Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30015111
Length (bp)3638
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase (SMED30015111) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30015111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30015111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30015111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015111SMESG000005445.1 SmedASXL_016090SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30015111SMESG000005445.1 dd_Smed_v4_9955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015111SMESG000005445.1 dd_Smed_v4_9955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015111SMESG000005445.1 dd_Smed_v6_9955_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015111SMESG000005445.1 dd_Smed_v4_9955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30015111SMESG000005445.1 dd_Smed_v4_9955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30015111SMESG000005445.1 dd_Smed_v4_9955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 304/514 (59.14%), Postives = 379/514 (73.74%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LEN+ I LD +FR SL+ D+ +GM +L  S I  HG+LKSSNC+VDSRFVLKITD+GL++FR   E    DS   Y  KLWTAPE+L    LP  G+ KADVYSF I+ QEI  RSG FY+  +D+   +IV       + P FRP + D   +N++++ ++  CW +DP  RP F QIK  +RR N  G   ILDNLL RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG  H   IA M+LA L  +  F+I H+P  QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD  G F L  RG+V++KGKG  +TYWL G ++ 
Sbjct:  535 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPD--DSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNG-QRPYFRPSI-DRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKG 1042          

HSP 2 Score: 142.124 bits (357), Expect = 1.664e-33
Identity = 123/495 (24.85%), Postives = 230/495 (46.46%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQC-QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKK-IYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGL------QPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIE 1680
            + +AV+LP  + S      +V PA+ +A++ +   R L  +  F  S  +   S  + PL A+D+   +  ++LLGP   +  A+V R++S+ +++P+LTA   AS  S K   Y  L R   +   +      +   FNW+ ++       Y+  + D     F    + +  + +    L +  +++     G   +T      IR N RI  IC      + +I+L A    LTNG+YV+F +D+    ++        +PW   N +++     +EAF++V+ +++R+P +  Y +F  ++  +++  +  +      N   G F+D ++LY   LN+T+    +  DG  +   +    ++G+TG +++D N     D+ L  M  + +G+F     + G  K  +    R I W   K + P D P C F  D   C   P++   +  L   +  I+  +S  +  RK M + EL SM W+I W +++
Sbjct:   25 LTLAVVLPEHNLSYAWAWPRVGPAVALAVEALG--RALPVDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASH-WRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARA----ALLYLDARTDDRPHYFTIEGVFEALQGSN---LSVQHQVYAREPGGPEQATHF----IRANGRIVYICG-PLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQ-IWWTGRPIPWV--KGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 301/522 (57.66%), Postives = 382/522 (73.18%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTK 3495
            G  L+     Q+FAKTA YK N+VA+K  R+  +RIE+ R++LF++K ++D+ N H+ RF+G C DP N CI+TEYCP+GSLQD+LENE I LD +FR SL  D+ +GML+L    I  HGNLKSSNC+VD RFVLKITD+GL +FR   ++        Y  KLWTAPE+LR  + P  G    DVYSF I+ QEI  RSGVF++  +D+   +I+     + E PPFRP L  +  + +++  +++ CW EDP  RP F QI+L LR+ N     +ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD++ ++ DVYKVETIGDAYMVVSGLP RNG +H   +A M+LA L  +  F+I H+P +QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIH+S  +K  L+ FG F L  RG+V++KGKG  +TYWL G +
Sbjct:  541 GSLLTTEGQFQVFAKTAYYKGNLVAVK--RVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFR---DLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVT-RGEQPPFRPSLALQSHL-EELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGER 1055          

HSP 2 Score: 184.882 bits (468), Expect = 7.893e-47
Identity = 135/516 (26.16%), Postives = 241/516 (46.71%), Query Frame = 1
Query:  238 IKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAV-----GPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEH-GFMNSTIANLIRIREN----ARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQ------PWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGK--KC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNS 1719
            + +AV+LP  ++       +V PA+++A+  VK   +L    T       S ++L V      PL A+D+  ++   V LGP   +  A V R++++ ++VP+LTA   A     K  Y + TR   +Y  +      +     W  ++    +  Y +   D   C F    +          F+ + D +++  +H  F    +++  R+        R+  IC+ S +  R +ML A    L   +YV+F++D+    ++G Q      PW         +V A++AF++   ++++ PD+  Y +F+ ++K  +   +N+  +    N+    FHD ++LY  A+ +TL+   ++TDGE +   +WN SF G+TG + ID +G    D+SL DMD   G F VV  + G ++ LV    R ++W       P D P CGFD +   C    ++   V  L   +  + ++I      RK +++ EL S  W++ W D+E     +  RS  S
Sbjct:   35 LTVAVVLPLANTSYPWSWARVGPAVELALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPVGRFTAH-WRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQA----LMLYAYRPGDEEHCFFLVEGL----------FMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICS-SPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPW---ERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNWP--LGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGS 529          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 402.134 bits (1032), Expect = 1.734e-120
Identity = 231/526 (43.92%), Postives = 318/526 (60.46%), Query Frame = 1
Query: 1981 AIYKENIVALKHLRL----EGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXX-------XXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTE-RGNVDIKGKGIQKTYWLHGTKENIVDQLPT 3522
            AIY+ + V LK   L    + + I+     +F++  +KDL + +I   +G   D G   I+TE+C +GSL+D+L N+ +KLD +F+ SL+ D+ +GM YL      HG LKS NC+VD RFVLK+TD+G +   I   +   +     +  LWTAPE+LR P    +G    DVYSFAI+ QE++ R   F + D+           P  V   V   E+ P             + + +++ CW E    RP F +I  + +  N     +I+D++L  +EQY++NLE L+ +RT++   EK++ E LL  MLP SVA  L +G  V  E F+ VT+YFSDI GFT +SA S P++V+ LLN+LYTLFD+I   HDVYKVETIGDAYMV SGLP+RNG  H   IA MSL  LS +  FK+ H P+  ++IRIG+H+G V AGVVG+ MPRYCLFGDTVNTASRMES G P +IHVS S+   L    E    E RG  ++KGKG ++T+WL G K+  +  LP 
Sbjct:  564 AIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEM--MKDLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDYGFN--DILEMLRLSEEESSMEELLWTAPELLRAPRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPVYRPVVPPEHAP------------PECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIG-KKGFMKPLPV 1072          

HSP 2 Score: 52.373 bits (124), Expect = 7.454e-6
Identity = 40/177 (22.60%), Postives = 76/177 (42.94%), Query Frame = 1
Query:  865 RITIICAKSS----NYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMD 1383
            RI I+C  S+         ++  AH LK+T+G YV+   D     +  L   + P    +NN   +EA+ +V+T++    +   Y  F    +  ++       + D  +   G  ++++     A+N  +  N        V++   N  F+G    +  D NG G ++Y +LD +
Sbjct:  243 RIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYD---ALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAF---TEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSR-NMQFHGFNQLMRTDSNGNGISEYVILDTN 412          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 390.578 bits (1002), Expect = 2.307e-116
Identity = 222/520 (42.69%), Postives = 318/520 (61.15%), Query Frame = 1
Query: 1981 AIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNE----------CIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPP--FRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSK---RELDTFGEFILTERGNVDIKGKGIQKTYWLHGTK 3495
             +Y+ + V LK    + + I I          +++L + ++A ++G+ L  G E           +++E+C +GSLQD+L   +IKLD +F+ SL+ D+ +G+ YL      HG LKS NC+VD RFVLKITD G       +++         +++LWTAPE+LR+P L   G    DV+S AI+ QE++ RS  +       +      + V+++ +PP   RP +  ++    + I +++ CW E P LRP         + IN     +I+D++L  +EQY++NLE L+ +RT++   EK++ + LL  MLP SVA  L  G PV  E FE+VT+YFSDI GFT +SA S P++V+ LLN+LYTLFD+I   HDVYKVETIGDAYMV SGLPQRNG  H   IA MSL  LS +  F++ H P+  ++IRIG+H+G   AGVVG+ MPRYCLFGDTVNTASRMES G P +IHV+ S+    R LD+  +  L  RG  ++KGKG + T+WL G +
Sbjct:  553 GVYEGDRVWLKKFPGD-QHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCIVDGRFVLKITDHGHGRLLEAQKVLPEPPRA--EDQLWTAPELLRDPALERRGTLAGDVFSLAIIMQEVVCRSAPY------AMLELTPEEVVQRVRSPPPLCRPLVSMDQA-PVECILLMKQCWAEQPELRPSMDHTFDLFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVEL--RGRTELKGKGAEDTFWLVGRR 1060          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 370.933 bits (951), Expect = 1.790e-109
Identity = 235/537 (43.76%), Postives = 316/537 (58.85%), Query Frame = 1
Query: 1987 YKENIVALKHLR------LEGRRIEINREILFQIKSVKDLNNNHIARFIG-ICLDPGNECIITEYCPKGSLQDVLENEQIK------LDSVFRLSLMQDMCRGMLYLQST-IGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENP----PFRPRLEDERGINKD--IISIIRSCWQEDPNLRPGFAQIKLKLRRING----AGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELD-TFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPT 3522
            Y +  V LK L+       E ++IE+N+  L QI    D  N  + +F G + LD     +I EYC +GSL++VL N+ I       +D  F++S++ D+ +GM YL S+    HG LKS+NC+VDSR V+KITDFG             +S    K  LWTAPE LR   +      K DVYS+ I+ QEII R   FY       +  I      ++EN     PFRP L  E    K+  +  ++++CW+EDP  RP F +I+  L +I G      +   +D L+ R++ Y+ NLE LV +RTQ Y  E+ RA+ L + +LP+ V   L     V  E +E+VTIYFSDI GFT +   STPM+V+ +LN++Y  FD I + HDVYKVETIGDAYMV SGLP+RNG  H   IA M+L  LS +  F++ H P   + IRIG+H+G   AGVVG+KMPRYCLFGDTVNTASRMES G PL+IHVS S+   L  T  +F+   RG   +KG+G + TYWL G K+   + LPT
Sbjct:  508 YDKKRVILKDLKHNDGNFTEKQKIELNK--LLQI----DYYN--LTKFYGTVKLDTMIFGVI-EYCERGSLREVL-NDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGC------------NSILPPKKDLWTAPEHLRQANIS----QKGDVYSYGIIAQEIILRKETFYTLSCRDRNEKIF-----RVENSNGMKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFN-LPT 1012          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 538.11 bits (1385), Expect = 2.614e-170
Identity = 269/529 (50.85%), Postives = 375/529 (70.89%), Query Frame = 1
Query: 1957 STQMFAKTAIYKENIVALKHLRLEGR---RIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHD--SFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKI--ENPPFRPRL------EDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKE 3498
            +TQ++ KTAI+K  +VA+K L ++ +   R++++R  L ++K +KDL ++HI RF G C+D  + C++TEYCPKGSL+D+LENE+I+LD + + SL+ D+ +G+ +L  S I  HG LKSSNC+VDSRFVLK+TDFGL       EI+  +     +YK  LWTAPE+LR+   PP+G  K D+YSFAI+  E+++R GVF + + D+   +IV    + +  +  P RP +      E +  +N  ++S++ +CW EDP+ RP  + ++  +R +N   +  +++DNLL RMEQYANNLEGLV +RTQ+Y  EK++ E+LL+ +LP ++A  LI G  V AES++ VTIYFSDI GFT+LS++STPMQV+TLLN+LY  FD + ++  VYKVETIGDAYMVVSGLP+R    H   IA MSL+ L ++  F I H+P +QLK+RIGMH+G V AGVVG KMPRYCLFGDTVNT+SRMESNG PLKIHVS+ +   L     F L  RG+V++KGKG+Q TYWL G K+
Sbjct:  700 NTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRGYKD 1227          

HSP 2 Score: 221.861 bits (564), Expect = 1.226e-58
Identity = 158/487 (32.44%), Postives = 252/487 (51.75%), Query Frame = 1
Query:  292 KVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSY-RYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIA-------NLIRIREN-ARITIICAKSSNYVRDIMLAAHHLKL-TNGEYVYFNIDLSANQIKGLQPWYMPNDSK-KNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNY------DYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXX--XRKKMKTELESMDWKINWCDIETQEKR 1695
            KV P  D+A++ V  E  +  N + ++ Y DS  S A+GP +A++       + ++G    + LA V R S Y +  +PI+T  G    L DK+ Y ++TR++  YK +      +F T+ W  K +  +            EC      +M   +    K +E+        E    N + A       N +R   N A + I+CA S + VR+IMLAAH L + T+GEYV+ NID+S       QPW   ND+  + N  AKEA+R++ T+S R+ D   Y +F ++VKE++   YNY      DY++   N+ +  F+DAV+LY +ALN+T+       +G  + + +W  +F GITG + ID NG  ++DYSLLD+D +   F+ V  + G +  L       + W   K   P D P+CG+D  KCP   P  V +L    + I++++ + IF   R K++ EL +M WKI W +++ +E +
Sbjct:   69 KVKPLADLALERVYRE-GILPNNSVNLIYRDSKLSDAIGPNVAVEQLLRKQIDCIIGYAYGYALAPVARMSPYWKNGIPIITPIGLTMSLDDKREYQLMTRINSPYKVVSSAVSTLFNTYKW--KRHIFMFHHAKAPSVAVGECFL----LMASLQHPLRKVMEMQHNFFTFNEDHGANISKAERHNQFRNYLRASSNMANVIILCA-SPDTVREIMLAAHDLGMATSGEYVFINIDVSTGS-HAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEM---NNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV--GQLHWVGGK--PPTDLPICGYDKSKCPQGYPLHVYLLMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQ 539          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 537.339 bits (1383), Expect = 2.632e-170
Identity = 269/529 (50.85%), Postives = 375/529 (70.89%), Query Frame = 1
Query: 1957 STQMFAKTAIYKENIVALKHLRLEGR---RIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHD--SFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKI--ENPPFRPRL------EDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKE 3498
            +TQ++ KTAI+K  +VA+K L ++ +   R++++R  L ++K +KDL ++HI RF G C+D  + C++TEYCPKGSL+D+LENE+I+LD + + SL+ D+ +G+ +L  S I  HG LKSSNC+VDSRFVLK+TDFGL       EI+  +     +YK  LWTAPE+LR+   PP+G  K D+YSFAI+  E+++R GVF + + D+   +IV    + +  +  P RP +      E +  +N  ++S++ +CW EDP+ RP  + ++  +R +N   +  +++DNLL RMEQYANNLEGLV +RTQ+Y  EK++ E+LL+ +LP ++A  LI G  V AES++ VTIYFSDI GFT+LS++STPMQV+TLLN+LY  FD + ++  VYKVETIGDAYMVVSGLP+R    H   IA MSL+ L ++  F I H+P +QLK+RIGMH+G V AGVVG KMPRYCLFGDTVNT+SRMESNG PLKIHVS+ +   L     F L  RG+V++KGKG+Q TYWL G K+
Sbjct:  679 NTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRGYKD 1206          

HSP 2 Score: 217.624 bits (553), Expect = 2.329e-57
Identity = 162/517 (31.33%), Postives = 267/517 (51.64%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQCQ------LIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYK-VPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAY--------ECNFQTRPIMDIF---KTNGYKFLELSD-EIHMLTEHGFMN--STIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKL-TNGEYVYFNIDLSANQIKGLQPWYMPNDSK-KNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNY------DYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXX--XRKKMKTELESMDWKINWCDIETQEKR 1695
            I I V LP +   + +      L K  P  DVA+  V + R +    +  +++ +S  S AVGP   I+ + +   + ++G    + LA V R S +  + VP+ T      +L D+  +P+LTR+ G+YK + ++  +I   F W         ++++++   A         EC F    I ++    KT+ +     S+ E   L     ++  S ++NLI         I+CA S + VR+IMLAAH L + T+GEYV+ NID+S       QPW   ND+  + N  AKEA+R++ T+S R+ D   Y +F ++VKE++   YNY      DY++   N+ +  F+DAV+LY +ALN+T+       +G  + + +W  +F GITG + ID NG  ++DYSLLD+D +   F+ V  + G +  L       + W   K   P D P+CG+D  KCP   P  V +L    + I++++ + IF   R K++ EL +M WKI W +++ +E +
Sbjct:   28 IDIVVGLPIEEGDRGKNPFLLTLAKSKPVFDVALQDVYHLR-ILPYGSLKVTFENSALSDAVGPQKMIEHYCNKTVDAIMGLPYVYALAPVARISKFWGQGVPVFTTTALVDELGDRNEFPLLTRMMGSYKSLGKLVTRIAERFEWQH-------YFFMFNDEVARGPRNKGRSECYFSLSAIKNLIMNNKTSTWNVKMFSEFEADRLQYRALLSEASVMSNLI---------ILCA-SPDTVREIMLAAHDLGMATSGEYVFINIDVSTGS-HAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEM---NNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV--GQLHWVGGK--PPTDLPICGYDKSKCPQGYPLHVYLLMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQ 518          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 538.495 bits (1386), Expect = 4.650e-170
Identity = 269/529 (50.85%), Postives = 375/529 (70.89%), Query Frame = 1
Query: 1957 STQMFAKTAIYKENIVALKHLRLEGR---RIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHD--SFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKI--ENPPFRPRL------EDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKE 3498
            +TQ++ KTAI+K  +VA+K L ++ +   R++++R  L ++K +KDL ++HI RF G C+D  + C++TEYCPKGSL+D+LENE+I+LD + + SL+ D+ +G+ +L  S I  HG LKSSNC+VDSRFVLK+TDFGL       EI+  +     +YK  LWTAPE+LR+   PP+G  K D+YSFAI+  E+++R GVF + + D+   +IV    + +  +  P RP +      E +  +N  ++S++ +CW EDP+ RP  + ++  +R +N   +  +++DNLL RMEQYANNLEGLV +RTQ+Y  EK++ E+LL+ +LP ++A  LI G  V AES++ VTIYFSDI GFT+LS++STPMQV+TLLN+LY  FD + ++  VYKVETIGDAYMVVSGLP+R    H   IA MSL+ L ++  F I H+P +QLK+RIGMH+G V AGVVG KMPRYCLFGDTVNT+SRMESNG PLKIHVS+ +   L     F L  RG+V++KGKG+Q TYWL G K+
Sbjct:  738 NTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRGYKD 1265          

HSP 2 Score: 194.897 bits (494), Expect = 3.526e-50
Identity = 154/514 (29.96%), Postives = 262/514 (50.97%), Query Frame = 1
Query:  286 LIKVLPAIDVAIDHVKNERNL---FRNATF--SISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSS-YRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNW-------SPKSYTTVVFWY---------IWHKFDAYE-------CNFQTRPIMDIF----KTNGYKFLELSDEIHMLTEHGFMNSTIANLIR-IRENARITIICAKSSNYVRDIMLAAHHLKL-TNGEYVYFNIDLSANQIKGLQPWYMPNDSK-KNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNY------DYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCP--PITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKR 1695
            L K +P ID+A+  V   + L   + N T+  S  Y D   +     +  I  + ++  + +LG  +++ LA V + ++     +PILT  G  S L+ KK YP LTR+ G+Y+ +     ++ A  +        S  +Y  ++F+Y         +  + ++ E       C F    I   F    KT   ++   + +     +      T    +R I   + + I+CA S + VR+IMLAAH L + T+GEYV+ NID+S       QPW   ND+  + N  AKEA+R++ T+S R+ D   Y +F ++VKE++   YNY      DY++   N+ +  F+DAV+LY +ALN+T+       +G  + + +W  +F GITG + ID NG  ++DYSLLD+D +   F+ V  + G +  L       + W   K   P D P+CG+D  KCP  P+  + + + S ++I +++ + +  + R K++ EL +M WKI W +++ +E +
Sbjct:   61 LQKAMPVIDIAVQEVIKAKKLPPGWINLTYWDSRLYEDILLAERHATVGVIQAYCEHRLDAILGFADNYGLATVTKVTAGLNGGIPILTTSGMPSLLNSKKEYPFLTRMQGSYRLLADSMYQLIAYHDEDSVSKSNSSLNYLNLIFFYHDKRRAVNRVIAQDESQETGATSSHCYFSLYAIKRYFTEKSKTFKREWALNTPQFPFDEDLVIERETFKQWLREISLQSNVIILCA-SPDTVREIMLAAHDLGMATSGEYVFINIDVSTGS-HAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEM---NNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV--GQLHWVGGK--PPTDLPICGYDKSKCPGYPLHVY-LLMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQ 564          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 495.352 bits (1274), Expect = 2.417e-161
Identity = 252/525 (48.00%), Postives = 365/525 (69.52%), Query Frame = 1
Query: 1957 STQMFAKTAIYKENIVALKHLRLEGR---RIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHD--SFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKI--ENPPFRPRL------EDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPL-------KIHVSESSKRELDTFGEFILTERGNVDIKGKGI 3465
            +TQ++ KTAI+K  +VA+K L ++ +   R++++R  L ++K +KDL ++HI RF G C+D  + C++TEYCPKGSL+D+LENE+I+LD + + SL+ D+ +G+ +L  S I  HG LKSSNC+VDSRFVLK+TDFGL       EI+  +     +YK  LWTAPE+LR+   PP+G  K D+YSFAI+  E+++R GVF + + D+   +IV    + +  +  P RP +      E +  +N  ++S++ +CW EDP+ RP  + ++  +R +N   +  +++DNLL RMEQYANNLEGLV +RTQ+Y  EK++ E+LL+ +LP ++A  LI G  V AES++ VTIYFSDI GFT+LS++STPMQV+TLLN+LY  FD + ++  VYKVETIGDAYMVVSGLP+R    H   IA MSL+ L ++  F I H+P +QLK+RIGMH+G V AGVVG KMPRYCLFGDTVNT+SRMESNG  +       KI+  +  K +++   +F+  E+ +++ +GK +
Sbjct:  111 NTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLRMFWNFSLYKIYKFKVFKNKIEL--DFLKNEKESIEFEGKKM 632          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-7 (Receptor-type guanylate cyclase gcy-7 [Source:UniProtKB/Swiss-Prot;Acc:H2L002])

HSP 1 Score: 431.024 bits (1107), Expect = 1.536e-131
Identity = 226/510 (44.31%), Postives = 330/510 (64.71%), Query Frame = 1
Query: 1993 ENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNK--LWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGI--NKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIV 3507
            E +VA KH      R  ++ +    ++S+++L+ +++ RFIG+CLD      +  +C +GS+ DV+    I++D+ F  SL++DM  G+++L  S +GYHG L S  CL+D R+ +KI+++GL   R         S + Y+ K  LW+APE+LR   +   G  + DVYS  I+C E+I R GVF + D      +I+    +     P RP LE +  I  N  ++ ++R C+ E P+ RP    ++ +LR +N + + +++D++   +E YA++LE  V++RT++  EEK++++ LLY MLPK+VA +L  G+ V  E+FE+VTI+FSD+  FT L+++ TP+QV+ LLN+LYT+FD I E HDVYKVETIGD Y+ VSGLP RNG  HVR IA MSLAFLS +  F++PH P +++ +RIGM+ G V AGVVG+ MPR+CLFGD VNTASRMESNGKP KIHVS  + R L   G F    RG V IKGKG+ +T+WL G     V
Sbjct:  586 EPVVAKKH----AYRPRLDDDKCTFMRSLRNLDQDNLNRFIGLCLDGPQMLSVWRFCSRGSIADVILKATIQMDNFFIYSLIKDMVHGLVFLHGSMVGYHGMLTSKCCLIDDRWQVKISNYGLQDLR---------SPEMYEKKDLLWSAPELLRAEDIK--GSKEGDVYSLGIICAELITRKGVFNMEDRKEDPEEIIYLLKKGGLKSP-RPDLEYDHTIEINPALLHLVRDCFTERPSERPSIETVRSQLRGMNSSRNDNLMDHVFNMLESYASSLEEEVSERTKELVEEKKKSDVLLYRMLPKTVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLASKCTPLQVVNLLNDLYTIFDGIIEKHDVYKVETIGDGYLCVSGLPHRNGNEHVRQIALMSLAFLSSLQFFRVPHLPSERINLRIGMNCGSVVAGVVGLTMPRFCLFGDAVNTASRMESNGKPGKIHVSAEANRMLHLVGGFDTESRGEVIIKGKGVMETFWLTGQGTGAV 1079          

