L EEIS  G+ ++VK++G  +PG  VSI++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RAY DALE+IP TLAEN+GL+PI TVTELRN+HA+G+  AGIN+++G +S+IL + V+QP+L++ SA+TLATETV ++LKIDD+VN
Sbjct:   16 NNGGTYVDRDKPAQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSRPVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVAS-TGVTRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVVN 534          
BLAST of SMED30015115 vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 305/529 (57.66%), Postives = 400/529 (75.61%), Query Frame = -2
Query:   28 NNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDK-TSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILR-DAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISA-GTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR*FFIF 1605
            NN   + D+ K + +R SNI+AAKAVAD VRTSLGP+GMDKM                              +V+LS++QD+EAGDGTTSVV+IAG+LL ACSKLL KGIHPT+ISE+FQKA +   EVL   S+ +++S+RE LL  A+TSL SKVV QYSS+LAP++VDAV+R ID  T+  V+LN+IKI  K GGT++D  LV+GL++ + V S   V RVEKAKI LI+FC+SPPKT+MD+ +VVS+Y+QMDRV+ EER YILN+ K +K +GCNVLLIQKSILR DA++DLALHF +K+ IMV+KDIER ++E  CK +  KPIA +DHF P+M   A+L EEIS  G+ ++VK++G  +PG  VSI++ GSN +V+ EAERS+HDALCVIRCLVKK ALIAGGGAPEI ++  +  YS  + G+  YC+RAY DALE+IP TLAEN+GL+PI TVTELRN+HA+G+  AGIN+++G +S+IL + V+QP+L++ SA+TLATETV ++LKIDD+V  +R  F F
Sbjct:   16 NNGGTYVDRDKPAQIRFSNISAAKAVADAVRTSLGPKGMDKM------------------------------LVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSRPVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVAS-TGVTRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRYDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVVR-LRTGFPF 512          
BLAST of SMED30015115 vs. Ensembl Medaka
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:101171367])

HSP 1 Score: 311.612 bits (797), Expect = 4.626e-99
Identity = 195/504 (38.69%), Postives = 293/504 (58.13%), Query Frame = -2
Query:   58 SNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEM--DISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSR--IVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHAR-GEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1554
            S+I AAKAVA T+RTSLGP G+DKM+ +  G+VTVTNDGATIL  M + H  A++MV+LS+SQD E GDGTT VVV+AG+LL     LLD+GIHP  IS+ + +AA IA E L   ++    D +N E L++ A T+L SKV+ +    +A IAV+A+L   D     V+   IK+  K GG +EDT L+ G+I+D+        K ++  KIA++     PPK    H + V+       +   E++    + + +KS+G N+ + Q         D A H   +  +  ++ +   ++EL   A   + +       P+    A LV+E+S GT++  ++ +    N    V+I + G N M++ EA+R+LHDALCVIR L++   ++ GGGA EIA +  +   + +   L QY +R++ADALE+IP  LAENSGL+PIQT+ E+R R  +      GI+      +D+    V++ L+     I+LAT+ V  +LKIDDI
Sbjct:   36 SHIMAAKAVAGTLRTSLGPNGLDKMMVDRDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAELLLDRGIHPIRISDGYDQAARIAIEKLDKIAETFPCDPNNLEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMQRKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKELKDVKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQVKSNGANLAICQW-----GFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFSELTPEKLGTAGLVKELSFGTTKDHMLVIQECKNTRA-VTIFIRGGNKMIIEEAKRALHDALCVIRNLIRDNRVVYGGGASEIACALAVNRAADKCPSLEQYAMRSFADALEVIPMALAENSGLNPIQTMAEVRARQVKDNNPFLGIDCLHKNTNDMKQQHVIETLIAKKQQISLATQVVRMILKIDDI 533          
BLAST of SMED30015115 vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 297.36 bits (760), Expect = 9.728e-94
Identity = 174/516 (33.72%), Postives = 292/516 (56.59%), Query Frame = -2
Query:   52 KSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKF----GGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFN-PDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHAR-GEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 1581
            +  G  V++ NI+AAK +AD +RT LGPR M KM+ +  G + +TNDG  IL+ +++ HPAA+ M+++S++QD E GDGTTSV+++AG +L+     L++ +HPTVI  A+++A E   E LK  S  +D S+R ++LKI ++++N+K + ++S +   IA+DAV R ++   +     DIK   K     GG +ED+ ++ G++I++ V      + ++  +I L++  +   K      + +S+     R++  E  YI  I + I     +++  +K      I+DLA H+  K NI  I+ + + D     +A   + ++  D     D+   A L E    G      ++   +P    +IL+ G++  +L E ER+L DA+ V R ++  P L+ GGGA E+A+S+ +   S  + G+ Q+  RA A ALE+IP TL +N G S I+ +T LR +H + G V  GIN + GC++D+    + +PL +       A ET   LL+IDDIV+
Sbjct:   15 RESGRKVQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALKEVSTPVDTSDRSMMLKIVNSAINTKALFRWSDLACTIALDAV-RTVELEENGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEK-----GISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGLFEVKKIGDEYFTFITECKDP-KACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGNVGWGINGESGCLTDMSTLGIWEPLAVKAQTYKTAVETAILLLRIDDIVS 523          
BLAST of SMED30015115 vs. Ensembl Medaka
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:101175451])

HSP 1 Score: 270.781 bits (691), Expect = 3.245e-83
Identity = 173/532 (32.52%), Postives = 293/532 (55.08%), Query Frame = -2
Query:   55 FNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVL-KNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVL--RAID-KTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALN---CKPIASLDH---FNPDMFAKADLV--EEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--------GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1590
            F  +S G +VR+ N+ AA ++A+ V++SLGP G+DKM+ +  GDVT+TNDGATILK +++ HPAA+++ +L+  QD E GDGTTSVV++A  LL +  +L+ + IHPT +   ++ A + A   + +N +   D   RE L+  A TS++SK++   S   A + VDA L  + +D K      +N + +    G + E++ LV+G  ++  V S   VKR+  AKIA ++F +   K  M   V++S+  ++D++   E        + I ++G NV+L         I D+ L +F     M ++ + + D++   KA     C  +++L+    F   M  +A+ V  E I      +VK + + +     SI++ G+N  +  E ERS+HDALCV++ +++  +++ GGGA E A+S Y+ NY+T +G   Q  +  +A +L +IP TLA N+       V +LR  H   +VN         G+++  G   D     V +P ++   ++  ATE    +L+IDD++
Sbjct:   11 FGQRSTGESVRTQNVMAAASIANIVKSSLGPYGLDKMLVDDIGDVTITNDGATILKMLEVEHPAAKVLCELADLQDKEVGDGTTSVVILAAELLKSADELVKQKIHPTSVINGYRLACKEAVRYINENLTIGTDDLGRECLINAAKTSMSSKIIKVDSDFFANMVVDAALAVKFVDSKGVAKYPINSVNVLKAHGRSQEESFLVNGYALNCTVGSQGMVKRIVNAKIACLDFSLQKAKMKMGVQVIISDPEKLDQIRQRESDITKERIQKILAAGANVVLTT-----GGIDDMCLKYFVDSGAMAVRRVLKRDLKRIAKATGAIVCPSLSNLEGEETFETTMLGQAEEVVQERICDDELILVKNTKVRSSA---SIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNRQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of SMED30015115 vs. Planmine SMEST
Match: SMESG000078668.1 (SMESG000078668.1)

HSP 1 Score: 1070.84 bits (2768), Expect = 0.000e+0
Identity = 525/525 (100.00%), Postives = 525/525 (100.00%), Query Frame = -2
Query:   43 MLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 1617
            MLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR
Sbjct:    1 MLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVNCMR 525          
BLAST of SMED30015115 vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 340/534 (63.67%), Postives = 435/534 (81.46%), Query Frame = -2
Query:   55 LSSYSRNCTPNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKT-SHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1653
            +++  ++C   K    ++K EF+DKSK +A+R+SNI AAKAVAD +RTSLGP+GMDKMIQE KGDVT+TNDGATILKRMKL+HPAA+M+V+LS++QDIEAGDGTT+VVV+AGS L ACSKLL KGIHPT IS++F  AA  A E+++  S  +D+++R  LLKIASTSLNSKVV QYSSVL+PIAVDAVLR  D +  + VNL+D+ I  K GGTVEDT LVDGLIIDR VES+CNV  VE AKI  I+FCI+PPK  M+ S+VVS+Y+QMDRV+ +ERKYIL I K IK+SGCNVLL+QK++LRD+++DLALHFF+K+NIM++K I +  VE  CK + CKPIA++++FN +    A  VEE+  G SRIV V+GI +    VSIL+ GSN +VL EAERSLHDALCV+RCLVKK AL+AGGGAPEI + Q +A YS  + G  QYC RA+ADA+++IPYTLAEN+GL+PI+TVTELR+ HA G +NAGIN+K+GCV +I+ +DVMQPLL++ +A++LA ETVC++LKIDD+V