HSP 2 Score: 98.2117 bits (243), Expect = 2.111e-20
Identity = 113/438 (25.80%), Postives = 191/438 (43.61%), Query Frame = 1
Query:  304 AIDVAIDHVKNERNLFRN--ATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGP-VNDFLLANVVRYSSYRYKVPILTAQGY--ASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSS-NYVRDIMLAAHHLKLTNGEYVYFNIDLSANQI------KGLQP-WYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQ---HYTDF---IIKVKEKSKSFYNYDYKIDD---ANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNM-IWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTL---VMARDRNIDWANEKNSA-PLDTPVCGFDGKKCP 1536
            A  +A+D +K E NL       F+I + D   S A G  + +D+   +  +V++GP +N   LA  +  S+Y +  PI+ A G   A+ L D + +P    LS   + +      +   + WS       V+ Y   + D  +C      +  +    G   L  S ++  ++  G + +    L +I+   RI + C K      R  +LAA    +   EYVY   D+ +          G +P W +   S +N+  A +AF+  I +           +YT F   II   +++  F   D + ++   A +  G+ HDAV  Y +AL+K L   +          M  +  SF G++G + I++ G       LL +D+   N   + T Y +N +     +  D  + WA+ KN+A P+D P+CGF G  CP
Sbjct:   60 AASIAVDRLKRE-NLMSGWEFNFTIEFDDCVESEAAG--MTVDLIEKHNVDVIIGPTMNQPTLAAFI-VSNY-FNRPII-AWGLVNAAQLDDFERFPNAGILSAGQRSLGVAIRAVLKRYEWS-----QFVYAYFTEE-DTEKCVTMRNDLQQVVSYFGDIILAYSIQVADISNDGMIEA----LKKIQSRGRIIVTCMKDGIGLRRKWLLAAEEAGMIGDEYVYVFSDIKSKGYVVPLLGGGERPSWILSTGSDENDTRALKAFKQSIFICDMMGQGSIATNYTIFGQEIIARMKEAPYFCTKDCEGENFTVAATYAGQLHDAVYAYGVALDKMLKAGQIAQYRNATAFMRYFPQSFIGMSGNVTINEKGTRNPTLFLLALDE-NNNNTRMATIYVENMSATFNALYSDEGVMWASRKNNARPVDVPLCGFTGNLCP 480          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0346151)

HSP 1 Score: 568.155 bits (1463), Expect = 7.310e-180
Identity = 289/522 (55.36%), Postives = 365/522 (69.92%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQST-IGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGR-----EISNHDSFQFYKNKLWTAPEVLR-NPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENP-----PFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            Q+F    +++++ VA+K + ++  +  + R ++ ++K +KDL ++H+ +F G CLD     ++TEYCPKGSLQD+LENEQ +LD +FRLSLM D+ RGM +L S+ I  HGNLKSSNC+VDSRFVLKITDFGL   R  R     +  N +S  ++   LWTAPE+LR     PP G  K DVY+F I+  EI  R G FY+           +  + K  NP     PFRP LE       DI  IIR CW EDP  RP F  +K  +RR N   + G+I+DNLL RME YANNLE LV +RTQ Y+EEK++ E LLY +LP+SVA QLI G+PV AE+F++VTIYFSDI GFTA+SAESTPMQV+  LN+LYT FDSI E+ DVYKVETIGDAYMVVSGLP RNG  H R IA ++LA L  ++ F+I H+P+ +LK+RIG+HTG   AGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIH+SE++K  LD FG F+ T RG V +KGKG   TYWL G
Sbjct:  609 QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTRFDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEG 1130          

HSP 2 Score: 207.608 bits (527), Expect = 6.370e-54
Identity = 167/538 (31.04%), Postives = 273/538 (50.74%), Query Frame = 1
Query:  235 EIKIAVLLPN---DSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISY--SDSNSSLAVGPLIAIDMFND-NVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDK-KIYPMLTRLSGT-YKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSD-----EIHMLTEHGFMNSTI--ANLIRIREN----ARITIICAKSSNYVRDIMLAAHHLKLTN-GEYVYFNIDL-SANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSC-VGRFHDAVVLYCLALNKTLS-----LNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCP--PITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIETQEKRQR--RRSLNSANKKSASIPIF 1752
            ++    LLP+   D+K+ C + KVLP +++AI HV+        + F I     D+  S   GP+   +++      N + G   +++LA + RY+   ++VP+LT  G A + + K + Y  LTRL G    ++  V   I  +FNW+  +        I+   +A              K N   FL L+      E H + + GF  ST   A++ R+ +N    +RI I+CA   + +R IML A  L + + GEYV+ NI+L S  Q    QPWY  ND+  NN  A++A+ +++TV+ +QP+D  YT    ++K  +   YNY +  ++  S  V  F D V+LY  ALN+++      L R I   + V+ M WN SF GITG + ID NG   + YSLLDM+  TG F +V  F   +  L    ++ I WA ++  AP D P+CG+DG  CP   +  + +  + +  + +V+ +      R  + + E+ SM WK++  D+  ++  +R  R S +S  K+S+ + + 
Sbjct:   85 QLVFVALLPSVESDNKNDCIMPKVLPVLELAIRHVQ-RMGFVGGSHFDIQLISRDTFCSSKYGPIGFFEIYTQWPEVNAVFGLPCEYVLAPISRYADV-WQVPVLTTGGNAKEFNKKSESYSTLTRLKGAQVNNLGNVVRAILNSFNWTRTAL-------IYQNENAK------------VKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITRMLKNVAMQSRIVIMCADPQS-IRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRM-WNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFL--HNRLEFEANKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDAAERGLRGSFHSLVKQSSQLTLM 597          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0083187)

HSP 1 Score: 568.155 bits (1463), Expect = 7.310e-180
Identity = 289/522 (55.36%), Postives = 365/522 (69.92%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQST-IGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGR-----EISNHDSFQFYKNKLWTAPEVLR-NPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENP-----PFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            Q+F    +++++ VA+K + ++  +  + R ++ ++K +KDL ++H+ +F G CLD     ++TEYCPKGSLQD+LENEQ +LD +FRLSLM D+ RGM +L S+ I  HGNLKSSNC+VDSRFVLKITDFGL   R  R     +  N +S  ++   LWTAPE+LR     PP G  K DVY+F I+  EI  R G FY+           +  + K  NP     PFRP LE       DI  IIR CW EDP  RP F  +K  +RR N   + G+I+DNLL RME YANNLE LV +RTQ Y+EEK++ E LLY +LP+SVA QLI G+PV AE+F++VTIYFSDI GFTA+SAESTPMQV+  LN+LYT FDSI E+ DVYKVETIGDAYMVVSGLP RNG  H R IA ++LA L  ++ F+I H+P+ +LK+RIG+HTG   AGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIH+SE++K  LD FG F+ T RG V +KGKG   TYWL G
Sbjct:  609 QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTRFDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEG 1130          

HSP 2 Score: 207.608 bits (527), Expect = 6.370e-54
Identity = 167/538 (31.04%), Postives = 273/538 (50.74%), Query Frame = 1
Query:  235 EIKIAVLLPN---DSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISY--SDSNSSLAVGPLIAIDMFND-NVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDK-KIYPMLTRLSGT-YKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSD-----EIHMLTEHGFMNSTI--ANLIRIREN----ARITIICAKSSNYVRDIMLAAHHLKLTN-GEYVYFNIDL-SANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSC-VGRFHDAVVLYCLALNKTLS-----LNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCP--PITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIETQEKRQR--RRSLNSANKKSASIPIF 1752
            ++    LLP+   D+K+ C + KVLP +++AI HV+        + F I     D+  S   GP+   +++      N + G   +++LA + RY+   ++VP+LT  G A + + K + Y  LTRL G    ++  V   I  +FNW+  +        I+   +A              K N   FL L+      E H + + GF  ST   A++ R+ +N    +RI I+CA   + +R IML A  L + + GEYV+ NI+L S  Q    QPWY  ND+  NN  A++A+ +++TV+ +QP+D  YT    ++K  +   YNY +  ++  S  V  F D V+LY  ALN+++      L R I   + V+ M WN SF GITG + ID NG   + YSLLDM+  TG F +V  F   +  L    ++ I WA ++  AP D P+CG+DG  CP   +  + +  + +  + +V+ +      R  + + E+ SM WK++  D+  ++  +R  R S +S  K+S+ + + 
Sbjct:   85 QLVFVALLPSVESDNKNDCIMPKVLPVLELAIRHVQ-RMGFVGGSHFDIQLISRDTFCSSKYGPIGFFEIYTQWPEVNAVFGLPCEYVLAPISRYADV-WQVPVLTTGGNAKEFNKKSESYSTLTRLKGAQVNNLGNVVRAILNSFNWTRTAL-------IYQNENAK------------VKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITRMLKNVAMQSRIVIMCADPQS-IRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRM-WNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFL--HNRLEFEANKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDAAERGLRGSFHSLVKQSSQLTLM 597          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0302487)

HSP 1 Score: 531.946 bits (1369), Expect = 7.750e-168
Identity = 355/1034 (34.33%), Postives = 535/1034 (51.74%), Query Frame = 1
Query:  514 YKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLI-RIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSA-------NQIKGLQPWYMPNDSKKNNVMAKEAFRSVI---TVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYK------IDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITG-KIIIDDNGAGFADYSLL-------DMDQITGNFLVVGTFYGKNKTLV--------MARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNK----LWTAPEVLR-NPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKE 3498
            + +P+++      D S+K  +P   R       + +    +   FNW     T V F Y+      Y+   +T  I+      G    ++    + +  HGFM++    L+ +   N RI +I      +V  ++       L+ G+Y    ID+           ++GL    +  D +   V A +++  ++   +VSF       + + + K  E+    +N+         +   ++     +DAV LY  AL + L       +G  +   I  S +    G  + ID+NG    +Y++L         +Q       VGTF  +N +L         +     IDW     + P   P CGF G+KC   T  + A ++   + ++ ++S+V++   + + EL+S+ WKI++ +++  E  + ++S          +P                        +  P    P I  S                    ++L+    +    T +F    +YK  + A+K +R   + ++I RE+  ++K ++D  +++I  FIG C DP N CII+EYC +GSL+D+LENE +KLD++F  S++ D+ RG++YL  S I +HG L +SNCLVDSR+V+K+TDFGL AF+ G E S+ D  Q    K    L+ APE+LR  P+   +G  + D YSF I+  E+  R G F  + +  +     V + +   NP +RP L+        +   +R CW E P  RP F  I+ KLR +      +I DN++  ME+YANNLE LV  RT Q  EEK++ + LL+ MLP+ VA QL +G  V  E +E+V+IYFSDI GFTA+SAE TP+QV+  LN+LYT FDSI   +DVYKVETIGDAYMVVSGLP RNG +H   IA MSL  LS + +FKI H+P  +L +RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMES+G PLKIH S   ++ LD  G +   ERG + +KGKG Q+TYWL G  E
Sbjct:  134 FNLPMISYYCTHRDPSNKADFPTFARTRPPDTQISKSVVALLLAFNW-----TQVSFLYLDDASGQYQPVAET--ILSTLTDAGVSIRDIRT-WNTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGL----LLEDVEPLAVQAFQSYLGIVPTASVSFAT-----FANEVNKYMERPP--FNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSPIDWVG--GTRPAAAPRCGFGGEKCVNYTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENEREQQSQKQTRHLLNHLP-----------------------RRLPPQSTHPLIRTSQ-------------------VSLSSNPDADFRYTTIFTPIGLYKGQLYAIKKVR--KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTD-MQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGETGLTPMQCLQKVLQPQDYLNP-YRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1100          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0302488)

HSP 1 Score: 531.561 bits (1368), Expect = 1.258e-167
Identity = 355/1036 (34.27%), Postives = 535/1036 (51.64%), Query Frame = 1
Query:  514 YKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLI-RIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSA-------NQIKGLQPWYMPNDSKKNNVMAKEAFRSVI---TVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYK------IDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITG-KIIIDDNGAGFADYSLL-------DMDQITGNFLVVGTFYGKNKTLV----------MARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNK----LWTAPEVLR-NPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKE 3498
            + +P+++      D S+K  +P   R       + +    +   FNW     T V F Y+      Y+   +T  I+      G    ++    + +  HGFM++    L+ +   N RI +I      +V  ++       L+ G+Y    ID+           ++GL    +  D +   V A +++  ++   +VSF       + + + K  E+    +N+         +   ++     +DAV LY  AL + L       +G  +   I  S +    G  + ID+NG    +Y++L         +Q       VGTF  +N +L           +     IDW     + P   P CGF G+KC   T  + A ++   + ++ ++S+V++   + + EL+S+ WKI++ +++  E  + ++S          +P                        +  P    P I  S                    ++L+    +    T +F    +YK  + A+K +R   + ++I RE+  ++K ++D  +++I  FIG C DP N CII+EYC +GSL+D+LENE +KLD++F  S++ D+ RG++YL  S I +HG L +SNCLVDSR+V+K+TDFGL AF+ G E S+ D  Q    K    L+ APE+LR  P+   +G  + D YSF I+  E+  R G F  + +  +     V + +   NP +RP L+        +   +R CW E P  RP F  I+ KLR +      +I DN++  ME+YANNLE LV  RT Q  EEK++ + LL+ MLP+ VA QL +G  V  E +E+V+IYFSDI GFTA+SAE TP+QV+  LN+LYT FDSI   +DVYKVETIGDAYMVVSGLP RNG +H   IA MSL  LS + +FKI H+P  +L +RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMES+G PLKIH S   ++ LD  G +   ERG + +KGKG Q+TYWL G  E
Sbjct:  134 FNLPMISYYCTHRDPSNKADFPTFARTRPPDTQISKSVVALLLAFNW-----TQVSFLYLDDASGQYQPVAET--ILSTLTDAGVSIRDIRT-WNTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGL----LLEDVEPLAVQAFQSYLGIVPTASVSFAT-----FANEVNKYMERPP--FNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPHQNLKLFSPIDWVG--GTRPAAAPRCGFGGEKCVNYTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENEREQQSQKQTRHLLNHLP-----------------------RRLPPQSTHPLIRTSQ-------------------VSLSSNPDADFRYTTIFTPIGLYKGQLYAIKKVR--KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTD-MQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGETGLTPMQCLQKVLQPQDYLNP-YRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1102          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304792)

HSP 1 Score: 530.02 bits (1364), Expect = 3.383e-167
Identity = 355/1034 (34.33%), Postives = 534/1034 (51.64%), Query Frame = 1
Query:  514 YKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLI-RIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSA-------NQIKGLQPWYMPNDSKKNNVMAKEAFRSVI---TVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYK------IDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITG-KIIIDDNGAGFADYSLL-------DMDQITGNFLVVGTFYGKNKTLVMARD--------RNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNK----LWTAPEVLR-NPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKE 3498
            + +P+++      D S+K  +P   R       + +    +   FNW     T V F Y+      Y+   +T  I+      G    ++    + +  HGFM++    L+ +   N RI +I      +V  ++       L+ G+Y    ID+           ++GL    +  D +   V A +++  ++   +VSF       + + + K  E+    +N+         +   ++     +DAV LY  AL + L       +G  +   I  S +    G  + ID+NG    +Y++L         +Q       VGTF  +N +L               IDW     + P   P CGF G+KC   T  + A ++   + ++ ++S+V++   + + EL+S+ WKI++ +++  E     R   S  +  ++ P+   +Q++ S N   + +Y                                                    T +F    +YK  + A+K +R   + ++I RE+  ++K ++D  +++I  FIG C DP N CII+EYC +GSL+D+LENE +KLD++F  S++ D+ RG++YL  S I +HG L +SNCLVDSR+V+K+TDFGL AF+ G E S+ D  Q    K    L+ APE+LR  P+   +G  + D YSF I+  E+  R G F  + +  +     V + +   NP +RP L+        +   +R CW E P  RP F  I+ KLR +      +I DN++  ME+YANNLE LV  RT Q  EEK++ + LL+ MLP+ VA QL +G  V  E +E+V+IYFSDI GFTA+SAE TP+QV+  LN+LYT FDSI   +DVYKVETIGDAYMVVSGLP RNG +H   IA MSL  LS + +FKI H+P  +L +RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMES+G PLKIH S   ++ LD  G +   ERG + +KGKG Q+TYWL G  E
Sbjct:  134 FNLPMISYYCTHRDPSNKADFPTFARTRPPDTQISKSVVALLLAFNW-----TQVSFLYLDDASGQYQPVAET--ILSTLTDAGVSIRDIRT-WNTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGL----LLEDVEPLAVQAFQSYLGIVPTASVSFAT-----FANEVNKYMERPP--FNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSPIDWVG--GTRPAAAPRCGFGGEKCVNYTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENE---REQQSQKQTRSTHPLIRTSQVSLSSNPDADFRY----------------------------------------------------TTIFTPIGLYKGQLYAIKKVR--KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTD-MQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGETGLTPMQCLQKVLQPQDYLNP-YRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1087          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 446/1147 (38.88%), Postives = 638/1147 (55.62%), Query Frame = 1
Query:  100 SLSALMLSIFIVFLITLYLCSLCQAGKSYITRIIKPLDKSNESSLEIKIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNAT-----FSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWH--KFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKG--LQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENI 3504
            SL  +   +FIV L  + +   C+A K  IT                 +AV+LP + K      +VLPAI +A + ++ +  L R  T     FS   S  + S     +IA+D    +  +  +GP   + +A+V R++S+ +K+P++TA G A      + +  + R   T K +      +   FNWS ++        I+H  K D     F +  I  + +      L    E      +  M      +  I++N RI  IC     + + + L    +K +  +Y  F +D+ A  + G    PW   +D + N+ +  + F+SV  V++++PD   YT F  ++ +++   +N   +    +   G FHD  VLY  AL++ L+   S  DG  +   + N    G+TG + ID   A F D+SL  M  + +G + +VG + G +K ++ +    I W   K   PLD P CGF   K   +    +  +   +  I+  IS  +  RK K++ EL  M W+I W +++ +       S N  +K++ S                     +   S+ G + +   I+    Y                               Q+FAKT  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM YL  S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E  N DS   Y  KLWTAPE+L     PP G  K DVYSF I+ QEI  R+G FY+  +D+   +I+       + P FRP  ++ R   +++  ++  CW EDP  RP F+ IK+ + + N          LL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L ++  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMES G+ L+IH+S ++K  LD FG F L  RG+V++KGKG  +TYWL G K ++
Sbjct:    8 SLLKMGYRVFIVLLTRMVVLE-CRAEKGNIT-----------------VAVMLPENLKYSWASPRVLPAIRMAQEKIQ-KSGLLRGHTINLLNFSTEDSSGSCSENEAQIIAVDTKLYHKPDAFIGPGCTYSVASVGRFASH-WKLPLITAGGPAYGFDKWEEFKTIVRTGPTTKKLGDFVNYLHGQFNWSSRALM------IFHDLKQDDRPHYFLSEGIYTVLREENITVLAFPYEDEQTYNYKDM------ITFIKDNGRIVYICGPLPTFFQIMKLFEDEVK-SPEDYAIFYLDVFAESLSGDVPMPW-QGSDIQWNDPI--KLFQSVFVVTYQEPDSPEYTAFRKELHKRAIQDFNVQLEPSMMDFIAGCFHDGFVLYAKALSEALADGVSQNDGINITARMQNRRLWGVTGLVSIDQKNARFTDFSLWAMTNLKSGQYAIVGHYNGTSKEILWSPTEKIQWP--KGCPPLDYPPCGFSPCKEDHLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRIRWEELQFE-------SPNKYHKRAGS---------------------RLTLSQRG-SSYGSLITAHGKY-------------------------------QLFAKTGYFKGNLVAIKHVN--KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE--NEDSHALYAKKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVEGMDLSPKEIIQKVRNG-QKPYFRPTTDNSRHC-EELTILMEGCWSEDPAERPDFSHIKVFIAKFNK--QHQYSQYLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHMSSATKEVLDEFGYFELQLRGDVEMKGKGKMRTYWLLGEKTDV 1048          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 409/1101 (37.15%), Postives = 597/1101 (54.22%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNAT-----FSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWH--KFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKG--LQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENI 3504
            I +AV+LP + K      +VLPAI +A + ++ +  L R  T     FS   S  + S     +IA+D    +  +  +GP   + +A+V R++S+ +K+P++TA G A      + +  + R   T K +      +   FNWS ++        I+H  K D     F +  I  + +      L    E      +  M      +  I++N RI  IC     + + + L    +K +  +Y  F +D+ A  + G    PW   +D + N+ +  + F+SV  V++++PD   YT F  ++ +++   +N   +    +   G FHD  VLY  AL++ L+   S  DG  +   + N    G+TG + ID   A F D+SL  M  + +G + +VG + G +K ++ +    I W   K   PLD P CGF   K   +    +  +   +  I+  IS  +  RK K++ EL  M W+I W +++ +       S N  +K++ S                     +   S+ G + +   I+    Y                               Q+FAKT  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM YL  S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E  N DS   Y  KLWTAPE+L     PP G  K DVYSF I+ QEI  R+G FY+  +D+   +I+       + P FRP  ++ R   +++  ++  CW EDP  RP F+ IK+ + + N          LL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L ++  FKI H+P+ QL++RI          ++  K    CLF   V + +        L+IH+S ++K  LD FG F L  RG+V++KGKG  +TYWL G K ++
Sbjct:   24 ITVAVMLPENLKYSWASPRVLPAIRMAQEKIQ-KSGLLRGHTINLLNFSTEDSSGSCSENEAQIIAVDTKLYHKPDAFIGPGCTYSVASVGRFASH-WKLPLITAGGPAYGFDKWEEFKTIVRTGPTTKKLGDFVNYLHGQFNWSSRALM------IFHDLKQDDRPHYFLSEGIYTVLREENITVLAFPYEDEQTYNYKDM------ITFIKDNGRIVYICGPLPTFFQIMKLFEDEVK-SPEDYAIFYLDVFAESLSGDVPMPW-QGSDIQWNDPI--KLFQSVFVVTYQEPDSPEYTAFRKELHKRAIQDFNVQLEPSMMDFIAGCFHDGFVLYAKALSEALADGVSQNDGINITARMQNRRLWGVTGLVSIDQKNARFTDFSLWAMTNLKSGQYAIVGHYNGTSKEILWSPTEKIQWP--KGCPPLDYPPCGFSPCKEDHLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRIRWEELQFE-------SPNKYHKRAGS---------------------RLTLSQRG-SSYGSLITAHGKY-------------------------------QLFAKTGYFKGNLVAIKHVN--KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE--NEDSHALYAKKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVEGMDLSPKEIIQKVRNG-QKPYFRPTTDNSRHC-EELTILMEGCWSEDPAERPDFSHIKVFIAKFNKQHQYS--QYLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRI---GIHTGTIIIISKFLMNCLFVMVVFSTA--------LRIHMSSATKEVLDEFGYFELQLRGDVEMKGKGKMRTYWLLGEKTDV 1025          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 299/528 (56.63%), Postives = 385/528 (72.92%), Query Frame = 1
Query: 1921 LTLAGIQLSQLAST----QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            L+L G     L +T    Q+FAKT  +K NIVA+K++    RR+E+ R++LF++K ++D+ N H+ RFIG C+DP N CI+TEYCP+GSLQ++LEN+ I LD +F+ SL+ D+ +GM +L  S I  HGNLKSSNC+VD+RFVLKITD+GLS+ R   E    D+  +Y  KLW APE+ R    PP G  K DVYSF I+ QE+  R GVFY+    +   +IV       E P  RP L + +  ++++  +++ CW E+P+ RP F+ I + LR+ N     +ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT+LSAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+PD+QLK+RIG+H+G VCAGVVG+KMPRYCLFGDTVNT+SRMESNG+PLKIHVS +++  L  F  F L  RG+V++KGKG  +TYWL G
Sbjct:  290 LSLRGSNYGSLLTTDGNFQVFAKTGYFKGNIVAIKYINR--RRVELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICIVTEYCPRGSLQNILENDSITLDWMFKYSLISDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIRT--ESDTEDAHSYYARKLWLAPELSRMECFPPGGTQKGDVYSFGIILQEVALRRGVFYLEGDLLSPKEIVDRVALG-EWPYLRPSL-NPQAHSEELGQLMQRCWAEEPSDRPEFSHISVLLRKQNREHRSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLG 811          