Sbjct:    1 MANQGQDCFKEKS---SSKHEFSDKSKPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVV 531          
BLAST of SMED30015115 vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 340/534 (63.67%), Postives = 435/534 (81.46%), Query Frame = -2
Query:   55 LSSYSRNCTPNKMLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKT-SHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1653
            +++  ++C   K    ++K EF+DKSK +A+R+SNI AAKAVAD +RTSLGP+GMDKMIQE KGDVT+TNDGATILKRMKL+HPAA+M+V+LS++QDIEAGDGTT+VVV+AGS L ACSKLL KGIHPT IS++F  AA  A E+++  S  +D+++R  LLKIASTSLNSKVV QYSSVL+PIAVDAVLR  D +  + VNL+D+ I  K GGTVEDT LVDGLIIDR VES+CNV  VE AKI  I+FCI+PPK  M+ S+VVS+Y+QMDRV+ +ERKYIL I K IK+SGCNVLL+QK++LRD+++DLALHFF+K+NIM++K I +  VE  CK + CKPIA++++FN +    A  VEE+  G SRIV V+GI +    VSIL+ GSN +VL EAERSLHDALCV+RCLVKK AL+AGGGAPEI + Q +A YS  + G  QYC RA+ADA+++IPYTLAEN+GL+PI+TVTELR+ HA G +NAGIN+K+GCV +I+ +DVMQPLL++ +A++LA ETVC++LKIDD+V
Sbjct:   10 MANQGQDCFKEKS---SSKHEFSDKSKPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVV 540          
BLAST of SMED30015115 vs. Planmine SMEST
Match: SMESG000012740.1 (SMESG000012740.1)

HSP 1 Score: 324.324 bits (830), Expect = 4.309e-104
Identity = 191/511 (37.38%), Postives = 294/511 (57.53%), Query Frame = -2
Query:   58 GSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDIS--NREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 1572
            G     S+I AAK V++ +RTSLGP+G+DK++     D+TVTNDG TI++ M + H  A++MV+LS+SQD E GDGTT VVV+AGSLL    +LL++GIHP  IS+ ++ AA++  E L   S +   S  N+E L++ A T+L SK+V +     A +AV A+L   D     V+   IK+  K GGT+ D++LV G+I+D+        K ++ AKIA++     PPK    H++ V      + +   E    + +   +K+SG N+++ Q         D A H   + N+  ++ +   ++EL   A   + +   +   P+    A +V E+S GT+  +++ +    N    V+  + G + M++ EA+RSLHDALCV+R LV+ P ++ GGGA EIA S  ++N + Q+ GL QY +RA+A+ALE IP  L+ENSGL  I TV EL+ R  + E N   G++ KR    D+    V++ L    + I LA +    +LKIDDI
Sbjct:   32 GIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLK-EANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 535          
BLAST of SMED30015115 vs. Planmine SMEST
Match: SMESG000079886.1 (SMESG000079886.1)

HSP 1 Score: 271.552 bits (693), Expect = 8.287e-84
Identity = 168/522 (32.18%), Postives = 285/522 (54.60%), Query Frame = -2
Query:   55 EFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISN----REILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDR---HVESICNVKRVEKAKIAL--IEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 1593
            E  D S+G     SNI A +++A+ VRT+LGPRGMDK+I + K   T++NDGATILK + ++HP A  +VQ++ SQD E GDGTTSV+++A   L      +++G+HP +I +A++KA+++A   L   S +++  N    R +L K AST+L+SK+V  Y    + + VDAV  ++D   H + L+ I I    GG+++D+ L+ G+   +   +       K   K KI+L  IE  +   K N +  + V+   +  R++  E + + +  + I  SG  ++L +       I D+A  +F+  ++     +   D++    A       ++     D   K D  EE+  G  R     G        +I++ G +   + E ERSLHDA+ ++R  +K  A++AGGGA ++ +S+Y+ +YS ++ G  Q  + A A + EIIP  L EN+G      + +LR +H++G++  G+++    V+D     V +P L+  +AIT ATE  C +L +D+ +
Sbjct:   12 EGTDTSQGIPQIMSNITAIQSIAEAVRTTLGPRGMDKLIIDEKSKATISNDGATILKLLDVIHPVAGTVVQIALSQDDEVGDGTTSVMLLASEFLKQAKPFIEEGVHPELIQKAYKKASKLALSYLNELSVKIEEGNEVERRSLLEKCASTALSSKLVATYKDFFSKLVVDAV-SSLD---HLLPLDMIGIKKVPGGSLQDSQLISGVAFKKTFSYAGFEMQPKSYVKPKISLLNIELELKSEKENAE--IRVNSVEEYQRIVDAEWQILYDKLEAIYKSGAKIVLSKL-----PIGDVATQYFADRDMFCAGRVSEEDLKRTMAACGGGIQTTVKDITEDTLGKCDSFEEVQIGGERFNIFVGCPE-AKTCTIILRGGSEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIDMEISRYLRDYSRKILGRDQLFISAMAKSFEIIPRQLCENAGFDATNILNKLRQKHSQGKIWCGVDILNEDVADNFEACVWEPALVKSNAITAATEAACMVLTLDETI 521          
The following BLAST results are available for this feature:
BLAST of SMED30015115 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT40.000e+061.94chaperonin containing TCP1 subunit 4 [Source:HGNC ... [more]
CCT40.000e+057.48chaperonin containing TCP1 subunit 4 [Source:HGNC ... [more]
CCT51.915e-11040.20chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT54.638e-11040.20chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT52.417e-10940.12chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
back to top
BLAST of SMED30015115 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-40.000e+058.86T-complex protein 1 subunit delta [Source:UniProt... [more]
cct-40.000e+058.86T-complex protein 1 subunit delta [Source:UniProt... [more]
cct-51.227e-11338.27T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-51.227e-11338.27T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-24.505e-9034.85T-complex protein 1 subunit beta [Source:UniProtK... [more]
back to top
BLAST of SMED30015115 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT40.000e+062.43gene:FBgn0032444 transcript:FBtr0080411[more]
CCT52.955e-10437.87gene:FBgn0010621 transcript:FBtr0087988[more]
CCT56.353e-10437.33gene:FBgn0010621 transcript:FBtr0087987[more]
CCT73.772e-8031.73gene:FBgn0037632 transcript:FBtr0081918[more]
CCT18.219e-7929.98gene:FBgn0003676 transcript:FBtr0084290[more]
back to top
BLAST of SMED30015115 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+063.08chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct51.991e-10639.68chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct37.546e-8932.17chaperonin containing TCP1, subunit 3 (gamma) [Sou... [more]
tcp17.014e-8532.52t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
tcp17.779e-8532.52t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
back to top
BLAST of SMED30015115 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+062.84chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+062.84chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+063.01chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+063.30chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+063.30chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of SMED30015115 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cct40.000e+060.34chaperonin containing Tcp1, subunit 4 (delta) [Sou... [more]
Cct40.000e+056.02chaperonin containing Tcp1, subunit 4 (delta) [Sou... [more]
Cct57.597e-10739.60chaperonin containing Tcp1, subunit 5 (epsilon) [S... [more]
Cct32.423e-8531.29chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct71.195e-8131.56chaperonin containing Tcp1, subunit 7 (eta) [Sourc... [more]
back to top
BLAST of SMED30015115 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53451|TCPD_TAKRU0.000e+062.50T-complex protein 1 subunit delta OS=Takifugu rubr... [more]
sp|Q7TPB1|TCPD_RAT0.000e+060.53T-complex protein 1 subunit delta OS=Rattus norveg... [more]
sp|Q2T9X2|TCPD_BOVIN0.000e+061.66T-complex protein 1 subunit delta OS=Bos taurus OX... [more]
sp|Q9NB32|TCPD_OCHTR0.000e+062.67T-complex protein 1 subunit delta OS=Ochlerotatus ... [more]
sp|P80315|TCPD_MOUSE0.000e+060.34T-complex protein 1 subunit delta OS=Mus musculus ... [more]
back to top
BLAST of SMED30015115 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SAK20.000e+068.34T-complex protein 1 subunit delta OS=Hymenolepis d... [more]