HSP 2 Score: 140.584 bits (353), Expect = 1.918e-33
Identity = 93/293 (31.74%), Postives = 153/293 (52.22%), Query Frame = 1
Query:  871 TIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGL--QPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDA--NSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGK----KCPPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNS 1719
              +C  S +  R +++  H   L   EYV+F ID+  +  +    QPW   +    ++V AKEAF+SV  +++ +P +Q Y DF+  +K  +K  +N+   +DD+  N   G F+D ++LYC ALN++LS +     GE V   +WN ++ G+TG + ID+NG    D++L DM  I TG+F +V  + G  K + +     I W   K   P+D P CGF  +    +   I    +  + + +I I++    V   RK K++ EL +  W+I+W DI+     +  RS  S
Sbjct:    2 VFVCC-SPDVFRQLIVHFHKAGLPKEEYVFFYIDIFGHSFRSRPSQPWARGD---SDDVFAKEAFQSVKILTYLEPQNQEYKDFVTDLKSDAKRMFNF--TVDDSLMNIISGGFYDGLMLYCHALNESLSDSHERPSGESVSKRMWNRTYYGVTGLVQIDENGDRETDFALWDMADINTGDFQIVAVYNGTQKEMNILPGMAIQWPGGK--VPMDVPTCGFKNENPACRARTIAMHQMISIVLFLILIIIFTVTVFIYRKLKLEKELVAQLWRISWDDIQMSHLEKALRSTGS 286          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 296/520 (56.92%), Postives = 381/520 (73.27%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            G  L+   + Q++AKT  YK NI A+K++    +RIE+ R++LF++K ++D+ N H+ RFIG C+DP N CI+TEYCP+GSLQD++E+E I LD +FR SL+ D+ +GM +L  S I  HGNLKSSNC+VDSRFVLKITD+GL +F   ++ +  D   FY  +LWTAPE+LR    P  G  K DVYSF I+ QE+    GVFY+    +   +I+   V     P  RP L  +   ++++  ++  CW ED N RP F+QIK+ LR+ N     +ILDNLL+RMEQYANNLE LV +RTQ Y+EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPM+V+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  ++ F+I H+P+ QL++RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVSE+++  L  F  F L  RG+V++KGKG  +TYWL G
Sbjct:  547 GSLLTMDGNFQIYAKTGYYKGNITAIKYVN--KKRIELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFH--KDSNLDDVHAFYARQLWTAPELLRADNPPACGTQKGDVYSFGIILQELALLKGVFYLEGPCLSPKEIIERVVEG-RWPYLRPLLCPQSH-SEEMGQLMLRCWSEDVNERPDFSQIKVLLRKNNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLG 1060          

HSP 2 Score: 165.236 bits (417), Expect = 7.890e-41
Identity = 137/513 (26.71%), Postives = 247/513 (48.15%), Query Frame = 1
Query:  217 SNESSLEIKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNS-----SLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTR-PIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKG--LQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQ--EKRQRR 1704
            ++ S   I +AV+LP ++++      +V PA+  A++ V ++ NL       + ++ S +     S +V PL+A+D+         +GP  D+  + V R++++ ++VP++T+   A   +   +Y  +T +  T+K +     ++   F W   +    +  +  +K D   C F    P   + + N    +   D +    E       +  L  I   AR+  +C K   + R +M+          EY +F IDL    ++    +PW    D+  N   AKEAF+SV  +++R+P +  Y DF+ K+K ++   +N++ +    N   G FHD V+LY  ALN T+  + S   G+ V   +WN +++G+TG + +D+NG    D++L DM D  TG++ +V  + G  K +++     + W   K   P D P CGF  D   C    +T   +  + +  I I++V   V   RK K++ EL +  W+++W DI+    EK  RR
Sbjct:   40 AHASQKNITLAVILPLHNTEYPWAWPRVGPALYWALEKVNSDPNLLAGYHLQLVFNSSENKEGLCSDSVAPLVAVDLKFSYNPWAFIGPGCDYSSSPVARFTTH-WEVPMITSGARALGFN---LYSSITNIGPTHKKLGEFVLRMHRHFGWDKHA----MLMFNDNKNDDRPCYFAVEGPYTQMREDN----ITADDLVFNEDEEPLRYDEL--LRDISHKARVVYVCCKWETF-RKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPWAR-GDADDN--AAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHWL--KGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMSNTEKVLRR 532          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 296/520 (56.92%), Postives = 381/520 (73.27%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            G  L+   + Q++AKT  YK NI A+K++    +RIE+ R++LF++K ++D+ N H+ RFIG C+DP N CI+TEYCP+GSLQD++E+E I LD +FR SL+ D+ +GM +L  S I  HGNLKSSNC+VDSRFVLKITD+GL +F   ++ +  D   FY  +LWTAPE+LR    P  G  K DVYSF I+ QE+    GVFY+    +   +I+   V     P  RP L  +   ++++  ++  CW ED N RP F+QIK+ LR+ N     +ILDNLL+RMEQYANNLE LV +RTQ Y+EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPM+V+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  ++ F+I H+P+ QL++RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVSE+++  L  F  F L  RG+V++KGKG  +TYWL G
Sbjct:  547 GSLLTMDGNFQIYAKTGYYKGNITAIKYVN--KKRIELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFH--KDSNLDDVHAFYARQLWTAPELLRADNPPACGTQKGDVYSFGIILQELALLKGVFYLEGPCLSPKEIIERVVEG-RWPYLRPLLCPQSH-SEEMGQLMLRCWSEDVNERPDFSQIKVLLRKNNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLG 1060          

HSP 2 Score: 165.236 bits (417), Expect = 7.890e-41
Identity = 137/513 (26.71%), Postives = 247/513 (48.15%), Query Frame = 1
Query:  217 SNESSLEIKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNS-----SLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTR-PIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKG--LQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQ--EKRQRR 1704
            ++ S   I +AV+LP ++++      +V PA+  A++ V ++ NL       + ++ S +     S +V PL+A+D+         +GP  D+  + V R++++ ++VP++T+   A   +   +Y  +T +  T+K +     ++   F W   +    +  +  +K D   C F    P   + + N    +   D +    E       +  L  I   AR+  +C K   + R +M+          EY +F IDL    ++    +PW    D+  N   AKEAF+SV  +++R+P +  Y DF+ K+K ++   +N++ +    N   G FHD V+LY  ALN T+  + S   G+ V   +WN +++G+TG + +D+NG    D++L DM D  TG++ +V  + G  K +++     + W   K   P D P CGF  D   C    +T   +  + +  I I++V   V   RK K++ EL +  W+++W DI+    EK  RR
Sbjct:   40 AHASQKNITLAVILPLHNTEYPWAWPRVGPALYWALEKVNSDPNLLAGYHLQLVFNSSENKEGLCSDSVAPLVAVDLKFSYNPWAFIGPGCDYSSSPVARFTTH-WEVPMITSGARALGFN---LYSSITNIGPTHKKLGEFVLRMHRHFGWDKHA----MLMFNDNKNDDRPCYFAVEGPYTQMREDN----ITADDLVFNEDEEPLRYDEL--LRDISHKARVVYVCCKWETF-RKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPWAR-GDADDN--AAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHWL--KGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMSNTEKVLRR 532          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 297/508 (58.46%), Postives = 373/508 (73.43%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIEN---PPFRPRLE-----DERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGK 3459
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RF+G C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L +S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E    D++  Y  KLWTAPE+LR    P  G  K DVYSF I+ QEI  R+G FYI  +D+   +IV     K+ N   P FRP ++     +E GI  D       CW E+P  RP F QIK  + + N  G   ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ L+IH+S ++K  LD F  F L  RG++++K K
Sbjct:   54 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEAD--DAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQ----KVRNGQRPYFRPTVDISCHSEELGILMD------RCWAEEPLDRPDFNQIKAYICKFNKEGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 547          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 297/508 (58.46%), Postives = 373/508 (73.43%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIEN---PPFRPRLE-----DERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGK 3459
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RF+G C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L +S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E    D++  Y  KLWTAPE+LR    P  G  K DVYSF I+ QEI  R+G FYI  +D+   +IV     K+ N   P FRP ++     +E GI  D       CW E+P  RP F QIK  + + N  G   ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ L+IH+S ++K  LD F  F L  RG++++K K
Sbjct:  139 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEAD--DAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQ----KVRNGQRPYFRPTVDISCHSEELGILMD------RCWAEEPLDRPDFNQIKAYICKFNKEGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 632          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 297/508 (58.46%), Postives = 373/508 (73.43%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIEN---PPFRPRLE-----DERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGK 3459
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RF+G C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L +S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E    D++  Y  KLWTAPE+LR    P  G  K DVYSF I+ QEI  R+G FYI  +D+   +IV     K+ N   P FRP ++     +E GI  D       CW E+P  RP F QIK  + + N  G   ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ L+IH+S ++K  LD F  F L  RG++++K K
Sbjct:  184 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEAD--DAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQ----KVRNGQRPYFRPTVDISCHSEELGILMD------RCWAEEPLDRPDFNQIKAYICKFNKEGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 677          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 297/508 (58.46%), Postives = 373/508 (73.43%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIEN---PPFRPRLE-----DERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGK 3459
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RF+G C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L +S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E    D++  Y  KLWTAPE+LR    P  G  K DVYSF I+ QEI  R+G FYI  +D+   +IV     K+ N   P FRP ++     +E GI  D       CW E+P  RP F QIK  + + N  G   ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ L+IH+S ++K  LD F  F L  RG++++K K
Sbjct:  212 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEAD--DAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQ----KVRNGQRPYFRPTVDISCHSEELGILMD------RCWAEEPLDRPDFNQIKAYICKFNKEGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 705          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 297/508 (58.46%), Postives = 373/508 (73.43%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIEN---PPFRPRLE-----DERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGK 3459
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RF+G C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L +S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E    D++  Y  KLWTAPE+LR    P  G  K DVYSF I+ QEI  R+G FYI  +D+   +IV     K+ N   P FRP ++     +E GI  D       CW E+P  RP F QIK  + + N  G   ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ L+IH+S ++K  LD F  F L  RG++++K K
Sbjct:  107 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEAD--DAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQ----KVRNGQRPYFRPTVDISCHSEELGILMD------RCWAEEPLDRPDFNQIKAYICKFNKEGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 600          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 307/517 (59.38%), Postives = 382/517 (73.89%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIEN---PPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LEN+ I LD +FR SL+ D+ +GM +L  S I  HG+LKSSNC+VDSRFVLKITD+GL++FR   E    DS   Y  KLWTAPE+L    LP  G+ KADVYSFAI+ QEI  RSG FY+  +D+   +IV     K+ N   P FRP + D   +N++++ ++  CW +DP  RP F QIK  +RR N  G   ILDNLL RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG  H   IA M+LA L  +  F+I H+P  QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD  G F L  RG+V++KGKG  +TYWL G ++ 
Sbjct:  101 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE--PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQ----KVRNGQRPYFRPSI-DRTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQKG 608          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 305/514 (59.34%), Postives = 380/514 (73.93%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LEN+ I LD +FR SL+ D+ +GM +L  S I  HG+LKSSNC+VDSRFVLKITD+GL++FR   E    DS   Y  KLWTAPE+L    LP  G+ KADVYSFAI+ QEI  RSG FY+  +D+   +IV       + P FRP + D   +N++++ ++  CW +DP  RP F QIK  +RR N  G   ILDNLL RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG  H   IA M+LA L  +  F+I H+P  QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD  G F L  RG+V++KGKG  +TYWL G ++ 
Sbjct:  535 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPD--DSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNG-QRPYFRPSI-DRTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQKG 1042          

HSP 2 Score: 145.976 bits (367), Expect = 8.631e-35
Identity = 125/495 (25.25%), Postives = 232/495 (46.87%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQC-QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDK-KIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGL------QPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIE 1680
            + +AV+LP  + S      +V PA+ +A++ +   R L  +  F  S  D   S  + PL A+D+   +  ++LLGP   +  A+V R++S+ +++P+LTA   AS  + K + Y  L R   +   +      +   FNW+ ++       Y+  + D     F    + +  + +    L +  +++     G   +T      IR N RI  IC      + +I+L A    LTNG+YV+F +D+    ++        +PW   N +++     +EAF++V+ +++R+P +  Y +F  ++  +++  +  +      N   G F+D ++LY   LN+T+    +  DG  +   +    ++G+TG +++D N     D+ L  M  + +G+F     + G  K  +    R I W   K + PLD P C F  D   C   P++   +  L   V  I+  +S  +  RK M + EL SM W+I W +++
Sbjct:   25 LTLAVVLPEHNLSYAWAWPRVGPAVALAVEALG--RALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASH-WRLPLLTAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARA----ALLYLDARTDDRPHYFTIEGVFEALQGSN---LSVQHQVYAREPGGPEQATHF----IRANGRIVYICG-PLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQ-IWWTGRPIPWV--KGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 301/522 (57.66%), Postives = 383/522 (73.37%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTK 3495
            G  L+     Q+FAKTA YK N+VA+K  R+  +RIE+ R++LF++K ++D+ N H+ RF+G C DP N CI+TEYCP+GSLQD+LENE I LD +FR SL  D+ +GML+L    IG HGNLKSSNC+VD RFVLKITD+GL +FR       H     +  KLWTAPE+LR  + P  G    DVYSF I+ QEI  RSGVFY+  +D+   +I+     + E PPFRP ++ +  + +++  +++ CW EDP  RP F QI+L LR+ N     +ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD++ ++ DVYKVETIGDAYMVVSGLP RNG +H R +A M+LA L  +  F+I H+P +QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ L+IH+S  +K  L+ F  F L  RG+V++KGKG  +TYWL G +
Sbjct:  537 GSLLTTEGQFQVFAKTAYYKGNLVAVK--RVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQGH---TLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIERVT-RGEQPPFRPSMDLQSHL-EELGQLMQRCWAEDPQERPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGER 1051          

HSP 2 Score: 171.014 bits (432), Expect = 1.149e-42
Identity = 122/449 (27.17%), Postives = 215/449 (47.88%), Query Frame = 1
Query:  235 EIKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAV-----GPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNF-------QTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIR-IRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQ------PWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFD 1521
            ++ +AV+LP  ++       +V PA+++A+  VK   +L    T  +    S ++  V      PL A+D+  ++   V LGP   +  A V R++++ ++VP+LTA   A  +  K  Y + TR   ++  +      +     W  ++    +  Y     D   C F       + R  ++I   N  +F+E  D  H              L+R ++   R+  IC+ S +  R++ML A    LT  +YV+F++D+    ++G Q      PW   +   +    A++AF++   +++++PD+  Y +F+ ++K  +   +N+  +    N     FHD ++LY  A+ +TL+   ++TDGE +   +WN SF G+TG + ID NG    D+SL DMD  TG F VV  F G ++ L+   +  + W       P D P CGFD
Sbjct:   30 DLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAH-WRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQA----LVLYADRLGDDRPCFFIVEGLYMRVRERLNI-TVNHQEFVE-GDPDHY-----------TKLLRTVQRKGRVIYICS-SPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRR---ARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWP--LGYPPPDIPKCGFD 454          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 495.738 bits (1275), Expect = 2.776e-156
Identity = 252/435 (57.93%), Postives = 317/435 (72.87%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTG 3264
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LEN+ I LD +FR SL+ D+ +GM +L  S I  HG+LKSSNC+VDSRFVLKITD+GL++FR   E    DS   Y  KLWTAPE+L    LP  G+ KADVYSFAI+ QEI  RSG FY+  +D+   +IV       + P FRP + D   +N++++ ++  CW +DP  RP F QIK  +RR N  G   ILDNLL RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG  H   IA M+LA L  +  F+I H+P  QL++RIG+HTG
Sbjct:  535 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPD--DSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNG-QRPYFRPSI-DRTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTG 963          

HSP 2 Score: 145.206 bits (365), Expect = 1.232e-34
Identity = 125/495 (25.25%), Postives = 232/495 (46.87%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQC-QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDK-KIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGL------QPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIE 1680
            + +AV+LP  + S      +V PA+ +A++ +   R L  +  F  S  D   S  + PL A+D+   +  ++LLGP   +  A+V R++S+ +++P+LTA   AS  + K + Y  L R   +   +      +   FNW+ ++       Y+  + D     F    + +  + +    L +  +++     G   +T      IR N RI  IC      + +I+L A    LTNG+YV+F +D+    ++        +PW   N +++     +EAF++V+ +++R+P +  Y +F  ++  +++  +  +      N   G F+D ++LY   LN+T+    +  DG  +   +    ++G+TG +++D N     D+ L  M  + +G+F     + G  K  +    R I W   K + PLD P C F  D   C   P++   +  L   V  I+  +S  +  RK M + EL SM W+I W +++
Sbjct:   25 LTLAVVLPEHNLSYAWAWPRVGPAVALAVEALG--RALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASH-WRLPLLTAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARA----ALLYLDARTDDRPHYFTIEGVFEALQGSN---LSVQHQVYAREPGGPEQATHF----IRANGRIVYICGPL-EMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQ-IWWTGRPIPWV--KGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2g (guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:106025])

HSP 1 Score: 441.425 bits (1134), Expect = 2.625e-135
Identity = 239/520 (45.96%), Postives = 331/520 (63.65%), Query Frame = 1
Query: 1966 MFAKTAIYKENIVALKHLRLEG----RRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKL-WTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRS--GVFYXXXXXXXXXXXXXXXXXKIENP----PFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
             FA   +Y+ N VAL ++  E     ++  + RE+        +L + +I  F G+C +P N CI+T+YC KGSLQDV+ N   ++D +F+LS   D+  G+L+L  S +  HGNLK SNCLVDS   LK++ FGL  F+ G    +++      ++L WTAPE+LR    P  G  + DVYSFAI+ +++I++   G F              + + +I++P    P RP L +++G  + I++++R CW E P LRP F  IK  LR  +  G   ILD+++ ++E YAN+LE +V +RT++   EKR+ E LL +MLP  V  QLI G+ V  E FE VTI+FSDI GFT L + S+P+QV+ LLN+LY+LFD   + HDVYKVETIGDAYMV SGLP RNG  H   IA M+L  LS    F+I H P+++LK+RIG+HTG V AGVVG+ MPRYCLFGDTVN ASRMES+  PL+IHVS+S+   L   G + L +RG + +KGKG Q T+WL G
Sbjct:  570 FFAPVGLYQGNQVALCYIGDEAEAWVKKPTVRREVCLMC----ELKHENIVPFFGVCTEPPNICIVTQYCKKGSLQDVMRNSDHEIDWIFKLSFAYDIVNGLLFLHGSPLRSHGNLKPSNCLVDSHMQLKLSGFGLWEFKHGSTWRSYNQEATDHSELYWTAPELLRLRESPCSGTPQGDVYSFAILLRDLIHQQAHGPF------EDLEAAPEEIISRIKDPRAPVPLRPSLLEDKGDGR-IVALVRECWDESPELRPIFPSIKKTLREASPRGHVSILDSMMGKLETYANHLEEVVEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVKGKGEQTTFWLKG 1078          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P55202|ANPRB_ANGJA (Atrial natriuretic peptide receptor 2 OS=Anguilla japonica OX=7937 GN=npr2 PE=2 SV=1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 433/1149 (37.68%), Postives = 616/1149 (53.61%), Query Frame = 1
Query:  121 SIFIVFLITLYLCSLCQAGKSYITRIIKPLDKSNESSLEIKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNS-----SLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDE---IHMLTEHGFMNSTIANLIR-IRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQI--KGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAI--YKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENI 3504
            S+F+VF  T +L + C+                 E    I + V+LP N  K      +V PAI +A D ++ +  L R  T ++    + S     S +   ++A+D       +   GP   + +A+V R+ ++ +K+P++TA   A     K+ Y  + R   +   +      + + FNW+ +++              ++     RP    F + G  FL L  E   +  +      NS    +I  ++ N RI  IC     ++ + M    +  L   +Y  F +D+ A  I  K  +PW     S  N     + F+SV  ++ ++PD+  Y  F  ++  ++K  ++   +    +   G F+D  +LY  ALN+TL+   S  DG  +   + N  F G+TG +  D N     D++L  M +  TG + +V  + G NK +V +    I W   K S PLD P C F  D   C    +    +  +   +  I+  IS  +  RK K++ EL  M W+I W +++ +       S N  +K + S                     +   S+ G + +   I+    Y+               L    G     L + +   K  I   ++ +  LKH+R                    D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L  S IG HGNLKSSNC+VDSRFVLKITD+GL++FR   E  N DS   Y  KLWTAPE+L     PP G  K DVYSF I+ QEI  R+G FY+  +D+   +IV       + P FRP   D    ++++  ++  CW EDP  RP F+ IK+ + ++N  G   IL+NLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVS    RNG +H R IA MSLA L ++  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIH+S ++K  LD FG F L  RG+V++KGKG  +TYWL G K ++
Sbjct:    6 SLFVVF--TCFLMARCRT----------------EIGKNITVVVMLPDNHLKYSFAFPRVFPAIRMAHDDIQKKGKLLRGYTINLLNHSTESQGAGCSESQAQIMAVDTKLYEKPDAFFGPGCVYSVASVGRFVNH-WKLPLITAWAPAFGFDSKEEYRTIVRTGLSTTKLGEFAHYLHSHFNWTTRAFMLF-----------HDLKVDDRPYY--FISEGV-FLVLRRENITVEAVPYDDQKNSDYREMISSLKSNGRIVYICGPLDTFL-EFMRIFQNEGLPPEDYAIFYLDMFAKSILDKDYKPW---ESSDINWTDPIKLFKSVFVITAKEPDNPEYKAFQRELHARAKQEFSVQLEPSLEDIIAGCFYDGFMLYAQALNETLAEGGSQNDGINITQKMQNRRFWGVTGLVSTDKNNDRDIDFNLWAMTNHKTGQYGIVAYYNGTNKEIVWSETEKIQWP--KGSPPLDNPPCVFSMDEPFCNEDQLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRIRWEELQFE-------SPNKYHKCAGS---------------------RLTISQRG-SSYGSLITAHGKYQ---------------LFAKTGYFKGNLVAIKHVNKKRIELTRQVLFELKHMR--------------------DVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE--NEDSHALYAKKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVDGMDLSPKEIVQKVRNG-QKPYFRPT-TDTSCHSEELSILMEGCWAEDPADRPDFSYIKIFVMKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSDSQSRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSATKEVLDEFGYFDLQLRGDVEMKGKGKMRTYWLLGEKTDV 1047          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16067|ANPRB_RAT (Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 305/514 (59.34%), Postives = 380/514 (73.93%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LEN+ I LD +FR SL+ D+ +GM +L  S I  HG+LKSSNC+VDSRFVLKITD+GL++FR   E    DS   Y  KLWTAPE+L    LP  G+ KADVYSFAI+ QEI  RSG FY+  +D+   +IV       + P FRP + D   +N++++ ++  CW +DP  RP F QIK  +RR N  G   ILDNLL RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG  H   IA M+LA L  +  F+I H+P  QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD  G F L  RG+V++KGKG  +TYWL G ++ 
Sbjct:  535 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPD--DSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNG-QRPYFRPSI-DRTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKG 1042          

HSP 2 Score: 144.821 bits (364), Expect = 1.274e-33
Identity = 124/495 (25.05%), Postives = 231/495 (46.67%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQC-QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDK-KIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGL------QPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIE 1680
            + +AV+LP  + S      +V PA+ +A++ +   R L  +  F  S  D   S  + PL A+D+   +  ++LLGP   +  A+V R++S+ + +P+LTA   AS  + K + Y  L R   +   +      +   FNW+ ++       Y+  + D     F    + +  + +    L +  +++     G   +T      IR N RI  IC      + +I+L A    LTNG+YV+F +D+    ++        +PW   N +++     +EAF++V+ +++R+P +  Y +F  ++  +++  +  +      N   G F+D ++LY   LN+T+    +  DG  +   +    ++G+TG +++D N     D+ L  M  + +G+F     + G  K  +    R I W   K + PLD P C F  D   C   P++   +  L   +  I+  +S  +  RK M + EL SM W+I W +++
Sbjct:   25 LTLAVVLPEHNLSYAWAWPRVGPAVALAVEALG--RALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASH-WHLPLLTAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARA----ALLYLDARTDDRPHYFTIEGVFEALQGSN---LSVQHQVYTREPGGPEQATHF----IRANGRIVYICG-PLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLESGDFQPAAHYSGAEKQ-IWWTGRPIPWV--KGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|Q6VVW5|ANPRB_MOUSE (Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 305/514 (59.34%), Postives = 380/514 (73.93%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LEN+ I LD +FR SL+ D+ +GM +L  S I  HG+LKSSNC+VDSRFVLKITD+GL++FR   E    DS   Y  KLWTAPE+L    LP  G+ KADVYSFAI+ QEI  RSG FY+  +D+   +IV       + P FRP + D   +N++++ ++  CW +DP  RP F QIK  +RR N  G   ILDNLL RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG  H   IA M+LA L  +  F+I H+P  QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD  G F L  RG+V++KGKG  +TYWL G ++ 
Sbjct:  535 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPD--DSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNG-QRPYFRPSI-DRTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQKG 1042          

HSP 2 Score: 145.976 bits (367), Expect = 6.037e-34
Identity = 125/495 (25.25%), Postives = 232/495 (46.87%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQC-QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDK-KIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGL------QPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIE 1680
            + +AV+LP  + S      +V PA+ +A++ +   R L  +  F  S  D   S  + PL A+D+   +  ++LLGP   +  A+V R++S+ +++P+LTA   AS  + K + Y  L R   +   +      +   FNW+ ++       Y+  + D     F    + +  + +    L +  +++     G   +T      IR N RI  IC      + +I+L A    LTNG+YV+F +D+    ++        +PW   N +++     +EAF++V+ +++R+P +  Y +F  ++  +++  +  +      N   G F+D ++LY   LN+T+    +  DG  +   +    ++G+TG +++D N     D+ L  M  + +G+F     + G  K  +    R I W   K + PLD P C F  D   C   P++   +  L   V  I+  +S  +  RK M + EL SM W+I W +++
Sbjct:   25 LTLAVVLPEHNLSYAWAWPRVGPAVALAVEALG--RALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASH-WRLPLLTAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARA----ALLYLDARTDDRPHYFTIEGVFEALQGSN---LSVQHQVYAREPGGPEQATHF----IRANGRIVYICG-PLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQ-IWWTGRPIPWV--KGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18293|ANPRA_MOUSE (Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 301/522 (57.66%), Postives = 383/522 (73.37%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTK 3495
            G  L+     Q+FAKTA YK N+VA+K  R+  +RIE+ R++LF++K ++D+ N H+ RF+G C DP N CI+TEYCP+GSLQD+LENE I LD +FR SL  D+ +GML+L    IG HGNLKSSNC+VD RFVLKITD+GL +FR       H     +  KLWTAPE+LR  + P  G    DVYSF I+ QEI  RSGVFY+  +D+   +I+     + E PPFRP ++ +  + +++  +++ CW EDP  RP F QI+L LR+ N     +ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD++ ++ DVYKVETIGDAYMVVSGLP RNG +H R +A M+LA L  +  F+I H+P +QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ L+IH+S  +K  L+ F  F L  RG+V++KGKG  +TYWL G +
Sbjct:  537 GSLLTTEGQFQVFAKTAYYKGNLVAVK--RVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQGH---TLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIERVT-RGEQPPFRPSMDLQSHL-EELGQLMQRCWAEDPQERPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGER 1051          

HSP 2 Score: 171.014 bits (432), Expect = 8.034e-42
Identity = 122/449 (27.17%), Postives = 215/449 (47.88%), Query Frame = 1
Query:  235 EIKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAV-----GPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNF-------QTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIR-IRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQ------PWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFD 1521
            ++ +AV+LP  ++       +V PA+++A+  VK   +L    T  +    S ++  V      PL A+D+  ++   V LGP   +  A V R++++ ++VP+LTA   A  +  K  Y + TR   ++  +      +     W  ++    +  Y     D   C F       + R  ++I   N  +F+E  D  H              L+R ++   R+  IC+ S +  R++ML A    LT  +YV+F++D+    ++G Q      PW   +   +    A++AF++   +++++PD+  Y +F+ ++K  +   +N+  +    N     FHD ++LY  A+ +TL+   ++TDGE +   +WN SF G+TG + ID NG    D+SL DMD  TG F VV  F G ++ L+   +  + W       P D P CGFD
Sbjct:   30 DLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAH-WRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQA----LVLYADRLGDDRPCFFIVEGLYMRVRERLNI-TVNHQEFVE-GDPDHY-----------TKLLRTVQRKGRVIYICS-SPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRR---ARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWP--LGYPPPDIPKCGFD 454          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P46197|ANPRB_BOVIN (Atrial natriuretic peptide receptor 2 OS=Bos taurus OX=9913 GN=NPR2 PE=2 SV=1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 304/514 (59.14%), Postives = 379/514 (73.74%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            Q+FA T  +K N+VA+KH+    +RIE+ R++LF++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LEN+ I LD +FR SL+ D+ +GM +L  S I  HG+LKSSNC+VDSRFVLKITD+GL++FR   E    DS   Y  KLWTAPE+L    LP  G+ KADVYSF I+ QEI  RSG FY+  +D+   +IV       + P FRP + D   +N++++ ++  CW +DP  RP F QIK  +RR N  G   ILDNLL RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG  H   IA M+LA L  +  F+I H+P  QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD  G F L  RG+V++KGKG  +TYWL G ++ 
Sbjct:  535 QIFANTGHFKGNVVAIKHV--NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIASHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE--PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNG-QRPYFRPSI-DRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKG 1042          

HSP 2 Score: 146.747 bits (369), Expect = 2.860e-34
Identity = 126/495 (25.45%), Postives = 231/495 (46.67%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQC-QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDK-KIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGL------QPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRKKM-KTELESMDWKINWCDIE 1680
            + +AV+LP  + S      +V PA+ +A++ +   R L  +  F  S  D   S  + PL A+D+   +  ++LLGP   +  A+V R++S+ +++P+LTA   AS  S K + Y  L R   +   +      +   FNW+ ++       Y+  + D     F    + +  + +    L +  +++     G   +T      IR N RI  IC      + +I+L A    LTNG+YV+F +D+    ++        +PW   N +++     +EAF++V+ +++R+P +  Y +F  ++  +++  +  +      N   G F+D ++LY   LN+T+    +  DG  +   +    + G+TG +++D N     D+ L  M D ++G+F     + G  K  +    R I W   K   PLD P C F  D   C   P++   +  L   +  I+  +S  +  RK M + EL SM W+I W +++
Sbjct:   25 LTLAVVLPEHNLSYAWAWPRVGPAVALAMEALG--RALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASH-WRLPLLTAGAVASGFSAKSEHYRTLVRTGPSAPKLGEFVVMLHGHFNWTARA----ALLYLDARTDDRPHYFTIEGVFEALQGSN---LSVQHQVYAREPGGPEQATHF----IRANGRIVYICG-PLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRSMGRPW-QDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYRGVTGLVVMDKNNDRETDFVLWAMGDLVSGDFQPAAHYSGAEKQ-IWWTGRPIPWV--KGVPPLDNPPCAFDMDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8HCY1 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 510/1129 (45.17%), Postives = 701/1129 (62.09%), Query Frame = 1
Query:  286 LIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSY-RYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTE--------HGFMNSTI-ANLIRI-RENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLN--RSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCP---PITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEK---------------------------RQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLN---PKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQF--YKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDE-----RGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRIN-GAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVD 3510
            L +VLP +D+AI+ V    +L    + S+  +DS    +V P++ + +    + +++LGP   F LA V RY+    Y+ PILT  G AS L DK  Y  L R+  ++  +E++   +F  FNW P+   T++F       +  + + + +   D       + L    E H + E        +   N+   + + R+ R+  R+ ++CA   + VR+IM+ A  L   NGEYV+FNIDL +++   LQPW   ND+ + N  A  A+R+++T++ R+P    Y +F  +VK  +KS YN+ Y  ++ NS VG FHDAV+LY LA+N T+  +    I +G  +   + N +F GITG + I+ NG   ADYSLLDMD+ T NF+VV  +YG  +   +   + IDW NE N  P D P CGFD   C            V+ +V+I ++ V+  VI+ + ++++EL +M+W+I W ++E  E+                           R  +    S  K++ S+ I   N  N+   S  N    K+Q         E    +S                     + T+AG+ LSQ+  TQ+F KTA YK  +VALK L L  +RIE+  ++L ++K VKDL ++++ RFIG CLD  NEC+++EYCPKGSLQDVLEN+ + LD +F+ SLM D+CRGM+YL    G HGNLKSSNCLVDSRF LKI DFGL + R  ++  + +  ++  Y+NKLWTAPE+LRNPT PP G  + DVYSFAI+CQEIIYR GVF+ISD D   P  +V++V++I N  +RP L+ E     +  ++ +I+ +R+CWQEDP  RP F  IK ++ R N  A  G+ILDNLL RMEQY+NNLE LVA+RT  Y EEK++AE+LLY MLPKSVA  L+RGE VTAE F+ VTIYFSDICGFTALS+ESTP++V+TLLN+LYTLFD I E +D YKVETIGDAYMVVSGLP RNGI+H R I+ M+L+FL  IY FKI HKPD QLK+RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG PLKIH+S  +   L+  G F+ T RG V++KGKG Q TYWLHG  ++IVD
Sbjct:    3 LEQVLPVVDIAIETVTT-LDLLHGHSVSLIANDSKCDYSVAPVLGVLLLQQKI-DLMLGPYCSFALAAVARYNRMPHYRRPILTTGGVASALRDKAEYFNLIRVGPSFDGVEKMLYLVFQRFNWKPRDVQTILF------IELPDEDVKEKRTRDEIGVTQSRILCHGIEKHFVQEKYIVRRLQYEMHNAQFKSEIFRVMRDEIRLVVLCA-DPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFSQQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTVYEHGFEGIANGSLITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIAVIYRKLRLESELHAMNWRIPWSELEPMERIAAGRRTSESGKDLQQQDEEPEQSQPHRHHQHRGQSHQKRTDSVRILFGNSHNEGSTSKKNRDEKKHQNDQHSGAAAEEMSLVS---------------------VDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRNKLWTAPELLRNPTPPPEGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEPQEIVEKVKEISNQMYRPTLDAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYWLHGEGDSIVD 1101          
BLAST of Guanylate cyclase vs. TrEMBL
Match: G4V651 (Guanylate cyclase OS=Schistosoma mansoni OX=6183 GN=Smp_142620 PE=3 SV=1)

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 520/1116 (46.59%), Postives = 691/1116 (61.92%), Query Frame = 1
Query:  232 LEIKIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVF----------WYIWHKFDAYECNFQTRPIMDIFKTNGYKFLE--LSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPI----TPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREI-SNHDSFQFYKNKLWTAPEVLRN--PTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGD-ILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLP 3519
            L +++  L P++        +VLPAID+A++ +++    F   +F+        +LA   L  +   N N  NV+ GP+NDF LAN  R+S+  Y VPI+   G+A  LSDK  Y MLTR+  TY D+E VF      + W P   T +              + H        FQ   +        YK L   L DE  +         T   L R+ ++ARI I+C      VRDIML AH L + NG+Y +FN+DL ++Q K  +PWY    S + N  A++A+R+++TV+  +PD   Y  F  +V+ ++   Y++ Y+  +    +G FHDAV LY LALN  L+   +IT+G  +   +WN +F G+TG + ID NG   ADYSLLDM+ +TG+F VV  ++G +K+L     R IDW N  N  PL TP CGFDG +C          + AV+ I+++T+ LV+ ++ + R K + EL +M+W I W  ++  EK  RR                                Y+ ++    PN+       S+  RK  SE                   +  A++QMFA+TA Y ++IVALK LR + R +E ++ +  ++K VKDLN +HI R IG+CL+  ++CI+ EYCPKGSLQDVLENEQIKLD +F+ SLMQD+CRG++YL    G HGNLKSSNCLVDSRFVLKITDFGL   R    + S   SF F++N LWTAPE+L +   T+ P    K DVYSFAIVCQEI+YR GVFYI +     PD +V  V+    PPFRP L+   G ++D++ +I   W +DP++RP F  IKL +R++N AGD + +LDNLL+RMEQYANNLE LV QRT QY EEK++ EDLLYSMLP+SVA QL R +PVTAESFE VTIYFSDI GFT+LSAESTPMQV+ LLN LYTLFD I E+ D YKVETIGDAYMV SGLPQRNG  H R +A MS+AFL  I++F+IPH+P+++L++RIG+H+G VCAGVVG KMPRYCLFGDTVNT+SRMESNG PLKIH+S+ +   L TF  FI+TERG V++KGKG QKTYWLHG    IVD +P
Sbjct:   81 LGVQLGPLGPDN------FAQVLPAIDLALEDIQS-FPAFGGVSFTTVLILYIDALACDALALLTQLNSNGVNVIFGPLNDFTLANAARFSTAMYNVPIVAPAGFAHQLSDKLEYGMLTRVLFTYSDLEWVFGNTLKHYGWLPDQQTPIAIVTTRNVRRREGVVGHT--GMAGVFQHLILQKFLVKAAYKLLSVTLDDEFDV---------TDRFLKRLPDSARIIILCT-DPEVVRDIMLEAHKLNMVNGDYAFFNMDLLSSQTKLKRPWYRETSSPEENERARQAYRALMTVTLLKPDSPEYRTFTEEVRARALRDYDFSYRDSEVTPFIGTFHDAVKLYALALNDALAKGGTITNGTLITQEMWNRTFKGVTGVVRIDANGDRNADYSLLDMNPVTGDFEVVVNYFGNDKSLSTVLGRTIDWINTDNQPPLHTPPCGFDGSECHNSHFIHIGIVGAVVFILLMTMSLVLGIIFYRRAKFQAELRAMNWIIPWDALQVTEKHLRR--------------------------------YRRESDIRSPNQ------SSDPLRKISSETCT----------------AAAANSQMFARTAFYMKSIVALKPLRRQTR-MEPSKALSIEVKKVKDLNCDHICRLIGVCLEVPHQCIVYEYCPKGSLQDVLENEQIKLDWMFKFSLMQDICRGVMYLHQIFGPHGNLKSSNCLVDSRFVLKITDFGLPHIRGPPPLESEVGSFIFHRNLLWTAPELLPDGDTTIYPRESIKGDVYSFAIVCQEIVYRKGVFYIQNFKNCEPDFIVKEVKAHRKPPFRPTLDSLEGCSEDLVQLICQAWDDDPSVRPDFQSIKLSMRKLNKAGDSNNVLDNLLSRMEQYANNLEELVEQRTAQYLEEKKKTEDLLYSMLPRSVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQVVELLNRLYTLFDGIIENFDAYKVETIGDAYMVASGLPQRNGNKHAREVARMSIAFLKAIFEFQIPHRPEKRLELRIGIHSGPVCAGVVGQKMPRYCLFGDTVNTSSRMESNGLPLKIHISQQTFDVLKTFKSFIMTERGLVEMKGKGRQKTYWLHGEDCYIVDPIP 1122          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8JDN4 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 500/1045 (47.85%), Postives = 682/1045 (65.26%), Query Frame = 1
Query:  460 GPVNDFLLANVVRYSSYR-YKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYI------WHK-FDAYECNFQT--RPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLN--RSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPP-ITPWXXXXXXXXXXXXXXXXXXXXXXRKKMK--TELESMDWKINWCDIETQEK-RQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHD--SFQFYKNKLWTAPEVLRNP-TLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKI--ENPPFRPRLEDERGINKD------IISIIRSCWQEDPNLRPGFAQIKLKLRRIN-GAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVD 3510
            GP   F LA V RY+ Y  Y+ PI+T+ G A++L DK+ Y  L R+     D+E +   IF  +NW P+    ++  Y+       HK  D     F    R  ++   ++ ++++ L  + +  T   F +     +   RE  R+ ++CA   + VR+IM+ AH L   NGEYV+FNIDL +++    +PWY   DS + N  A  A+R+++T++ R+P+   Y DF  KVK  +K  Y+++Y  ++ NS VG FHDAV+LY LA+N TL+ +    I++G  + + + + +F GITG + I+ NG   ADYSLLDMD+ T NF VV  +YG  K   +   + IDW ++ N  P D P CGFD  +C   ++   +  + ++++ I ++  ++  I +K++  +EL +M+W+I W ++E  E+   RRRS+ S + +    P     Q   +  ++     +A+     PNE      Q +       + S    S+ S+ T+AG+ LSQ+   Q+FAKTA YK N+VALK + L  +R+E+N +IL +IK VKDL +++I RFIG CLD  NEC++TEYCPKGSLQD+LEN+ + LD +F+ SLM D+CRGM+YL  + G HGNLKSSNCLVDSRF LKI DFGL + R  +E+   D   +  Y+NKLWTAPE+LRNP T P  G  + DVYSF I+ QEIIYR GVFYISD D   P  +++++R+     PPFRP L  E  ++ D      ++ I+RSCW EDPN RP F  +K ++ R N  A  G+ILDNLL RMEQY+NNLE LVA+RT QY EEK++AE+LLY MLPK VA  L++GE VTAE F+ VTIYFSDICGFTALS+ESTPM+V+ LLN+LYTLFD I E +D YKVETIGDAYMVVSGLP RNG +H R IA MSL+FL  I+ FKI HKPD QLK+RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG PLKIH+S  +   L+  G F+ TERG V++KGKG+QKTYWLHG  +NIVD
Sbjct:   37 GPFCTFCLAAVARYNRYYLYQKPIITS-GAAANLEDKEEYYNLIRVGPMNFDIENMLLAIFQRYNWLPRQQQNLLIIYVPDDETQLHKQRDETRVTFSRLLRTTIENRFSHQHRYI-LRVKPYSATNKHFQSEVFRCM---REEVRLVVLCA-DPDTVREIMIKAHELGFINGEYVFFNIDLFSSERLTSRPWYRKTDSNERNAAASVAYRALMTITLRKPNSTEYRDFSDKVKAAAKQNYSFEYPEEEVNSFVGAFHDAVLLYALAINDTLATHGLAGISNGSLITSRMKSRTFKGITGTVSINANGDRNADYSLLDMDKNTKNFTVVAHYYGNTKRYELVSGKVIDWFSKDNLPPPDVPKCGFDNSRCKKDLSEMAIYAVIVLLVLICVLSVLIGVIYRKLRLESELHAMNWRIAWSELEPTERLAARRRSMASQSSRLRERPSDSGAQRTQTFGNHQQEGEEAQPLNPTPNE----QQQQDEDPAIAPKGSDVVSSNDSVETIAGVPLSQIPVAQLFAKTAYYKGNLVALKQIYLRNKRLEVNNKILMEIKRVKDLASDNIVRFIGACLDSPNECLVTEYCPKGSLQDILENDNLNLDWMFKFSLMLDICRGMIYLHHSFGSHGNLKSSNCLVDSRFSLKIADFGLHSLRGSKELKERDDSDYSSYRNKLWTAPELLRNPSTAPAEGTREGDVYSFGIIAQEIIYRKGVFYISDYDFPEPQDIIEKIRQPVGSQPPFRPSLSQEL-VDLDGERVQALLGIVRSCWHEDPNARPNFNAVKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVARRTDQYLEEKKKAENLLYCMLPKQVATTLMKGESVTAEWFDSVTIYFSDICGFTALSSESTPMEVVNLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPGRNGNLHAREIARMSLSFLRNIFSFKIRHKPDAQLKLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSLTYAILEEIGGFVTTERGEVEMKGKGLQKTYWLHGENDNIVD 1070          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8GAT2 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 513/1128 (45.48%), Postives = 696/1128 (61.70%), Query Frame = 1
Query:  274 SQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYR-YKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFW----YIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRS--ITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPP-ITPWXXXXXXXXXXXXXXXXXXXXXXRKKMK--TELESMDWKINWCDIETQEK-RQRRRSL-----------NSANKKSASIPI----------FIHNQLNDSRNSYLNPKYQAKAS---KEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIG----REISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERG-INKD----IISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPT 3522
            S   L +VLP +DVA+   ++   L  N T  +  +DS    ++ P++ + M  +   +++LGP   F L  V RY+ Y  Y+ PI+T+ G AS L++K  Y  L R+  +++ +E +  KIF  +NW P+   TV+       I  +    E       +M +          +S     LT           L ++ E  RI ++CA   + VRDIM+ A  L   NGEYV+FNIDL +++   ++PW   ND+ + N  A  A+RS++T++ R+P+   Y +F  +VKE +   YN+ Y  ++ NS VG FHDAV+LY LA+N TL  + S  I +G  V   + + SF GITG + I+ NG   ADYSLLDMD+ TG F VV  + G  K   + +DR IDW NE+N  P D P CGFD   C   +T   +  + ++++ I  +  ++  I +K++  +EL  M+W+I W ++E  E+   RRRSL            +  KK A +            F  N     R++  +P   A  +   +      +           S S V   S S  S+ T+AG+ LSQ+ + Q+FAKTA YK  +VALK L L  +RIE+   +L ++K VKDL ++++ RFIG CLDP NEC++TEYCPKGSLQD+LEN+ + LD +F+LSLM D+CRGM+YL  + G HGNLKSSNC+VDSRF LKI DFGL + R      R+  + D +  Y+NKLWTAPE+LR P  P  G  + DVYSFAI+CQE+IYR GVF++SD D I P  +V+RVR  +NPPFRP L +E   +  D    + +++  CW EDP  RP F   K ++ R N   + G+ILDNLL RMEQY+NNLE LVA+RT QY  EK++AEDLLY MLPK+VA  L+RGE VTAE F+ V+IYFSDICGFTALS+ESTP+QV+TLLN+LYTLFD I E +  YKVETIGDAYMVVSGLP+RNG  H   I+ M+L+FL+ IY F+I H P  QLK+RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG PLKIH+S ++   L   G F+ T RG V++KGKG Q TYWLHG  + IVD  P 
Sbjct:    7 SHMSLERVLPVVDVAVASAQSV-GLLSNVTVRLLSNDSECDYSIAPVVGMLMLRE--VDLMLGPYCSFCLGAVARYNRYHLYQRPIITSGGGASVLNNKVEYYNLIRVGPSHEQIEEMLLKIFKHYNWRPRPVQTVLVVGPPDEINSRQHQSESIISDALVMSVAIEKMLTQPNVSYIARRLTYKPGRPHLATQLFKVLEEVRIVVLCA-DPDTVRDIMIRAEELGFINGEYVFFNIDLFSSEKLTVRPWRRVNDTAERNSKAFRAYRSLMTITLRKPNSPEYRNFSRQVKELAYHKYNFTYPEEEVNSFVGAFHDAVLLYALAINDTLREHGSEGIRNGSLVTEKMKSRSFEGITGTVSINKNGDRNADYSLLDMDKDTGEFAVVAHYNGNKKVYELVKDRQIDWNNEENLPPKDIPTCGFDYSLCKKDLTQMALYAVVVLLVLICFLTILIFVIYRKLRLESELHGMNWRIAWEELEPTERVAARRRSLAQPQPPPPQKQTTNKKKRARLNQKKQQQQQPHWFFANHHGTKRSNRGDPDEAAAETLPLRPSGGGANDSGGGDIGAGDSQSVVQMDSASMESVETIAGVPLSQIPTAQLFAKTAYYKGTLVALKQLNLRNKRIEVTNRLLMEVKRVKDLASDNVVRFIGACLDPPNECLVTEYCPKGSLQDILENDNLNLDWMFKLSLMADICRGMIYLHHSFGSHGNLKSSNCMVDSRFSLKIADFGLQSLRSNKLEYRDKEDGD-YSTYRNKLWTAPELLRLPNPPFEGTKEGDVYSFAIICQEVIYRKGVFFLSDSDFIEPQDIVERVRTPQNPPFRPALVEEMSDLEPDRTAALTAMVELCWHEDPGARPTFNAAKSRISRFNKTAESGNILDNLLKRMEQYSNNLESLVAKRTDQYQVEKKKAEDLLYCMLPKAVATTLMRGEAVTAEWFDSVSIYFSDICGFTALSSESTPLQVVTLLNDLYTLFDRIIEQYSCYKVETIGDAYMVVSGLPERNGNRHAGEISRMALSFLNNIYSFEIRHMPGVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISATTHELLTDIGNFVTTVRGEVEMKGKGKQLTYWLHGEGDKIVDPPPA 1129          
BLAST of Guanylate cyclase vs. TrEMBL
Match: V4AEX2 (Guanylate cyclase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237906 PE=3 SV=1)