A0A0R3TC910.000e+068.35T-complex protein 1 subunit delta OS=Rodentolepis ... [more]
A0A068YGI40.000e+066.98T-complex protein 1 subunit delta OS=Echinococcus ... [more]
A0A0V0J9B10.000e+066.23T-complex protein 1 subunit delta OS=Schistocephal... [more]
A0A564YM550.000e+068.42T-complex protein 1 subunit delta OS=Hymenolepis d... [more]
back to top
BLAST of SMED30015115 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+062.12chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct51.839e-10639.13chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct52.116e-9538.34chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct35.294e-8832.36chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
tcp11.185e-8232.45t-complex 1 [Source:NCBI gene;Acc:103041096][more]
back to top
BLAST of SMED30015115 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+062.84chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct54.914e-10438.22chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct74.410e-6932.75chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
ENSPMAT00000002042.11.034e-5230.69pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
ENSPMAT00000002094.13.552e-3338.94pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
back to top
BLAST of SMED30015115 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCT40.000e+052.69Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT51.288e-9132.96Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT31.553e-8029.66Subunit of the cytosolic chaperonin Cct ring compl... [more]
TCP11.084e-7131.60Alpha subunit of chaperonin-containing T-complex; ... [more]
CCT71.414e-7130.29Subunit of the cytosolic chaperonin Cct ring compl... [more]
back to top
BLAST of SMED30015115 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO299320.000e+063.60T-complex protein 1 subunit delta [Source:UniProt... [more]
EDO495711.352e-10638.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274111.558e-9837.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486922.297e-8331.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354151.307e-8232.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30015115 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+062.50chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+057.66chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct54.626e-9938.69chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct39.728e-9433.72chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
tcp13.245e-8332.52t-complex 1 [Source:NCBI gene;Acc:101175451][more]
back to top
BLAST of SMED30015115 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078668.10.000e+0100.00SMESG000078668.1[more]
SMESG000060610.10.000e+063.67SMESG000060610.1[more]
SMESG000060610.10.000e+063.67SMESG000060610.1[more]
SMESG000012740.14.309e-10437.38SMESG000012740.1[more]
SMESG000079886.18.287e-8432.18SMESG000079886.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015115 ID=SMED30015115|Name=SMED30015115|organism=Schmidtea mediterranea sexual|type=transcript|length=1681bp
TGGGCAAATTTTTATTCCGCATTACAAAAATATAAAAAACTATCGCATAC
AATTGACAATATCATCAATCTTCAACAATGCACAGACCGTTTCGGTTGCT
AAAGTAATAGCACTGTGATTGATAAGGAGTGGTTGCATAACGTCATCAGC
CAAAATATCAGATACACATCCACGTTTCATGTTTATTCCAGCATTCACTT
CTCCTCTGGCATGTCTATTTCTTAACTCTGTTACAGTTTGAATTGGACTC
AAACCTGAATTTTCAGCTAATGTATACGGAATAATTTCCAAAGCGTCTGC
GTAAGCTCTTAGGCAATACTGCATTAGTCCACCAACTTGTGTTGAATAAT
TTGCAATATACTGAGACATTGCAATTTCTGGTGCCCCACCACCAGCAATT
AGAGCAGGTTTCTTTACTAGGCAACGAATAACACATAGTGCATCATGTAA
CGAGCGTTCAGCTTCATGTAATACCATGTGATTAGATCCAAACATTAAAA