HSP 1 Score: 891.723 bits (2303), Expect = 0.000e+0
Identity = 508/1122 (45.28%), Postives = 680/1122 (60.61%), Query Frame = 1
Query:  196 IIKPLDKSNESSLEIKIAVLLPNDSKSQCQLIKVLPAIDVAIDH-VKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAY------ECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRE-NARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFY-NYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXX----XRKKMKTELESMDWKINWCDI-----ETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            ++  L  +N  ++++ I V+LP   K    L +  PAI+ AI+H + +  N+       I+Y DS  S   GPL AID++    A+V +GP  D+ +A + R+S  R+ +P+L+A    S  SDK  Y +LTR+ G+Y      F K+ A FN+            I+H F          C+F    I    ++  YK     D  +   +    N+  + L++    + R+ ++CA   + VR+IM+ AH L   NGEYV+FNIDL +++     PWY  +D+ + N  A+ A+ +++TV+ R+P    Y  F  +VK K+K  Y N+ Y  ++ NS VG FHDAV+LY  ALN+TL  N SI+DG  +   +WN +F GITG + ID NG   ADYSLLD++     F VV  ++G  K     + + I WA  +   P D PVCGFDG  CPP  P+    + I+V+  +LVI +V         K++ EL  M+W++ W DI     E   K +R+ S  S                       LN KY   +S  G                                T+A + L+   + Q+F KT  YK  IVA+K +  +   I I + +L +IK +KDL N+HI R  G C+DP + C +TEYCPKGSLQDVLEN+QIKLD +FR S+MQD+ RG+ YL  S I  HGNLKS+NC+VDSRFV+KITDFGL  FR   +    +S+ FY  KLWTAPE+LR  T  P G  K D+YSF+I+CQEI+YR+GVFY+ ++D+   +I V     +  P FRP L+D    + ++ +IIR CW EDP  RP    +K  +R++N  GD G+ILDNLL+RMEQYANNLE LV +RT  Y EEK++AE+LLY MLPK VAGQLIRGE V AE+F++VTIYFSDICGFTALSAESTPMQV+ LLN+LYT FDSI E+ DVYKVETIGDAYMVVSGLP RNG +H R I+ MSLA L  +  F+I H+PD+QLK+RIG+HTG V AGVVG+KMPRYCLFGDTVNTASRMESNG PLKIH+S  +K  LD FG F +  RG +D+KGKG Q TYWL G K++
Sbjct:    9 LVNALYINNIEAVDLHIGVILPFKGKFPWVLKRTKPAIEFAINHSIPSTFNVI------INYRDSECSDTEGPLAAIDLYVQKRAHVFIGPACDYAVAPIARFS-LRWGIPVLSAGALVSAFSDKSEYSLLTRVQGSYAKAGGCFVKLCADFNFRS-------IGLIYHDFRNRPNGINSNCHFTMEAIFLAVRS-AYK-----DPWYKSFDQTSKNNDFSALLQAASMHTRVVVLCAAPES-VREIMIKAHELNFDNGEYVFFNIDLFSSKNASQTPWYKADDTPERNEAARLAYDALMTVTLRKPTSPEYKTFSEEVKRKAKELYPNFTYGEEEVNSFVGAFHDAVILYATALNETLEANGSISDGAAITKRMWNRTFEGITGTVSIDANGDRNADYSLLDLNPENDKFEVVANYFGNKKQYEKVKGKEIHWAGGRTEPPPDVPVCGFDGSLCPPEEPFPEYGIVIIVLGSILVIVLVTVFFIYRHIKLEAELAEMNWRVKWDDILFGSPEKNHKLERQGSRIS-----------------------LNRKYSYASSCSGD-------------------------------TIA-VHLNDAGNRQLFTKTGYYKGAIVAVKPI--QRTNITITKPLLIEIKRMKDLQNDHIVRLSGACIDPPHCCTLTEYCPKGSLQDVLENDQIKLDWMFRYSIMQDILRGLSYLHTSEIRVHGNLKSTNCVVDSRFVVKITDFGLRYFREVEKEEEDESYAFYNKKLWTAPEILRISTKNPCGTQKGDIYSFSIICQEIVYRNGVFYLHNLDLSPKEIYVKVRNGLR-PYFRPTLDDYDCPSDELANIIRRCWAEDPAERPDCQALKSLIRKLNRDGDKGNILDNLLSRMEQYANNLEALVEERTADYLEEKKKAENLLYLMLPKPVAGQLIRGESVAAETFDQVTIYFSDICGFTALSAESTPMQVVNLLNDLYTTFDSIIENFDVYKVETIGDAYMVVSGLPVRNGNLHAREISRMSLALLDAVLSFRIKHRPDEQLKLRIGLHTGFVVAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSTQTKETLDNFGTFEVELRGQIDMKGKGTQTTYWLLGEKQS 1051          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 401/1092 (36.72%), Postives = 594/1092 (54.40%), Query Frame = 1
Query:  109 ALMLSIFIVFLITLYLCSLCQAGKSYITRIIKPLDKSNE----SSLE-IKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNS-----SLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWH--KFDAYECNFQTR-PIMDIFKTN-GYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKG--LQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPR----------------LEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTG 3264
             L+ S+++  L+ L       AG S     ++PL +       SSL  I +A++LP  +++      +V PA++ A++ V ++  L       + +S S +     S +V PL+A+D+   +     +GP  D+  + V R++++ ++VP++TA   A   +   +Y  +T    T+K +     ++   F W    Y  V+F    H  K D   C F    P  ++   N   K +  +++   L+    +N        I +  R+  +C K   + R +M+  +  +L   EYV+F IDL    ++    +PW        ++  AK+AF+SV  +++R+P +  Y  F+ K+K  +K  +N+  +    N   G FHD V+LY  ALN+++  +     G  V   +WN +F+G+TG + +D+NG    D++L DM D  +G + +V  +    K +V+     + W   K S P D PVCGF  D   C    +T   +  +    I I++V   V   RK K++ EL +  W++ W DI+         +L+ A +++ S                     +   S  G N  S                         LLTL G       + Q++AKT  YK NI A+K++    +RIE+ R++LF++K ++D+ N H+ RFIG C+D  N CI+TEYCP+GSLQD++E E I LD +FR SL+ D+ +GM +L  S I  HGNLKSSNCLVDSRFVLKITD+GL++FR  +E    D+  +Y  KLWTAPE++R+    P G  K DVYSF I+ QE+    GVFY                  +++PPF P+                L   +  ++++  +++ CW ED N RP F QIK+ L + N     +ILDNLL+RMEQYANNLE LV +RTQ Y+EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTA+SAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H   IA MSLA L  +Y F+I H+PD QL++RIG+HTG
Sbjct:    7 GLLGSVWLPLLVLL-------AGVSLGVMELEPLSQEESHPAGSSLRNITLAIILPKQNTEYPWAWPRVGPALNWALEKVNSDPTLLPGYHMQLVFSSSENKEGLCSDSVAPLVAVDLKFAHDPWAFIGPGCDYASSPVARFTTH-WEVPMVTAGAPALGFN---MYSSITNTGPTHKKLGEFVVRMHHNFGW--HKYAMVMF----HDKKNDDRPCYFAVEGPYTEMTADNITAKDMVFNEDDEPLSYADLING-------ISQRGRVVYVCCKWDTF-RKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPW---ARGDADDEAAKQAFKSVKIMTYREPQNPEYKHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDMTDTESGVYEIVSVYNSSAKQMVLEPGMKVHWL--KGSPPPDIPVCGFKNDNPACLAKTVTMHQMISIVACFIFIIIVTVTVFIYRKVKLENELAAQLWRVYWEDIQIS-------NLDKALRRACS---------------------RLTLSLRGSNYGS-------------------------LLTLEG-------NVQIYAKTCYYKGNITAIKYVN--KKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFR--KESYLEDTHAYYARKLWTAPELMRDENRQPCGTQKGDVYSFGIILQELALLKGVFY------------------LDSPPFSPKEIVEHVAEGRWPYLRPLLCTQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHKNNRGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTG 986          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 402/1102 (36.48%), Postives = 583/1102 (52.90%), Query Frame = 1
Query:  238 IKIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNAT----FSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIR-IRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQI--KGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVC--GFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAI--YKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIV 3507
            I +AV+LP++ K      +VLPAI +A +H+     L   A     FS+  S  + S     +IA+D    +  +  LGP   + +A+V R++S+ +K+P++TA G A    + + +  L R   T   +      + A FNW+ ++        I+H           RP    F + G     L++ + +       N++   ++  IRE+ RI  IC     +   +      +K T  +Y  F +D     +  +  QPW+      K+ +   + F++V  ++FR+PD+  Y  F  ++ +++   +N   +    +   G F+D  VLY  ALN+ L+   S  DG  +   + N S  G+TG +  D N A + D+SL  M  +T    V G + G NK +V ++ + I WA      P+D P C    +G+       W        V+     +S +   + K++ EL  M W+I W D++ +       S N  +K++ S                     +   S+ G + +   IS    ++               L    G     L + +   K  I   ++ +  LKH+R                    D+  NH+ RF+G C+DP N CI+TEYCP+GSLQ         +++    +L+     GM YL  S IG HGNLKSSNC+VDSRFVLKITD+GL++FR      N DS + Y  KLWTAPE+L     PP G  K D+YSF I+ QEI  R+G FY+  +D+   +I+       + P FRP  ++ R   +++  ++  CW EDP  RP F+ IK+ + ++N  G   IL+NLL+RMEQYANNLE LV +RTQ Y EEKRRAE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT+         V+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L ++  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMES G+ L+IH+S ++K  LD FG F L  RG+V++K K      WL   +E I+
Sbjct:   34 ITVAVMLPDNMKYPWASPRVLPAIRMAREHILRSGMLRDRAVHLLNFSVEDSAGSCSENKAQIIAVDTKLYHRPDAFLGPGCVYSVASVGRFASH-WKLPLITAGGLAYGFDNSEEFRTLVRTGPTTTKLGDFVNSLHAEFNWTRRALL------IFHDLKR-----DDRP--HFFLSEGIYINLLAENMTVEVLPYEDNTSYQEIVTFIRESGRIVYICGPLQTFFNIMSTFEEEVKNTE-DYAIFYLDAFGESLSNEAHQPWHTSAMQWKDPI---KLFQNVFVITFREPDNPEYAAFRTELHKRATQDFNVQLEPSLMDYIAGCFYDGFVLYATALNEALADGVSQNDGINITTRMLNRSIWGVTGLVSTDQNNARYTDFSLWSMSNLTTGQYVAGHYNGTNKEIVWSK-KGIQWA---KGIPIDDPRCLVSCEGRS------W--------VLLFFKGLSYIGNRKLKLEKELARMLWRIKWEDLQFE-------SPNKYHKRAGS---------------------RLTLSQRG-SSYGSLISAHGKHQ---------------LFAKTGYFKGNLVAIKHVNKKRIELTRQVLFELKHMR--------------------DVQFNHLTRFVGACIDPPNICIVTEYCPRGSLQ---------VNTYASCTLL-----GMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFR--SSYDNEDSHELYARKLWTAPELLIYDRPPPQGTQKGDIYSFGIILQEIALRNGPFYVEAMDLSPKEIIQKVRNG-QRPYFRPTTDNSRHC-EELTILMEGCWAEDPTERPDFSHIKIFITKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRRAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTS--------NVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHMSSATKEVLDEFGYFDLQLRGDVEMKVK------WLFLKEELIL 1003          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 302/520 (58.08%), Postives = 383/520 (73.65%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            G  L+   + Q+FAKTA +K NIVA+K++    +RIE+ R++LF++K ++D+ N+H+ RFIG C+DP N  I+TEYCP+GSLQD+LENE I LD +F+ SL+ D+ +GM +L  S I  HGNLKSSNC+VD+RFVLKITD+GLS+FR   E    D+  +Y  KLW AP++LR    P  G  K D+YSF I+ QE+  R GVFYI    +   +IV       E P  RP + + +  ++++  +++ CW E+P  RP F+ IK+ LR+ N     DILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT+LSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+PDQQLK+RIG+H+G VCAGVVG+KMPRYCLFGDTVNT+SRMESNG+PLKIHVS +S   L  F  F L  RG+V++KGKG  +TYWL G
Sbjct:  553 GSLLTADGNFQVFAKTAYFKGNIVAIKYVNR--KRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRT--ESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEGDSLSPKEIVDRVALG-EWPYLRPTV-NTQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREVSRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLG 1066          

HSP 2 Score: 148.673 bits (374), Expect = 8.439e-36
Identity = 129/511 (25.24%), Postives = 236/511 (46.18%), Query Frame = 1
Query:  238 IKIAVLLPNDSKS-QCQLIKVLPAIDVAIDHVKNERNLFRNATFSISY-----SDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKK-IYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQI--KGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDA--NSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNS 1719
            IK+AV+LP  + S      +V PAID A+  V +  +L    +    +     +D   S ++ PL+A+D+   +     +GP  D+  + V  ++++ + +P++TA   A   SD+   Y  +T    T+K +      I   F WS  +    +  +   K    EC F    +    K      ++L     +  E     +   +L +I+E  R+  +C  S +  R +M+      L   E+V+  ID+    +  + +QPW        ++ +AK+A++SV  +++R+P +  Y DF++ +K  +K  +N+   +DD+  N   G F+D ++LY  ALN++L+ +      + +   +WN ++ G+TG + ID +G    D++L DM D  +  F +V  + G  K +         W       P D P CGF  D   C    IT   +  + +  I +++    V   RK K++ EL +  W+I+W D++     +  RS  S
Sbjct:   49 IKLAVILPKTNTSYPWAWPRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSESIAPLMAVDLKFAHEPWAFIGPGCDYTSSPVGLFTTH-WGLPMITAGAPAVGFSDRSDAYTSITNTGPTHKKLGEFALHICRHFGWSQHA----LLMFGDSKMGERECYFAVEGLYTELKEVNITTVDL-----VFEEDSRPVNYSEHLQKIKEEGRVVFVCC-SPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPW---ARGDADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNF--TVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWPG--GFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMSNLEKVLRSAGS 541          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 302/520 (58.08%), Postives = 383/520 (73.65%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            G  L+   + Q+FAKTA +K NIVA+K++    +RIE+ R++LF++K ++D+ N+H+ RFIG C+DP N  I+TEYCP+GSLQD+LENE I LD +F+ SL+ D+ +GM +L  S I  HGNLKSSNC+VD+RFVLKITD+GLS+FR   E    D+  +Y  KLW AP++LR    P  G  K D+YSF I+ QE+  R GVFYI    +   +IV       E P  RP + + +  ++++  +++ CW E+P  RP F+ IK+ LR+ N     DILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT+LSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L  +  FKI H+PDQQLK+RIG+H+G VCAGVVG+KMPRYCLFGDTVNT+SRMESNG+PLKIHVS +S   L  F  F L  RG+V++KGKG  +TYWL G
Sbjct:  553 GSLLTADGNFQVFAKTAYFKGNIVAIKYVNR--KRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRT--ESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEGDSLSPKEIVDRVALG-EWPYLRPTV-NTQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREVSRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLG 1066          

HSP 2 Score: 148.673 bits (374), Expect = 8.439e-36
Identity = 129/511 (25.24%), Postives = 236/511 (46.18%), Query Frame = 1
Query:  238 IKIAVLLPNDSKS-QCQLIKVLPAIDVAIDHVKNERNLFRNATFSISY-----SDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKK-IYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQI--KGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDA--NSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNS 1719
            IK+AV+LP  + S      +V PAID A+  V +  +L    +    +     +D   S ++ PL+A+D+   +     +GP  D+  + V  ++++ + +P++TA   A   SD+   Y  +T    T+K +      I   F WS  +    +  +   K    EC F    +    K      ++L     +  E     +   +L +I+E  R+  +C  S +  R +M+      L   E+V+  ID+    +  + +QPW        ++ +AK+A++SV  +++R+P +  Y DF++ +K  +K  +N+   +DD+  N   G F+D ++LY  ALN++L+ +      + +   +WN ++ G+TG + ID +G    D++L DM D  +  F +V  + G  K +         W       P D P CGF  D   C    IT   +  + +  I +++    V   RK K++ EL +  W+I+W D++     +  RS  S
Sbjct:   49 IKLAVILPKTNTSYPWAWPRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSESIAPLMAVDLKFAHEPWAFIGPGCDYTSSPVGLFTTH-WGLPMITAGAPAVGFSDRSDAYTSITNTGPTHKKLGEFALHICRHFGWSQHA----LLMFGDSKMGERECYFAVEGLYTELKEVNITTVDL-----VFEEDSRPVNYSEHLQKIKEEGRVVFVCC-SPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPW---ARGDADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNF--TVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWPG--GFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMSNLEKVLRSAGS 541          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 299/541 (55.27%), Postives = 381/541 (70.43%), Query Frame = 1
Query: 1918 LLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPR----------------LEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            LLTL G       + Q++AKT  YK NI A+K++    +RIE+ R++LF++K ++D+ N H+ RFIG C+D  N CI+TEYCP+GSLQD++E E I LD +FR SL+ D+ +GM +L  S I  HGNLKSSNCLVDSRFVLKITD+GL++FR  +E    D+  +Y  KLWTAPE++R+    P G  K DVYSF I+ QE+    GVFY                  +++PPF P+                L   +  ++++  +++ CW ED N RP F QIK+ L + N     +ILDNLL+RMEQYANNLE LV +RTQ Y+EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTA+SAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H   IA MSLA L  +Y F+I H+PD QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVSE+++  L  F  F L  RG++++KGKG  +TYWL G
Sbjct:  535 LLTLEG-------NVQIYAKTCYYKGNITAIKYV--NKKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFR--KESYLEDTHAYYARKLWTAPELMRDENRQPCGTQKGDVYSFGIILQELALLKGVFY------------------LDSPPFSPKEIVEHVAEGRWPYLRPLLCTQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHKNNRGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDIEMKGKGRMRTYWLLG 1046          

HSP 2 Score: 137.502 bits (345), Expect = 2.697e-32
Identity = 103/393 (26.21%), Postives = 192/393 (48.85%), Query Frame = 1
Query:  238 IKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNS-----SLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWH--KFDAYECNFQTR-PIMDIFKTN-GYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKG--LQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM 1380
            I +A++LP  +++      +V PA++ A++ V ++  L       + +S S +     S +V PL+A+D+   +     +GP  D+  + V R++++ ++VP++TA   A   +   +Y  +T    T+K +     ++   F W    Y  V+F    H  K D   C F    P  ++   N   K +  +++   L+    +N        I +  R+  +C K   + R +M+  +  +L   EYV+F IDL    ++    +PW        ++  AK+AF+SV  +++R+P +  Y  F+ K+K  +K  +N+  +    N   G FHD V+LY  ALN+++  +     G  V   +WN +F+G+TG + +D+NG    D++L DM
Sbjct:   25 ITLAIILPKQNTEYPWAWPRVGPALNWALEKVNSDPTLLPGYHMQLVFSSSENKEGLCSDSVAPLVAVDLKFAHDPWAFIGPGCDYASSPVARFTTH-WEVPMVTAGAPALGFN---MYSSITNTGPTHKKLGEFVVRMHHNFGW--HKYAMVMF----HDKKNDDRPCYFAVEGPYTEMTADNITAKDMVFNEDDEPLSYADLING-------ISQRGRVVYVCCKWDTF-RKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPW---ARGDADDEAAKQAFKSVKIMTYREPQNPEYKHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDM 396          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 393/899 (43.72%), Postives = 537/899 (59.73%), Query Frame = 1
Query:  853 RENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNID-----LSANQI-KGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAI--YKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSL-QDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIEN---PPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKE 3498
            R+   +   C  ++ + R  M+ AH   +T G+YV+F +D     LS + + +  +PW   ++  +    AKEA+++V+ +S+R+P +  Y DF++K+K+++K  +N+  +    N   G F+DA+++Y  ALNKTLS    + DG  +   +WN ++ G+TG+  ID NG    D+SL D+ D  TG F VV ++ G +  L+      I W     S P D P+CGF+ + C     +   V ++   +I +++ +S  +  RK K++ EL SM W++ W +I+     + RRS  S                            +   S  G +  S   +Q  N                 +    G     L + +   K  I   +E +  LKH+R                    D+ N H+ RF+G C+DP N CI+TEYCP+GSL QD+LENE I LD VFR SL+ D+ +GML+L  S IG HG+LKSSNC+VDSRFVLKITD+GL++FR   E    D    Y  KLWTAPE+LR    PP G  K DVYS  I+ QEI  R+G FY             + V+K++N   P FRP   DE    +++  +++ CW EDP  RP F+QIK+ + + N     +ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT+LSAESTPMQV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG ++ + IA MSLA L  +  FKI H+ + +LK+RIG+HTG VCAGVVG+KMPR+CLFGDTVNTASRMESNG+ LKIHVS+++K  LD FG F L  RG+V++KGKG  +TYWL G  E
Sbjct:    1 RDCVSVVYFCCSAAVF-RQTMVQAHAEGMTAGDYVFFYVDPFSESLSESNVSESRKPWKRGDEFDEQ---AKEAYKAVMIISYREPQNIEYKDFVVKLKKRAKEQFNFTIEDTLMNLIAGSFYDAIMMYTAALNKTLSSGGGVHDGHAITKHMWNRTYRGVTGEFTIDRNGDRETDFSLWDLTDMNTGEFNVVLSYDGASSKLIEVPGLEIQWPG--GSIPKDVPLCGFENEACISGGFSTMEVLMIVFSLILLIVAVSSFLIYRKLKLEKELASMLWRLRWENIQVSSLEKARRSAGS----------------------------KLTLSMRGSSCGSLLTTQGRN----------------QMFAKTGYYRGNLVAIKPINKKKIELTREVLFELKHMR--------------------DVLNEHLTRFVGACIDPPNICIVTEYCPRGSLQQDILENESITLDWVFRYSLINDIVKGMLFLHNSVIGSHGSLKSSNCVVDSRFVLKITDYGLASFRSCSEC--EDMHSLYAKKLWTAPELLRLEHPPPQGTQKGDVYSLGIILQEIALRNGTFY----VEGMDLSPKEIVQKVKNGQRPYFRPS-TDESCHIEELGLLMQRCWAEDPAERPDFSQIKMLIHKFNKENSTNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGEIE 822          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 279/494 (56.48%), Postives = 359/494 (72.67%), Query Frame = 1
Query: 2032 RRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQST-IGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDG-------DILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            ++IE+ R++LF++K ++D+ N H+ RF+G C+D  N CIITEYCP+GSLQD+LENE I LD +FR SLM D+ +GMLYL S+ IG HGNLKSSNC+VDSRFVLKITD+GLS+ R   +  +  S  +++ +LWTAPE+LR   + P G  K DVYSFAI+ QEI  RSG FY+    + + +IV       E P  RP + D  G ++++  +++ CW E+   RP F QIK+ L++ +   DG        ILDNLL+RMEQYANNLE LV +RTQ Y EEK +AE LLY +LP SVA QL RGE V AE+F+ VTIY SDI GFTA+SA+STPMQV+  LN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP  NG  H   +A M+LA LS +  F I H+P Q+L +RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRME+ G+  +IH+S ++K  LD +G F++   G+VDIKGKG  +TYWL G
Sbjct:   13 KKIELTRQMLFELKHMRDVQNEHLTRFVGACIDVPNICIITEYCPRGSLQDILENESISLDWMFRYSLMHDIVKGMLYLHSSVIGSHGNLKSSNCVVDSRFVLKITDYGLSSVRAHSKADS--SANYFEKRLWTAPELLRLEEVAPRGTQKGDVYSFAIILQEIALRSGPFYLEANHLTAKEIVQRVKLG-EWPYLRPTV-DPGGHSEELGHLMQRCWAEESTERPDFHQIKILLQKFSSQDDGPESPPAFTILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLG 502          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 432.565 bits (1111), Expect = 5.223e-137
Identity = 246/510 (48.24%), Postives = 330/510 (64.71%), Query Frame = 1
Query: 1981 AIYKENIVALKHL-RLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGR-----EISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
             IY+ N VALK L R     ++ NR   F +K ++++ + ++  F G+C++  N CI+T+YC KGSL+DVL+    +LD +F+ S   D+  GM++L +S I  HGNLK S CL+DSR  +K+T FG+  FR G+     +I+N  SF  +    WTAPE+LR   LP  G  K DV+SFAI+ +E+IY         + +   DI+      I  PP RP L +       I ++IR CW E  + RP F+ +   LR  +  GD +ILDN+++++E+YAN+LE +V  RT Q   EK++ + LL S+LP  V  QL  G+ V  E +E VTI+F DI GFTA+SA STP++VI LLN+LY L D I +++DVYKVETIGDAYMV SGLP RNG+ HV  IA MSL FLS I  F+I H P +QLK+RIG+++G V AGVVG  MPRYCLFGDTVN ASRMES G PL IHVSE++   L   G + L ERG +++KGKG Q TYWL G
Sbjct:  215 GIYQGNQVALKFLERTHPPDLKSNR---FALK-MREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINNLGSF--FIELYWTAPELLRMEDLPVNGTPKGDVFSFAILMREVIYHEDEGPYVGIHLEPKDIIDQVRDGIAVPPLRPLLTER--CEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGDMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKG 716          

HSP 2 Score: 55.8398 bits (133), Expect = 5.698e-8
Identity = 36/119 (30.25%), Postives = 58/119 (48.74%), Query Frame = 1
Query: 1198 FHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSS---FNGITGKIIIDDNGAGFADYSLLDMDQ---ITGNFLVVGTFYGKNKTLVMARD-RNIDWANEKNSAPLDTPVCGFDGKKC 1533
             HDA +LY +A+ + L    +  DG  V   I  S+   F G +G++ ID NG  F DY++ D+ +    TG   +    Y   +T+    + + + W + +   P D P CGF G+ C
Sbjct:    4 LHDAGILYAMAVRELLRQGGNPRDGRAVIRTIRGSNKIKFYGASGQVSIDVNGERFLDYAVFDLQKKQTATGEMRIASKRYFTFQTINFTPEYQKMGWPDGR--PPSDMPECGFTGELC 120          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 437.958 bits (1125), Expect = 5.061e-135
Identity = 241/515 (46.80%), Postives = 334/515 (64.85%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGR-----EISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            +MF    IY+ N VALK L+        ++ +L +++ +++L + ++  F G+C++  N CI+T+YC KGSL+DVL+    +LD +F+ S   D+  GM++L +S I  HGNLK S CL+DSR  +K+T FG+  FR G+     +++N D  + +    WT+PE+LR    P  G  K DV+SF ++ +E+IY         VD+   +I+        +PP RP L +       I ++I+ CW E P+ RP F  I   LR  +  G   ILDN+++++E+YAN+LE +V  RT Q   EK++ + LL S+LP  V  QL  G+ V  E FE+VTI+F DI GFTA+SA S+P++VITLLN+LY L D I +++DVYKVETIGDAYMV SGLP RNG+ HV  I+ MSL FLS I  F+I H P +QLKIRIG+++G V AGVVG  MPRYCLFGDTVN ASRMES G PL+IHVSES+   L + G + L ERG + +KGKG Q TYWL+G
Sbjct:  543 KMFTPLGIYQGNQVALKFLQRTRPPDLKSKTLLKELQMLRELRHENLVVFFGVCVEMPNICIVTQYCRKGSLKDVLKTSDFELDLMFKTSFAYDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRHGKKGKIMDVNNQDIAELF----WTSPELLRMEIFPVNGTPKGDVFSFGVLMREMIYHEDEGPYVGVDMEPKEIIDQVREGKCSPPLRPLLTER--CEPRIQALIQRCWDESPDRRPDFHSIARMLRSASPEGHRSILDNMVSKLEKYANHLEEVVEDRTAQLESEKKKTDRLLSSLLPSVVVEQLKAGKTVQPEHFEQVTIFFCDIVGFTAMSAISSPLEVITLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEISIMSLHFLSSIINFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLNG 1051          

HSP 2 Score: 95.1301 bits (235), Expect = 5.603e-20
Identity = 96/448 (21.43%), Postives = 181/448 (40.40%), Query Frame = 1
Query:  244 IAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVAN----VLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFW-YIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITI-ICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEK--SKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSS---FNGITGKIIIDDNGAGFADYSLLDMDQITGN---FLVVGTFYGKNKTLVMARD-RNIDWANEKNSAPLDTPVCGFDGKKCPPI 1542
            I +  P    +   ++++  A+ +A D + +      N TF+ +Y+D     A    +++D F   V       LLGPV     + V    + ++ VP+L   G+   +    +Y    R+    + M ++ E     F W+  +          W   D    + +      +  T   K+      +H             NL+ I   ARI I IC   S   R+++L A  L L  G++++  +    +       ++    +++ +    +A   V+  + +      Y  F+ +V+ +     FY+      + +      HDA +LY +A+ + L    +  DG  +   I  S+   F G++G++ ID NG  F DY++ ++ Q  GN   FL V  F     ++    + + + W   +   P D P+CGF G+ C  I
Sbjct:   19 IGLQAPQALSNPFSVMRLGAALQIAFDSLNSNPTFMPNHTFAFTYADC----ACDAKVSLDSFVTQVREKGIIALLGPVCA-EASEVTGLLAAQWNVPMLGFVGHTQRMDSSAVYDTYVRIMSPLQRMGQMLEATMRHFGWTRAAMLGGTAQNSTWANIDELWASVERELARSVTITARIKYDTSDKVLHR-----------QNLLDISTKARIVILICG--SEEAREVLLEAQSLGLATGKFIFLVVQQFEDS------FWKSVAAERLDTQTLQALEPVMLFTIKAYGSSDYELFLQEVRRRLLGPPFYSNLSSDKEVSPYAAYLHDAAILYAMAVRELLRHGGNPRDGRAIVRTIKGSTKVKFYGVSGQVNIDVNGERFLDYAVFNL-QKKGNSSQFLPVMVFDTFQGSISFTPEYQKMVWP--EGGPPNDMPICGFLGELCQEI 439          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 413.305 bits (1061), Expect = 8.584e-131
Identity = 233/488 (47.75%), Postives = 312/488 (63.93%), Query Frame = 1
Query: 2053 EILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYL-QSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISN------HDSFQFYKNKL-WTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAG-DGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            EI   I  ++++ + ++  F G+C++  N CI+T+YC KGSL+DVL+    +LD +F+ S   D+  GM++L +S I  HGNLK S CL+DSR  +K+T FG+  FR G++          D++     +L WTAPE+LR   LP  G  K DV+SFAI+ +E   R          +  PDI+      I  PP RP L +       I ++IR CW E  + RP F+ +   LR  +  G   +ILDN+++++E+YAN+LE +V  RT Q   EK++ + LL S+LP  V  QL  G+ V  E +E VTI+F DI GFTA+SA STP++VI LLN+LY L D I +++DVYKVETIGDAYMV SGLP RNG+ HV  IA MSL FLS I  F+I H P +QLK+RIG+++G V AGVVG  MPRYCLFGDTVN ASRMES G PL IHVSE++   L   G + L ERG +++KGKG Q TYWL G
Sbjct:  142 EIPIGIYQMREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINKQEDAWALSSKELYWTAPELLRMEDLPVNGTPKGDVFSFAILMRESTPREWPTATRANRVPFPDIIDQVRDGIAVPPLRPLLTER--CEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKG 627          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 62.7734 bits (151), Expect = 2.520e-10
Identity = 41/136 (30.15%), Postives = 69/136 (50.74%), Query Frame = 1
Query: 1957 STQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSA 2364
            S ++FA   + K +I + K            +++L +I+  K +++ +I +FI    D  N  I+ E CP GSL ++L+  ++  +   R    Q +C  + Y+ S    H +LK  N   DS + LKI DFGL+A
Sbjct:  103 SGEIFAAKTVAKASIKSEK----------TRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQ-ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAA 227          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 62.3882 bits (150), Expect = 3.518e-10
Identity = 44/152 (28.95%), Postives = 71/152 (46.71%), Query Frame = 1
Query: 2077 VKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCR----GMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEI 2520
            +K+L++ +I  + G   + GN  I  EY P GS+  +L N        F  SL+ +  R    G+ YL      H ++K +N L+D +  +KITDFG+S          +       +  W +PEV++         AKAD++S   V  E+
Sbjct:  508 LKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNY-----GPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATT----AKADIWSTGCVVIEM 650          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 62.003 bits (149), Expect = 4.318e-10
Identity = 53/183 (28.96%), Postives = 91/183 (49.73%), Query Frame = 1
Query: 2002 VALKHLRL--EGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNEC-IITEYCPKGSLQDVLENEQIKLDSVFRLS------LMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEII 2523
            VA+K + L  + R+  I  EIL     +KD  + +I  F+   L   ++  ++ E+   GSL D++EN     +S   L+      ++++ C+G+ +L      H ++KS N L+D+R  +KITDFG  A R+  + S   +        W APEV++          K DV+S  I+  E++
Sbjct:  591 VAIKQMVLSKQPRKELIVNEILV----MKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCA-RLTDKRSKRAT--MVGTPYWMAPEVVKQREYD----EKIDVWSLGIMTIEML 762          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 61.2326 bits (147), Expect = 7.996e-10
Identity = 45/186 (24.19%), Postives = 88/186 (47.31%), Query Frame = 1
Query: 1987 YKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFY 2544
            + + +VA+K +  E    E+N +I+ +I  +K+LN+N+I ++ G         I+ EYC  GSL+ ++      L      + +     G+ YL      H ++K++N L+ +   +K+ DFG+S       I N  +        W APE+L N     +    +D++S      E++ ++  ++
Sbjct:   46 HTDQVVAIKEVVYENDE-ELN-DIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVST------IVNSSALTLAGTLNWMAPEILGNRGASTL----SDIWSLGATVVEMLTKNPPYH 219          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 57.7658 bits (138), Expect = 9.895e-9
Identity = 73/273 (26.74%), Postives = 120/273 (43.96%), Query Frame = 1
Query: 1999 IVALKHLRLEGRRIEI---NREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQ---FYKNKLWTAPEVLRNPTLPPVGL---AKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQ-IKLKLRRINGAGDGDILDNLLTR 2787
            + A+K L L+    E+    REI F + S+K ++N  I R+ G  L   +  II E+C  GSL+ +L     K+D  +   +M+++   +  +      H ++K++N L+ +   +K+ DFG++A        N  S +         W APEV+        G+    K D++S  I   EI   +  +   +       I       I++ P  PRLED R  +  +   I  C  EDP  R      +K K  R + A    IL  L++R
Sbjct:   48 VYAIKVLNLDSDSDEVEDVQREIQF-LASLKQISN--ITRYYGSYLKDTSLWIIMEHCAGGSLRSLL--RPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQ------VNQTSLRRQTMAGTPYWMAPEVIME------GVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLI-------IKSKP--PRLED-RSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELISR 293          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 272/515 (52.82%), Postives = 367/515 (71.26%), Query Frame = 1
Query: 1963 QMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQST-IGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDS-FQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLED---ERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGT 3492
            Q+F    IYK N+VA+K  R+  R+IE+ REI +++K ++ + + ++  F G C++P N CI+ +YCPKGSLQD+LENE IKLDS+F  SL+ D+ +GM YL ST I  HG LKS NC+VD R+VLKITD+GL+ F+  ++IS  +  +  Y  KLWTAPE+LR     P G  K DVYSF I+ QE++ RSG F         P  ++++V ++E+PPFRP+L     E      I+ + + CW+E+P+ RP F +I+  +R++      +I+DN++  +E+YANNLE LV +RT Q  +EKR+ E+LL  MLP SVA  L+ G+ VTAE+F++V+I+FSDI GFT+LS+ESTP+QV+ LLN+LYTLFD I  ++DVYKVETIGDAYMVVSGLP RNG  H   IA M+L  L EI  FKI H+P+ +LK+RIG+H+G   AGVVG KMPRYCLFGDTVNTASRMESNG+ LKIH+S S+KR LD  G + + +RG V +KGKG   TYWL G+
Sbjct:    6 QIFTTVGIYKSNMVAIK--RINKRQIELTREIKYEMKLMRTVRHENLVTFTGACVEPPNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPNCVVDGRWVLKITDYGLNKFKSNQDISEEEGEYAMYYRKLWTAPELLRAADPRPRGTQKGDVYSFGIIVQELLTRSGPF-DLSYYTNEPSDIIEKVTRVESPPFRPKLSTIVLEGPTVAGIVDLAKWCWEENPDHRPDFEEIRKTVRKLPMGKQSNIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGS 517          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 505.753 bits (1301), Expect = 1.007e-166
Identity = 257/494 (52.02%), Postives = 351/494 (71.05%), Query Frame = 1
Query: 2023 LEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRI--NGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEI-YKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGT 3492
            L  R I+I+R++L ++K ++D+ ++++ +FIG C+ P N CI+ +YC +GSLQD+LEN+ +KLD VF  SL+ D+ +GM YL  S I  HGNLKSSNCLVDSR+VLKITD+GL   R   + S  ++   +++ LW APE+LR P+ PP G  K DVYSF+I+ QE   R G +     + + P  ++++VRK E PP+RP + +     +++  +++ CW EDP+LRP F +IK  +RRI        +I DN++  ME YA+NLE LVAQRT Q  +EKR+ + LL S+LP+ VA QL +G+ V AESF +VTIYFSDI GFT+LSAESTPMQV+T LN+LYT+FD I +++DVYKVETIGDAYMV SGLP RNG  H   IA M+L  +  + + F + HKP+ +L++R+G HTG V AGVVG  M RYCLFGDTVNTASRMESNG+PL+IH+S+ +K  LD  G F++  RG V +KGKG  +T+WL  T
Sbjct:    8 LPKRTIDISRQLLLEMKQMRDIRHDNLNQFIGACVGPPNVCIVMQYCSRGSLQDILENDDVKLDLVFIASLLSDIVKGMEYLHNSDIRSHGNLKSSNCLVDSRWVLKITDYGLPLLRSRSKKSTIETN--WRDLLWVAPEILRIPSRPPKGTHKGDVYSFSIILQEFHTRDGPY---SANYMEPKAIIEKVRKSEFPPYRPIVANLIDGAEELRDLMKQCWAEDPDLRPDFTEIKKTVRRIVDKSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFLNDLYTIFDDIIQEYDVYKVETIGDAYMVASGLPIRNGRRHAGEIAKMALHLVDAVSHNFIVRHKPEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWLVST 496          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36203 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA1])

HSP 1 Score: 417.542 bits (1072), Expect = 1.127e-133
Identity = 221/476 (46.43%), Postives = 302/476 (63.45%), Query Frame = 1
Query: 1951 LASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGR----EISNHDSFQFYKNKLWTAPEVLRN--PTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNG 3357
            LA    F + +  K  +VALK LR +   + + R++L ++K V+D+ + ++  +IG+C  P N CI+++YC +GSLQ++L N++I LD  FR S   D+  GM  +  S+I  HG+L+SS CL+DSR+V K+ DFGL+  +  +    EI  H     Y    W APE+L+N   T  PV     DVYSF I+  E++ R   +  ++   I     +       NPPFRP    E   N+ +  ++  CW +DP  RP F+ IK +LR + G G   I+DN+L  ME Y   LE +V +RT+Q  +EK + ++LLY MLP+ +A  L RGEPV AES+  VTI+FSDI GFT L+A STP+QV+ LLN+LYT FD+I + HDVYKVETIGDAYMVVSGLP RNG  H   IA M+L  LS +  F+  H P++ + +RIG+HTG   AGVVG+KMPRYCLFGDTVN ASRMES G
Sbjct:   53 LALFPWFCEHSFIKSYLVALKMLRKDS--LTLTRDMLIEMKQVRDVQHTNLLHYIGVCTTPPNICIVSQYCHRGSLQEILANDEISLDWFFRESFANDIAMGMHVIHTSSIHVHGDLRSSKCLIDSRWVCKVADFGLNLLKANQRPDPEIGVHAQ---YSRLFWRAPELLQNEKSTNKPVPTQMGDVYSFGIILNELLTREEPYATTEFAPIEVIERIRCHL---NPPFRPETPFEIR-NRSVTKLMTQCWNDDPQARPTFSDIKRQLRLLKG-GKSSIVDNMLRLMENYTEQLETIVDERTRQLADEKAKTDELLYKMLPRYIAESLKRGEPVIAESYSSVTIFFSDIVGFTELAAASTPLQVVDLLNDLYTCFDTIIDKHDVYKVETIGDAYMVVSGLPVRNGHRHAGEIATMALNLLSSMGNFRARHLPNRPIHLRIGIHTGSCVAGVVGLKMPRYCLFGDTVNYASRMESTG 518          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36182 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA4])