TTGATACAATTGGGCCGGGATTAACAATTCCACTAACTTTAACAATTCTA
GATGTTCCAGCGCTTATTTCTTCCACCAAATCAGCTTTAGCAAACATGTC
TGGATTAAAATGATCTAAACTAGCAATTGGTTTACAATTTAGAGCTTTGC
AATAAAGTTCAACATCATTTCTCTCAATATCCTTAATAACCATAATATTC
AATTTCGAGAAAAAATGTAAAGCTAAATCTGTGATTGCATCTCGTAAAAT
ACTTTTCTGTATTAAAAGAACATTACAGCCAGAGCTTTTAATAGTTTTTG
CAATGTTTAAAATATATTTCCTTTCTTCACTAATAACTCGATCCATTTGG
CTATATTCTGATACGACAACACTATGATCCATATTGGTCTTTGGTGGAGA
AATACAAAATTCAATTAAAGCAATCTTAGCCTTTTCAACTCTTTTAACAT
TACAAATTGATTCAACATGTCTGTCAATAATTAATCCATCTACTAACACA
GTGTCTTCAACCGTACCACCAAATTTCATGGTTATTTTAATGTCGTTTAA
ATTAACAGAATGACTTGTTTTGTCAATAGCTCGCAAGACAGCATCAACTG
CTATTGGAGCAAGAACGCTAGAATATTGGCCTACAACTTTGGAATTCAAT
GACGTAGACGCTATCTTTAATAATATTTCTCTGTTTGAAATATCCATTTC
TTGAGAATGGTTCTTAAGAACTTCACATGCAATTTCTGCTGCTTTCTGGA
AAGCTTCCGATATAACAGTTGGGTGAATGCCTTTATCTAATAACTTTGAA
CATGCAGTAAGTAAGCTTCCAGCAATAACAACCACAGAAGTTGTACCATC
TCCTGCTTCAATATCTTGTGATTGAGATAATTGAACCATCATTTGTGCAG
CTGGGTGCAACAATTTCATTCTCTTTAAAATAGTAGCACCATCATTAGTC
ACAGTTACGTCTCCTTTACTTTCCTGAATCATTTTATCCATTCCACGAGG
ACCCAAGCTTGTTCTAACAGTATCAGCAACAGCTTTGGCTGCGGCGATAT
TACTGCTTCTAACAGCACTTCCTTTAGATTTATCATTAAACTCTGATTTG
TTGTTCACTGCTAACATTTTGTTTGGTGTACAGTTTCTAGAATATGATGA
TAATATTAAAACAACAAATCAGAGTTTAATG
back to top

protein sequence of SMED30015115-orf-1

>SMED30015115-orf-1 ID=SMED30015115-orf-1|Name=SMED30015115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=526bp
MLAVNNKSEFNDKSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQES
KGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAG
SLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILL
KIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFG
GTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSV
VVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLAL
HFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEE
ISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCL
VKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTL
AENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLIN
HSAITLATETVCALLKIDDIVNCMR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
Vocabulary: INTERPRO
TermDefinition
IPR012717Chap_CCT_delta
IPR017998Chaperone_TCP-1
IPR027413GROEL-like_equatorial_sf
IPR002423Cpn60/TCP-1
IPR027409GroEL-like_apical_dom_sf
IPR027410TCP-1-like_intermed_sf
IPR002194Chaperonin_TCP-1_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 71..89
score: 42.42
coord: 101..120
score: 50.99
coord: 49..65
score: 44.41
coord: 389..411
score: 31.09
coord: 423..435
score: 38.0
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 228..385
e-value: 1.3E-63
score: 215.4
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 222..392
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 12..202
e-value: 4.1E-54
score: 185.6
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 391..542
e-value: 2.7E-46
score: 159.7
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 30..539
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 47..539
e-value: 1.0E-146
score: 489.4
IPR012717T-complex protein 1, delta subunitTIGRFAMTIGR02342TIGR02342coord: 27..539
e-value: 9.9E-241
score: 797.7
IPR012717T-complex protein 1, delta subunitCDDcd03338TCP1_deltacoord: 28..540
e-value: 0.0
score: 821.532
NoneNo IPR availablePANTHERPTHR11353:SF26T-COMPLEX PROTEIN 1 SUBUNIT DELTAcoord: 23..539
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 23..539
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00751TCP1_2coord: 73..89
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00750TCP1_1coord: 52..64
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00995TCP1_3coord: 101..109
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 162..421