HSP 1 Score: 406.371 bits (1043), Expect = 7.754e-130
Identity = 231/496 (46.57%), Postives = 312/496 (62.90%), Query Frame = 1
Query: 2068 IKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVL---------RNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLED--ERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLP 3519
            +K V+DL++ ++ R++G+C++  N C+++ +C +G+LQD+L N+ IKLD +FR S   D+  GM  +  S I  HGNLKSSNCL+DSR+  KITD+GL   R  +   +   F  YKN  WTAPE+L         +N T         DVYS+ IV  EII R    Y ++ D +S   V++ VRK + P FRP+     E      ++ + + CW  D   RP F+ IK KL+  NG G+G I   + +R   Y NN   LV  R       KR    LL  +L + +A +L +G  V+AESF+ VTI+FSDI GFT+++A+STP+QV+ LLN LYT FD + ++HDVYKVETIGDAYMVVSGLP RNG  H   +A M+L  LSE+  F+IPH P +++++RIG+H+G   AGVVG+KMPRYCLFGDTVN ASRMES+G  L+IHVS   K  LD  G + L ERG V +KGKG   TY+L G K+     LP
Sbjct:    1 MKMVRDLHHANLNRYLGVCVESPNICMVSRFCNRGTLQDLLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGEFAVYKNLFWTAPELLPLADGFKDRKNKT------QAGDVYSYGIVLYEIITRDEP-YSTNTDTLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKLK-ANGMGNGKI-SGMFSR---YYNNFSKLVISRMGVCMALKR----LL--VLSRPIADELKKGNSVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMKGKGTIVTYFLTG-KDGFDKPLP 477          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 396.741 bits (1018), Expect = 5.653e-127
Identity = 213/436 (48.85%), Postives = 284/436 (65.14%), Query Frame = 1
Query: 2185 VLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVL---------RNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLED--ERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDG-DILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIK 3453
            +L N+ IKLD +FR S   D+  GM  +  S I  HGNLKSSNCL+DSR+  KITD+GL   R  +   +   F  Y+N  WT PE+L         +N T         DVYS+ IV  EII R    Y ++ D +S   V++ VRK + P FRP+     E      ++ + + CW  D   RP F+ IK KL+  NG G   +I+DN++T M +Y + LE +V +RT+Q  EEK + ++LLY MLP+ +A +L +G PV+AESF+ VTI+FSDI GFT+++A+STP+QV+ LLN LYT FD + ++HDVYKVETIGDAYMVVSGLP RNG  H   +A M+L  LSE+  F+IPH P +++++RIG+H+G   AGVVG+KMPRYCLFGDTVN ASRMES+G  L+IHVS   K  LD  G + L ERG V +K
Sbjct:    2 LLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGEFAVYRNLFWTVPELLPLADGFKDHKNKT------QAGDVYSYGIVLYEIITRDEP-YSTNTDTLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKLK-ANGMGKNLNIVDNMITMMAKYTDQLEDIVEERTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMK 429          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 440/1106 (39.78%), Postives = 625/1106 (56.51%), Query Frame = 1
Query:  238 IKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSI-SYSDSNSSL------AVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHM-LTEHGFMNST-IANLIR-IRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMK--TELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENI 3504
            I  AV+LP N  K    L +V PA+ +A + +  +  L    T +I +YS  N +       +   ++ +D    +  +V  GP   + LA+V R+ S+ +K+P++TA G A        Y  + R+  +   +      +   FNW+ ++   V+F         Y+     RP    F + G  F+ L DE++M ++   + N      L+  I+EN RI  IC     ++  + L    ++     Y  F +D+ A  +   +PW    ++K +     + F+SV  +++  PD+  Y DF  K+  +++  +  + +    +   G F+D  VLY +AL++TL+   +  +G  +     N SF G+TG + ID   A   D  L  M +Q TG + VV  + G  K +V ++   I W +     PLD P C F  D   C    P L  V     + +++       I +K+K   EL  M W++ W D++ +       S N  +K++ S                     +   S+ G + +   I+    Y                               Q+FAKT  +K N+VA+KH+    +RIE+ R++L ++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L  S  G HGNLKSSNC+VDSRFVLKITD+GL++FR   E  N DS   Y  KLWTAPE+L     PP G  K DVYSF I+ QEI  R+G FY+  +D+   +IV       + P FRP   D R  ++++  ++  CW EDP  RP F  IK+ + ++N  G   IL+NLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L ++  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD F  F L  RG+V++KGKG  +TYWL G K ++
Sbjct:   34 ITAAVMLPDNYHKYPWALPRVFPALLMAQEDLHTKHKLLLGHTITILNYSTENPAAPGSCAESRAQVVVVDAKLYSRPDVFFGPGCVYPLASVGRFVSH-WKLPLITAGGPAYGFEKLDEYKTIVRIGPSTTKLGAFVNVLHTQFNWTSRA--VVIF---------YDLKQDDRP--HYFLSEGI-FMNLKDEMNMTVSARPYTNEQDYKELVSFIKENGRIIYICGPLETFLSIMKLFQSEIQDPE-SYAIFYLDVFAESLTHRKPW---QNAKFDWTNPIQVFKSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPS--CGPPLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRVQWEDLQFE-------SPNKYHKRAGS---------------------RLTLSQRG-SSYGSLITAQGKY-------------------------------QLFAKTGYFKGNLVAIKHV--NKKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE--NDDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMDLSPKEIVQKVRNG-QRPYFRPT-TDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEKTDV 1052          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 383/874 (43.82%), Postives = 518/874 (59.27%), Query Frame = 1
Query:  928 HLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRS---------VITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMK--TELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQ-STIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENI 3504
            H  L+ G  ++ N+    N     +P+    D K+     KE  RS         V  +++  PD+  Y DF  K+  +++  +  + +    +   G F+D  VLY +AL++TL+   +  +G  +     N SF G+TG + ID   A   D  L  M +Q TG + VV  + G  K +V ++   I W +     PLD P C F  D   C    P L  V     + +++       I +K+K   EL  M W++ W D++ +       S N  +K++ S                     +   S+ G + +   I+    Y                               Q+FAKT  +K N+VA+KH+    +RIE+ R++L ++K ++D+  NH+ RFIG C+DP N CI+TEYCP+GSLQD+LENE I LD +FR SL+ D+ +GM +L  S  G HGNLKSSNC+VDSRFVLKITD+GL++FR   E  N DS   Y  KLWTAPE+L     PP G  K DVYSF I+ QEI  R+G FY+  +D+   +IV       + P FRP   D R  ++++  ++  CW EDP  RP F  IK+ + ++N  G   IL+NLL+RMEQYANNLE LV +RTQ Y EEKR+AE+LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFT++SAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R IA MSLA L ++  FKI H+P+ QL++RIG+HTG VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ LKIHVS ++K  LD F  F L  RG+V++KGKG  +TYWL G K ++
Sbjct:  197 HYFLSEG--IFMNLKDEMNMTVSARPYTNEQDYKELVSFIKENGRSKFTHQYDTSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPS--CGPPLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRVQWEDLQFE-------SPNKYHKRAGS---------------------RLTLSQRG-SSYGSLITAQGKY-------------------------------QLFAKTGYFKGNLVAIKHV--NKKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE--NDDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMDLSPKEIVQKVRNG-QRPYFRPT-TDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEKTDV 1000          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 292/524 (55.73%), Postives = 387/524 (73.85%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGY-HGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKEN 3501
            G  ++   + Q+FAKT  YK NIVA+K+     +RIE+NR++LF++K ++D+ N H+ RFIG C+DP N CIITEYCP+GSLQD+LEN+ I L+ +F+ SL+ D+ +GM++L +++ + HG LKSSNC+VD+RFVLKITD+GLS FR   ++ + DS  +Y  KLW APE+LR    PP G  K DVYSF+I+ QE+  R G FY+    +   +IV   +   + P  RP + D +  + ++  +++ CW E+P  RP F  I+L LR+ N     +ILDNLL+RMEQYANNLE LV +RTQ Y+EEKR+AE LLY +LP SVA QL RGE V AE+F+ V+IYFSDI GFTALSAESTPM+V+TLLN+LYT FD++ ++ DVYKVETIGDAYMVVSGLP RNG +H R IA M+LA L  +  F+I H+P+QQLK+RIG+H+G VCAGVVG+KMPRYCLFGDTVNT+SRMES+G+ LKIHVS +++  L  F  F L  RG++DIKGKG   TYWL G  ++
Sbjct:  544 GSLMTANGNLQVFAKTGYYKGNIVAIKYT--NKKRIELNRKVLFELKHMRDVQNEHLTRFIGACVDPPNICIITEYCPRGSLQDILENDSITLEWMFKFSLINDIVKGMVFLHNSVIFSHGKLKSSNCVVDNRFVLKITDYGLSTFRQESDVGS-DSHSYYAQKLWMAPELLRMENPPPQGTQKGDVYSFSIILQEVALRRGAFYLDGDPLSPKEIVDRVILG-DWPCLRPSI-DPQSHSPELGQLMQRCWAEEPTERPDFNHIRLLLRKHNKESRTNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVSIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMALALLDTVRTFRIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESSGEALKIHVSAATRDVLIEFNSFQLELRGDIDIKGKGKMTTYWLLGESDS 1062          

HSP 2 Score: 160.229 bits (404), Expect = 2.340e-39
Identity = 132/503 (26.24%), Postives = 242/503 (48.11%), Query Frame = 1
Query:  238 IKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSS-----LAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDM-DQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIETQEKRQRRRS 1710
            I +A++LP  ++       ++ PA++ AI  + ++ NL  N   +  +  S +S      +V PL+A+D+         +GP   +  + V  ++++ + VP++TA   A    D  IYP +T    T+K + R   +I   F W  + Y T++F    +K D   C F    + +  K+     + L D +    +     S I  L  I+   R+  +C  S +  R +M+      L + +YV+  IDL A  +   QPW       +++ +AK+AF+SV  +S+R+P +Q Y  F+  +K  +K+ +NY  +    N   G F+D ++LY  ALN+T  +  +   G+ +   +WN +F+G+TG + +D +G    D++L D+ D  + +F +V  +    + +      ++ W     + PLD P CGF  D   C    IT   +  +++  I  + +   +   RK K++ EL +  W+I+W DI+     +  RS
Sbjct:   45 ITLAIILPETNTAYPWAWPRIGPALERAIIKINSDPNLLPNHHLTYVFKSSENSNGICSESVAPLVAVDLEFAYKPWAFIGPGCSYTASPVGLFTTH-WDVPLITAGAPAIAFLDG-IYPTITNTGPTHKKLGRFALRICEHFGW--REYVTLMFSD--NKEDDRPCYFAMEGLYEELKSIN---ISLQDSVFEENKPPINYSQI--LADIQNIGRVMFVCC-SPDVFRRLMIEFWKADLPHEQYVFLYIDLFAVSLSNKQPW---ARGDQDDTIAKDAFQSVKILSYREPQNQEYQQFVRDLKADAKTSFNYSVQDSLMNIIAGGFYDGLMLYAHALNETALVPGARPPGKLISGKMWNRTFHGVTGLLHLDVSGDRETDFALWDLVDTNSSSFQIVVVYNSFEEQVTPVPGTSVRWLG--GARPLDVPKCGFKNDNPACLTKTITIHQMVSITLFFIFTMTLTIAIFICRKMKLEKELVAQLWRISWDDIQMSNLDKVLRS 530          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 290/525 (55.24%), Postives = 378/525 (72.00%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGY-HGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRL-----EDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            G  ++   + Q++ KT  YK N+VA+K++    +RIE+ R +LF++K ++D++N H+ RFIG C+DP N CIITEYCP+GSLQD++E+E + LD +FR SL+ D+ +GM +L +++ + HGNLKSSNC+VDSRFVLKITD+GL + R        D+  +Y  KLWTAPE+LR    P  G  K DVYSF I+ QE+    GVFYI    +I  +I+   + +   P  RP L      +E G+      +++ CW E+P  RP F  IK+ LR+ +     +ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R +A M+LA L  +  FKI H+P QQL++RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMES G+ LKIHVSE++++ L  F  F L  RG +++KGKG  +TYWL G
Sbjct:  536 GSLMTMEGNLQIYTKTGYYKGNLVAIKYI--NKKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRTSS--CPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTHTLIPKEIIQGVI-RGGVPLLRPSLCFHSHSEELGV------LMQRCWCEEPGERPDFNTIKILLRKQHRGYGSNILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQG 1049          

HSP 2 Score: 153.295 bits (386), Expect = 3.640e-37
Identity = 129/503 (25.65%), Postives = 233/503 (46.32%), Query Frame = 1
Query:  235 EIKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNS-----SLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIAN--LIRI-RENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNR------SITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQI-TGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIE 1680
            E+ +A +LP  ++       +V PA+  A+D V ++ +L       + +  S +     S +  PL+A+D+   +     +GP  D+  + V R++++ + VP++TA   A   S    +  +T    T+K +     KI  TF W    +T ++F       D   C F    +  +   +     +            F+ S I +  L++I ++N R+  +C    N +R +M+      +    YV+F IDL A  + G +P        +++  A+ AFRSV  +++ +P +  Y  F+  +K+ ++  +N+  K    N   G F+D V+LY  ALN+TLS  +          G+ V   +WN +F G+ G + +D  G    D++L DM  I +G F VV  +    K LV+ +  N  W     S PL+ P CGF  D   C    +T   +  + I  + ++++   +   RK K++ EL +  W+++W DI+
Sbjct:   29 EVTLAAILPLTNTDYPWAWPRVAPALYRAVDSVNSDPHLLPGLKLQLVHGSSENREGFCSDSAAPLVAVDLKLSHDPWAFIGPGCDYSSSPVARFTTH-WDVPMVTAGARADGFSK---FAAVTNTGPTHKKLGEFSLKIQETFGW--HHHTMLIFSDNKDDNDERTCYFAIEGLYSLMGKHNITVFDY-----------FVESNINHKELVQIIQKNGRVVYLCCSWDN-MRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWFRGDQDDHAARLAFRSVKVLTYMEPQNAEYHQFVETLKKDAEKMFNFTIKDSLYNLIAGGFYDGVMLYSRALNETLSKRKPGLRPVQRPKGDMVTQRMWNRTFQGVMGTVEMDKFGDREIDFALWDMTDINSGKFEVVCVYNSSIKELVLQKGLNFQWPG--GSPPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQ 511          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 290/525 (55.24%), Postives = 378/525 (72.00%), Query Frame = 1
Query: 1933 GIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGY-HGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRL-----EDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHG 3489
            G  ++   + Q++ KT  YK N+VA+K++    +RIE+ R +LF++K ++D++N H+ RFIG C+DP N CIITEYCP+GSLQD++E+E + LD +FR SL+ D+ +GM +L +++ + HGNLKSSNC+VDSRFVLKITD+GL + R        D+  +Y  KLWTAPE+LR    P  G  K DVYSF I+ QE+    GVFYI    +I  +I+   + +   P  RP L      +E G+      +++ CW E+P  RP F  IK+ LR+ +     +ILDNLL+RMEQYANNLE LV +RTQ Y EEKR+AE LLY +LP SVA QL RGE V AE+F+ VTIYFSDI GFTALSAESTP+QV+TLLN+LYT FD+I ++ DVYKVETIGDAYMVVSGLP RNG +H R +A M+LA L  +  FKI H+P QQL++RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMES G+ LKIHVSE++++ L  F  F L  RG +++KGKG  +TYWL G
Sbjct:  477 GSLMTMEGNLQIYTKTGYYKGNLVAIKYIN--KKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRTSS--CPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTHTLIPKEIIQGVI-RGGVPLLRPSLCFHSHSEELGV------LMQRCWCEEPGERPDFNTIKILLRKQHRGYGSNILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQG 990          

HSP 2 Score: 80.1073 bits (196), Expect = 9.801e-15
Identity = 109/498 (21.89%), Postives = 198/498 (39.76%), Query Frame = 1
Query:  235 EIKIAVLLP-NDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNS-----SLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIAN--LIR-IRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKS--KSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGF--DGKKC--PPITPWXXXXXXXXXXXXXXXXXXXXXXRK-KMKTELESMDWKINWCDIE 1680
            E+ +A +LP  ++       +V PA+  A+D V ++ +L       + +  S +     S +  PL+A+D+   +     +GP  D+  + V R++++ + VP++TA   A   S    +  +T    T+K +     KI  TF W    +T ++F       D   C F    +  +   +     +            F+ S I +  L++ I++N R+  +C    N +R +M+      +    YV+F IDL A  + G +P  MP                     FR   D H      +V+  S   SF  Y+                       L+ T++  +S    +     +W     G+ G + +D  G    D++L DM  I           GK +   + +  N  W     S PL+ P CGF  D   C    +T   +  + I  + ++++   +   RK K++ EL +  W+++W DI+
Sbjct:   29 EVTLAAILPLTNTDYPWAWPRVAPALYRAVDSVNSDPHLLPGLKLQLVHGSSENREGFCSDSAAPLVAVDLKLSHDPWAFIGPGCDYSSSPVARFTTH-WDVPMVTAGARADGFSK---FAAVTNTGPTHKKLGEFSLKIQETFGW--HHHTMLIFSDNKDDNDERTCYFAIEGLYSLMGKHNITVFDY-----------FVESNINHKELVQIIQKNGRVVYLCCSWDN-MRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKP-GMP--------------------WFRGDQDDHAARLAFRVRHPSIFNSFSVYN-----------------------LSTTIT-PQSFMQIKMCSEPVWCVVSAGVMGTVEMDKFGDREIDFALWDMTDINS---------GKFEVKHLPKGLNFQWPG--GSPPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQ 452          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000005445.1 (SMESG000005445.1)

HSP 1 Score: 2218.35 bits (5747), Expect = 0.000e+0
Identity = 1137/1145 (99.30%), Postives = 1140/1145 (99.56%), Query Frame = 1
Query:   91 MKLSLSALMLSIFIVFLITLYLCSLCQAGKSYITRIIKPLDKSNESSLEIKIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPTE 3525
            MKLS+SALMLSIFIVFLITLYLCSLCQAGKSYITRII+PLDKSNESSLEIKIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSS YVRDIMLAAH LKLTNGEYVYFNIDLSANQIKG QPWYMPN+SKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWLVAV SIVVITIVLVISVVIFIRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKSISEVSRRSESSSSLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTL PVGLAKADVYSFAIVCQEIIYRSGVFYISDVDIISPDIVVDRVRKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPTE
Sbjct:    1 MKLSMSALMLSIFIVFLITLYLCSLCQAGKSYITRIIRPLDKSNESSLEIKIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSKYVRDIMLAAHQLKLTNGEYVYFNIDLSANQIKGHQPWYMPNESKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWLVAVFSIVVITIVLVISVVIFIRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKSISEVSRRSESSSSLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLHPVGLAKADVYSFAIVCQEIIYRSGVFYISDVDIISPDIVVDRVRKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPTE 1145          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000039747.1 (SMESG000039747.1)

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 519/1119 (46.38%), Postives = 708/1119 (63.27%), Query Frame = 1
Query:  208 LDKSNESSLEIKIAVLLPNDSKSQC-----QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMF-NDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSR---NSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGRE-ISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXK-IENPPFRPRLEDE-RGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPTE 3525
            ++  N    ++ I ++L N+S          L +++PA+D+A + +K +   FRN            S++      ID+  N     V+LGP++DF +AN VR S  RY+VP+LT  G A  L  K+ + MLT    T++D++ V   +F  F W P+SY  V  +    + D    +F +  +    +   +K   ++ EI+         +   NL  + +N+RI I+CAK    +RDIM AA+ L    G+Y + + D+  N+ +  +PWY P +S + N + K+A+RS++ ++   P+  ++  F  +VK+KSKS  +      D +  V  FHD+V++Y  ALN  L  +++++DG+ +   + N S NGI+G + ID NG   ADYSLLDMD  T  F VV    G +K      +  IDW N  N  PLDTP CGF    C       ++ + +V++ I  V+S+VI+   K   EL++M+W I W  IET EKR+ R S N    K  ++   I+ +  +S     S+   ++  +      N+      Q  ++R         + S +SL TLAGIQ   L + QMF+KT +YK  IVA+K + +  ++IEIN+ +L Q+K VKDLNN+HI RFIG CL+P + CI++EYCPKGSLQDVLEN+QIKLD +F+ SL+QD+CRGM+YL S IG HGNLKSSNCL+DSRFV+K+TDFGL   R  ++ +   + + FY+N LWTAPE+LRN      G  K D+YSFAI+ QEIIYR+GVFY+ + +       +    K     PFRP L  E      +I SII+  W+E P  RP    IK+  R+ N AGD G+ILDNLL+RMEQYANNLEGLV QRT+QY EEKR+AEDLLY MLPKSVA QLIR EPVTAES+E VTIYFSDI GFT+LSAESTPMQVI LLN+LYT FDSI E++DVYKVETIGDAY+VVSGLPQRNG +H R I+ MSLAFL  ++ F+IPH+ D+QL +RIGMH+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ +KIH+S ++   L TFG FI+TERG +++KGKG Q TYWLHG  E+IVD +  E
Sbjct:   14 INAENSKKHQMVIGIILENNSSQNHLGNLPTLDQIVPAVDIAFEKIKKKFIRFRNFELVTVTKTLTKSMSKSLWEIIDLLQNSTRPQVILGPLDDFNIANAVRLSDGRYRVPLLTPGGNALGLRKKQDFQMLTSTLFTFQDLKYVLLAMFDEFKWKPRSYKNVGLYIFDMENDNNLGDFISEVVYKTLQDANFK---IAKEIYKQKLTARPPNHKDNLRELSKNSRIIILCAKPE-VIRDIMKAAYDLGFHKGDYAFISFDI-LNKSQSQRPWYSPLNSTQENEILKKAYRSLLIITLTLPESNNFKSFSEEVKQKSKSLGS-----QDVSRFVVAFHDSVLIYAHALNDCL--DKNVSDGDHITEQMKNKSINGISGNVHIDSNGDRNADYSLLDMDPKTETFQVVAIVNGSDKKFSPVANVQIDWVNVNNRPPLDTPKCGFSNTDCNFGFALTLSTILLVILIIAAVVSIVIYRHFKFHIELKAMNWLIMWDCIETTEKRKARYSDNKVKLKQENLNKLIYPECEESELMNKSFAENEFNMENHYLMTNKDVQLF-QGGSFRN---ARRLSNWSENSLETLAGIQFENLRNHQMFSKTGVYKNGIVAIKPI-MHTKKIEINKSLLIQVKKVKDLNNDHICRFIGACLEPQHMCILSEYCPKGSLQDVLENDQIKLDWIFKFSLIQDICRGMIYLHSNIGPHGNLKSSNCLIDSRFVVKLTDFGLQKLRGSKDHLLEENPYAFYRNLLWTAPEILRNSNSLVEGTVKGDIYSFAIILQEIIYRNGVFYLGEFETPIEPQEIVERVKQFRQIPFRPYLGKESENHGSEIDSIIKQMWEEFPLQRPEMRNIKVMFRKFNKAGDSGNILDNLLSRMEQYANNLEGLVTQRTEQYLEEKRKAEDLLYLMLPKSVARQLIRNEPVTAESYESVTIYFSDIVGFTSLSAESTPMQVIELLNHLYTTFDSILENYDVYKVETIGDAYVVVSGLPQRNGNLHAREISRMSLAFLRALFTFQIPHRQDRQLHVRIGMHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQAMKIHISRNTLDVLKTFGSFIITERGQIELKGKGFQTTYWLHGEGEDIVDPVLPE 1115          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000039747.1 (SMESG000039747.1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 518/1107 (46.79%), Postives = 703/1107 (63.50%), Query Frame = 1
Query:  244 IAVLLPNDSKSQC-----QLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSNSSLAVGPLIAIDMF-NDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXXXXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSR---NSYLNPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGRE-ISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXK-IENPPFRPRLEDE-RGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPTE 3525
            I ++L N+S          L +++PA+D+A + +K +   FRN            S++      ID+  N     V+LGP++DF +AN VR S  RY+VP+LT  G A  L  K+ + MLT    T++D++ V   +F  F W P+SY  V  +    + D    +F +  +    +   +K   ++ EI+         +   NL  + +N+RI I+CAK    +RDIM AA+ L    G+Y + + D+  N+ +  +PWY P +S + N + K+A+RS++ ++   P+  ++  F  +VK+KSKS  +      D +  V  FHD+V++Y  ALN  L  +++++DG+ +   + N S NGI+G + ID NG   ADYSLLDMD  T  F VV    G +K      +  IDW N  N  PLDTP CGF    C       ++ + +V++ I  V+S+VI+   K   EL++M+W I W  IET EKR+ R S N    K  ++   I+ +  +S     S+   ++  +      N+      Q  ++R         + S +SL TLAGIQ   L + QMF+KT +YK  IVA+K + +  ++IEIN+ +L Q+K VKDLNN+HI RFIG CL+P + CI++EYCPKGSLQDVLEN+QIKLD +F+ SL+QD+CRGM+YL S IG HGNLKSSNCL+DSRFV+K+TDFGL   R  ++ +   + + FY+N LWTAPE+LRN      G  K D+YSFAI+ QEIIYR+GVFY+ + +       +    K     PFRP L  E      +I SII+  W+E P  RP    IK+  R+ N AGD G+ILDNLL+RMEQYANNLEGLV QRT+QY EEKR+AEDLLY MLPKSVA QLIR EPVTAES+E VTIYFSDI GFT+LSAESTPMQVI LLN+LYT FDSI E++DVYKVETIGDAY+VVSGLPQRNG +H R I+ MSLAFL  ++ F+IPH+ D+QL +RIGMH+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG+ +KIH+S ++   L TFG FI+TERG +++KGKG Q TYWLHG  E+IVD +  E
Sbjct:    3 IGIILENNSSQNHLGNLPTLDQIVPAVDIAFEKIKKKFIRFRNFELVTVTKTLTKSMSKSLWEIIDLLQNSTRPQVILGPLDDFNIANAVRLSDGRYRVPLLTPGGNALGLRKKQDFQMLTSTLFTFQDLKYVLLAMFDEFKWKPRSYKNVGLYIFDMENDNNLGDFISEVVYKTLQDANFK---IAKEIYKQKLTARPPNHKDNLRELSKNSRIIILCAKPE-VIRDIMKAAYDLGFHKGDYAFISFDI-LNKSQSQRPWYSPLNSTQENEILKKAYRSLLIITLTLPESNNFKSFSEEVKQKSKSLGS-----QDVSRFVVAFHDSVLIYAHALNDCL--DKNVSDGDHITEQMKNKSINGISGNVHIDSNGDRNADYSLLDMDPKTETFQVVAIVNGSDKKFSPVANVQIDWVNVNNRPPLDTPKCGFSNTDCNFGFALTLSTILLVILIIAAVVSIVIYRHFKFHIELKAMNWLIMWDCIETTEKRKARYSDNKVKLKQENLNKLIYPECEESELMNKSFAENEFNMENHYLMTNKDVQLF-QGGSFRN---ARRLSNWSENSLETLAGIQFENLRNHQMFSKTGVYKNGIVAIKPI-MHTKKIEINKSLLIQVKKVKDLNNDHICRFIGACLEPQHMCILSEYCPKGSLQDVLENDQIKLDWIFKFSLIQDICRGMIYLHSNIGPHGNLKSSNCLIDSRFVVKLTDFGLQKLRGSKDHLLEENPYAFYRNLLWTAPEILRNSNSLVEGTVKGDIYSFAIILQEIIYRNGVFYLGEFETPIEPQEIVERVKQFRQIPFRPYLGKESENHGSEIDSIIKQMWEEFPLQRPEMRNIKVMFRKFNKAGDSGNILDNLLSRMEQYANNLEGLVTQRTEQYLEEKRKAEDLLYLMLPKSVARQLIRNEPVTAESYESVTIYFSDIVGFTSLSAESTPMQVIELLNHLYTTFDSILENYDVYKVETIGDAYVVVSGLPQRNGNLHAREISRMSLAFLRALFTFQIPHRQDRQLHVRIGMHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQAMKIHISRNTLDVLKTFGSFIITERGQIELKGKGFQTTYWLHGEGEDIVDPVLPE 1092          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 505/1121 (45.05%), Postives = 694/1121 (61.91%), Query Frame = 1
Query:  250 VLLPNDSKSQCQLIKVLPAIDVAIDHVK--NERNLFRNATFSISYSDSNSSLAVG--PLI-AIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKI--YPMLTRLSG--TYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXX---XXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYL----------------NPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGRE-ISNHDSFQFYKNKLWTAPEVLRNPT-LPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLP 3519
            +++P+D +       +L A D+A++ ++  N     R   +   Y+D++S       PL   + +   +   V  GP+ D+ LA + R   + + +PI+T  G +      K   Y  LTR++       ++ +F KIF  +NWS               ++    NF  R +  +F +  YK       + +  E      T+  +    ENA + ++C +  + VR I+L AH L   NGEYV+ NIDL  ++    +PWY  ND+ + N  AKEA+RS++TV+ ++P+ + Y +FI +VK ++   Y     ++++N  +G FHD+++LY LALN T+++N +  +G F+   +WN +  GITG++ ID+NG   ADYS+LDMD+ TG F +V  + GK +  +    + IDW N+KN  P   PVCG++ K CP        +  I +  I+L   +    I+ R K + EL +M+W I W ++ET+EKR R       +K S ++P   +++L   R  Y                 NP       K  P+  +      N++                  +  G+Q   L   + F  TA+YK N+VALK L    +++EINR +L ++K VK+LNN HI RFIG+CLD     ++TEYCPKGSLQD+LENEQI LD +F+ SL+QD+CRGM+YL S IG HGNLKSSNCLVDSRFVLKI DFGL   R  +E +  +D + +Y+N LWTAPE+LR  T +      KADVYSF I+CQE++YR+GVFY+SD+++    IV     K++  P+RP L +    ++ +  IIR  WQED +LRP F  IK  +R +N  GD G+ILDNLL+RMEQYANNLE LV QRT+QY EEKR+ EDLLYSMLPKSVAGQLIR E VTAES+E V+IYFSDI GFTALSAESTPMQVI LLN LYT FDSI E  DVYKVETIGDAYMV SGLPQRNG +H+R IA MSLAFLS I++F+IPHKP++++++RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG PLKIH+SE S   L TF  FI+++RG V++KGKG Q TYWLHG    IVD +P
Sbjct:   43 IMIPDDIRHNFNKNLMLSAFDIALEKIRTWNIHPFIRKLKY---YADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPF-WDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLI----------YEQTFLNF-CRSVGTLFDSENYKNKTFKSVVLLNAE------TLLEIDMGSENA-VVVLCVEPES-VRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRL-----THKVSDTLP---NSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVNSINISINSWE-----------------SFTGLQNDNLHCIKTFITTALYKGNVVALKQLH-GSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVT-KVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIP 1110          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 499/1078 (46.29%), Postives = 674/1078 (62.52%), Query Frame = 1
Query:  379 SDSNSSLAVGPLIAID-MFNDNVANVL----LGPVNDFLLANVVRYSSYRYKVPILTAQGYASDLSDKKI--YPMLTRLSG--TYKDMERVFEKIFATFNWSPKSYTTVVFWYIWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIANLIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQIKGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKSKSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNMIWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTLVMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWXXXXXXXXXXXXXXXXXXX---XXXRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSASIPIFIHNQLNDSRNSYL----------------NPKYQAKASKEGPNEFSPFISQSNNYRKXXXXXXXXXXXXXXLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRIEINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVLENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLKITDFGLSAFRIGRE-ISNHDSFQFYKNKLWTAPEVLRNPT-LPPVGLAKADVYSFAIVCQEIIYRSGVFYXXXXXXXXXXXXXXXXXKIENPPFRPRLEDERGINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGD-GDILDNLLTRMEQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKVETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLKIRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESSKRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLP 3519
            + SN   ++ P I +      NV NV      GP+ D+ LA + R   + + +PI+T  G +      K   Y  LTR++       ++ +F KIF  +NWS               ++    NF  R +  +F +  YK       + +  E      T+  +    ENA + ++C +  + VR I+L AH L   NGEYV+ NIDL  ++    +PWY  ND+ + N  AKEA+RS++TV+ ++P+ + Y +FI +VK ++   Y     ++++N  +G FHD+++LY LALN T+++N +  +G F+   +WN +  GITG++ ID+NG   ADYS+LDMD+ TG F +V  + GK +  +    + IDW N+KN  P   PVCG++ K CP        +  I +  I+L   +    I+ R K + EL +M+W I W ++ET+EKR R       +K S ++P   +++L   R  Y                 NP       K  P+  +      N++                  +  G+Q   L   + F  TA+YK N+VALK L    +++EINR +L ++K VK+LNN HI RFIG+CLD     ++TEYCPKGSLQD+LENEQI LD +F+ SL+QD+CRGM+YL S IG HGNLKSSNCLVDSRFVLKI DFGL   R  +E +  +D + +Y+N LWTAPE+LR  T +      KADVYSF I+CQE++YR+GVFY+SD+++    IV     K++  P+RP L +    ++ +  IIR  WQED +LRP F  IK  +R +N  GD G+ILDNLL+RMEQYANNLE LV QRT+QY EEKR+ EDLLYSMLPKSVAGQLIR E VTAES+E V+IYFSDI GFTALSAESTPMQVI LLN LYT FDSI E  DVYKVETIGDAYMV SGLPQRNG +H+R IA MSLAFLS I++F+IPHKP++++++RIG+H+G VCAGVVG+KMPRYCLFGDTVNTASRMESNG PLKIH+SE S   L TF  FI+++RG V++KGKG Q TYWLHG    IVD +P
Sbjct:   24 TQSNRISSLDPKINVQSTVTTNVLNVFKYVWFGPICDYSLAPIARLLPF-WDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLI----------YEQTFLNF-CRSVGTLFDSENYKNKTFKSVVLLNAE------TLLEIDMGSENA-VVVLCVEPES-VRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRL-----THKVSDTLP---NSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVNSINISINSWE-----------------SFTGLQNDNLHCIKTFITTALYKGNVVALKQLH-GSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVT-KVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIP 1051          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR21.664e-3359.14natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
NPR17.893e-4757.66natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
GUCY2F1.734e-12043.92guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
GUCY2D2.307e-11642.69guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
GUCY2C1.790e-10943.76guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-282.614e-17050.85Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-282.632e-17050.85Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-284.650e-17050.85Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-282.417e-16148.00Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-71.536e-13144.31Receptor-type guanylate cyclase gcy-7 [Source:Uni... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG311837.310e-18055.36gene:FBgn0051183 transcript:FBtr0346151[more]
CG311837.310e-18055.36gene:FBgn0051183 transcript:FBtr0083187[more]
CG107387.750e-16834.33gene:FBgn0036368 transcript:FBtr0302487[more]
CG107381.258e-16734.27gene:FBgn0036368 transcript:FBtr0302488[more]
CG107383.383e-16734.33gene:FBgn0036368 transcript:FBtr0304792[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr20.000e+038.88natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
npr20.000e+037.15natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
npr1b1.918e-3356.63natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
npr1a7.890e-4156.92natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a7.890e-4156.92natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR20.000e+058.46natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+058.46natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+058.46natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+058.46natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+058.46natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npr20.000e+059.38natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr28.631e-3559.34natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr11.149e-4257.66natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
Npr22.776e-15657.93natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Gucy2g2.625e-13545.96guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55202|ANPRB_ANGJA0.000e+037.68Atrial natriuretic peptide receptor 2 OS=Anguilla ... [more]
sp|P16067|ANPRB_RAT1.274e-3359.34Atrial natriuretic peptide receptor 2 OS=Rattus no... [more]
sp|Q6VVW5|ANPRB_MOUSE6.037e-3459.34Atrial natriuretic peptide receptor 2 OS=Mus muscu... [more]
sp|P18293|ANPRA_MOUSE8.034e-4257.66Atrial natriuretic peptide receptor 1 OS=Mus muscu... [more]
sp|P46197|ANPRB_BOVIN2.860e-3459.14Atrial natriuretic peptide receptor 2 OS=Bos tauru... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HCY10.000e+045.17Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
G4V6510.000e+046.59Guanylate cyclase OS=Schistosoma mansoni OX=6183 G... [more]
A0A1I8JDN40.000e+047.85Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A1I8GAT20.000e+045.48Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
V4AEX20.000e+045.28Guanylate cyclase OS=Lottia gigantea OX=225164 GN=... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1a0.000e+036.72natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr20.000e+036.48natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
npr1b8.439e-3658.08atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b8.439e-3658.08atrial natriuretic peptide receptor 1-like [Source... [more]
npr1a2.697e-3255.27natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006352.10.000e+043.72pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR10.000e+056.48natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000008976.15.223e-13748.24pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
ENSPMAT00000008942.15.061e-13546.80pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
ENSPMAT00000008986.18.584e-13147.75pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC52.520e-1030.15Polo-like kinase; controls targeting and activatio... [more]
STE113.518e-1028.95Signal transducing MEK kinase; involved in pheromo... [more]
CLA44.318e-1028.96Cdc42p-activated signal transducing kinase; member... [more]
CDC157.996e-1024.19Protein kinase of the Mitotic Exit Network; locali... [more]
KIC19.895e-926.74Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342750.000e+052.82Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309851.007e-16652.02Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362031.127e-13346.43Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361827.754e-13046.57Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279235.653e-12748.85Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr20.000e+039.78natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
npr20.000e+043.82natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc22.340e-3955.73membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc73.640e-3755.24membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc79.801e-1555.24membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005445.10.000e+099.30SMESG000005445.1[more]
SMESG000039747.10.000e+046.38SMESG000039747.1[more]
SMESG000039747.10.000e+046.79SMESG000039747.1[more]
SMESG000068881.10.000e+045.05SMESG000068881.1[more]
SMESG000068881.10.000e+046.29SMESG000068881.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015111 ID=SMED30015111|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=3638bp
CGACCAATCAAACGCAAGCTTTATTATTGATTTGGTTTTATTTGAAATAT
TTCTCACAGAATCATGGGAATAATTTAATAATTTCAAAATATGAAGCTTT
CACTCTCAGCTTTGATGCTTTCCATTTTTATTGTATTCTTGATAACATTA
TATTTGTGTTCATTATGCCAAGCTGGAAAGTCTTACATTACGAGGATTAT
AAAGCCATTGGACAAATCAAATGAAAGTAGTCTTGAAATTAAAATTGCTG
TTCTTCTACCAAATGATTCTAAAAGTCAATGTCAATTGATCAAAGTTTTA
CCGGCAATTGATGTAGCCATCGATCACGTAAAGAATGAAAGGAATCTATT
TAGAAATGCAACGTTTTCAATATCATACAGTGACTCGAATTCCAGTCTTG
CAGTGGGGCCGTTAATAGCCATTGACATGTTTAATGATAACGTTGCAAAT
GTGCTGTTAGGTCCGGTGAACGATTTTCTCTTAGCCAATGTCGTCAGATA
CAGTTCTTATCGATATAAAGTTCCAATTCTAACTGCCCAAGGATACGCAT
CAGATTTAAGTGATAAAAAAATCTACCCAATGCTAACTCGGTTATCTGGA
ACCTATAAAGATATGGAGCGAGTTTTTGAAAAGATTTTCGCAACTTTCAA
CTGGTCTCCAAAGTCCTACACAACTGTTGTTTTTTGGTATATTTGGCACA
AATTCGATGCCTACGAATGTAATTTTCAAACGAGACCAATTATGGATATT
TTTAAAACAAATGGATATAAATTTCTGGAACTTAGCGATGAAATTCACAT
GTTAACCGAGCACGGATTTATGAATTCTACTATTGCTAACCTAATACGGA
TTCGTGAAAACGCTCGAATAACAATAATCTGCGCAAAAAGCAGCAATTAC
GTCAGAGACATAATGTTGGCGGCTCACCATCTTAAACTAACAAATGGAGA
ATACGTTTATTTCAATATAGATCTGTCAGCAAATCAAATAAAAGGCCTTC
AACCTTGGTACATGCCAAATGATTCCAAAAAGAACAATGTGATGGCTAAA
GAAGCTTTTCGATCAGTTATAACAGTTTCTTTTCGGCAACCAGATGACCA
ACACTACACTGATTTTATTATAAAAGTGAAAGAAAAATCAAAATCATTTT
ATAATTATGACTACAAGATTGACGATGCCAACAGTTGCGTAGGTCGCTTT
CATGATGCCGTTGTCTTGTATTGCCTAGCTCTCAATAAGACGCTCTCACT
CAATCGCTCTATTACCGACGGAGAATTCGTAAAGAATATGATTTGGAATA
GCAGTTTTAATGGCATTACCGGTAAAATTATTATCGACGACAATGGAGCT
GGATTTGCTGATTATTCTTTGCTTGATATGGATCAAATTACTGGAAACTT
TTTGGTTGTTGGTACTTTCTATGGAAAAAATAAGACGCTAGTCATGGCTC
GAGATAGAAACATCGACTGGGCCAACGAAAAGAATTCTGCGCCACTTGAT
ACTCCAGTTTGTGGTTTCGATGGCAAAAAATGCCCTCCAATTACTCCGTG
GCTCGTGGCGGTACTTTCGATAGTGGTCATAACAATAGTTCTTGTAATCA
GTGTTGTAATTTTTATCAGGAAAAAAATGAAAACCGAACTCGAATCTATG
GACTGGAAAATTAATTGGTGTGATATAGAGACTCAGGAGAAACGCCAACG
AAGACGATCACTTAACTCCGCAAACAAGAAAAGCGCCTCTATTCCAATAT
TCATACATAACCAGTTAAATGATAGTCGCAATAGTTACCTAAATCCAAAA
TATCAAGCGAAAGCATCGAAAGAAGGACCAAACGAGTTCAGTCCATTCAT
ATCTCAGTCAAACAATTATCGAAAGTCAATTTCAGAAGTATCTCGTCGAT
CCGAATCTTCTTCCTCTCTCCTTACTCTTGCTGGAATTCAATTGAGTCAA
TTGGCATCGACACAAATGTTTGCTAAAACGGCAATCTACAAAGAAAATAT
TGTTGCCTTGAAGCATCTTAGACTGGAAGGAAGAAGAATAGAAATAAACC
GGGAAATATTATTTCAAATAAAGAGTGTTAAAGATCTCAATAATAATCAT
ATAGCACGATTTATTGGAATTTGCTTGGATCCTGGCAACGAATGCATAAT
TACTGAATACTGTCCAAAAGGAAGTCTTCAAGATGTTTTAGAAAACGAGC
AAATCAAACTAGATTCTGTGTTCCGTTTGTCATTAATGCAAGACATGTGT
AGAGGAATGCTTTATTTGCAAAGTACAATCGGTTATCACGGAAACTTGAA
AAGTTCAAACTGTTTGGTTGATTCAAGGTTTGTTTTAAAGATAACAGATT
TTGGTCTTTCTGCATTTCGAATCGGGAGAGAAATTAGTAACCATGACTCT
TTTCAATTTTATAAAAACAAATTATGGACTGCTCCTGAAGTTCTACGAAA
CCCGACATTGCCTCCAGTTGGTTTAGCGAAAGCCGACGTCTACAGTTTCG
CAATTGTTTGTCAAGAAATTATTTATAGATCAGGAGTATTTTATATAAGT
GATGTTGACATTATCAGTCCAGATATTGTCGTTGATCGGGTGAGAAAAAT
TGAAAATCCGCCTTTTAGACCTCGACTCGAAGATGAGCGCGGAATTAATA
AAGATATAATATCAATCATTAGAAGCTGTTGGCAAGAAGACCCTAATCTC
AGACCAGGTTTCGCTCAAATAAAGTTGAAATTGAGAAGAATAAATGGGGC
AGGAGATGGGGATATTCTGGACAATTTACTTACTCGAATGGAGCAATATG
CCAACAATCTCGAAGGATTAGTAGCTCAACGTACGCAGCAATATTATGAA
GAAAAACGGAGAGCAGAAGATTTACTTTACTCAATGTTACCAAAATCAGT
TGCTGGCCAGCTTATTAGAGGGGAGCCTGTGACTGCTGAATCATTCGAAA
AAGTAACAATTTATTTCAGTGACATTTGTGGTTTCACTGCTCTTTCTGCA
GAGTCGACTCCAATGCAAGTGATTACGCTTTTAAACAACCTTTATACGCT
GTTTGATTCAATCACTGAAGACCACGATGTTTATAAGGTTGAAACTATAG
GAGATGCTTACATGGTCGTGTCTGGTCTTCCACAACGGAATGGAATTATG
CACGTTAGGCATATTGCCTGCATGTCTTTAGCATTTTTGTCAGAGATTTA
TAAATTTAAAATTCCTCACAAACCAGATCAGCAACTGAAAATCCGGATCG
GAATGCACACTGGAATGGTCTGTGCCGGCGTTGTGGGGGTGAAAATGCCC
AGATACTGTCTGTTTGGGGACACAGTTAACACAGCCAGCCGAATGGAGAG
CAATGGAAAACCTTTAAAAATTCACGTCAGCGAGTCTTCAAAAAGAGAAT
TAGACACTTTTGGGGAATTTATTTTAACTGAAAGAGGAAATGTTGACATA
AAAGGAAAAGGTATTCAGAAAACATACTGGCTTCACGGCACTAAAGAAAA
TATCGTTGACCAGCTCCCTACAGAATCGTGATATTATTCACATATAAATA
ATATTTGAAACTATCGAGTGTTTATTTTATTTTTTAATTATAGTTAGATG
TGGATATAAAAATGAAAATTGTTTCATATGGATATTCC
back to top

protein sequence of SMED30015111-orf-1

>SMED30015111-orf-1 ID=SMED30015111-orf-1|Name=SMED30015111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1147bp
MKLSLSALMLSIFIVFLITLYLCSLCQAGKSYITRIIKPLDKSNESSLEI
KIAVLLPNDSKSQCQLIKVLPAIDVAIDHVKNERNLFRNATFSISYSDSN
SSLAVGPLIAIDMFNDNVANVLLGPVNDFLLANVVRYSSYRYKVPILTAQ
GYASDLSDKKIYPMLTRLSGTYKDMERVFEKIFATFNWSPKSYTTVVFWY
IWHKFDAYECNFQTRPIMDIFKTNGYKFLELSDEIHMLTEHGFMNSTIAN
LIRIRENARITIICAKSSNYVRDIMLAAHHLKLTNGEYVYFNIDLSANQI
KGLQPWYMPNDSKKNNVMAKEAFRSVITVSFRQPDDQHYTDFIIKVKEKS
KSFYNYDYKIDDANSCVGRFHDAVVLYCLALNKTLSLNRSITDGEFVKNM
IWNSSFNGITGKIIIDDNGAGFADYSLLDMDQITGNFLVVGTFYGKNKTL
VMARDRNIDWANEKNSAPLDTPVCGFDGKKCPPITPWLVAVLSIVVITIV
LVISVVIFIRKKMKTELESMDWKINWCDIETQEKRQRRRSLNSANKKSAS
IPIFIHNQLNDSRNSYLNPKYQAKASKEGPNEFSPFISQSNNYRKSISEV
SRRSESSSSLLTLAGIQLSQLASTQMFAKTAIYKENIVALKHLRLEGRRI
EINREILFQIKSVKDLNNNHIARFIGICLDPGNECIITEYCPKGSLQDVL
ENEQIKLDSVFRLSLMQDMCRGMLYLQSTIGYHGNLKSSNCLVDSRFVLK
ITDFGLSAFRIGREISNHDSFQFYKNKLWTAPEVLRNPTLPPVGLAKADV
YSFAIVCQEIIYRSGVFYISDVDIISPDIVVDRVRKIENPPFRPRLEDER
GINKDIISIIRSCWQEDPNLRPGFAQIKLKLRRINGAGDGDILDNLLTRM
EQYANNLEGLVAQRTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAE
SFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHDVYKV
ETIGDAYMVVSGLPQRNGIMHVRHIACMSLAFLSEIYKFKIPHKPDQQLK
IRIGMHTGMVCAGVVGVKMPRYCLFGDTVNTASRMESNGKPLKIHVSESS
KRELDTFGEFILTERGNVDIKGKGIQKTYWLHGTKENIVDQLPTES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0016849phosphorus-oxygen lyase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0003677DNA binding
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006468protein phosphorylation
GO:0006355regulation of transcription, DNA-templated
GO:0006182cGMP biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000141dorsal region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001170ANPR/GUC
IPR001054A/G_cyclase
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR001828ANF_lig-bd_rcpt
IPR018297A/G_cyclase_CS
IPR000719Prot_kinase_dom
IPR029787Nucleotide_cyclase
IPR028082Peripla_BP_I
IPR011009Kinase-like_dom_sf
IPR000551MerR-type_HTH_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 893..913
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 625..919
e-value: 3.0E-54
score: 186.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 68..425
e-value: 2.4E-102
score: 345.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 174..476
e-value: 2.4E-102
score: 345.0
NoneNo IPR availablePANTHERPTHR11920ADENYLATE AND GUANYLATE CYCLASEScoord: 67..540
NoneNo IPR availablePANTHERPTHR11920:SF300ATRIAL NATRIURETIC PEPTIDE RECEPTOR 1coord: 67..540
coord: 602..1137
NoneNo IPR availablePANTHERPTHR11920ADENYLATE AND GUANYLATE CYCLASEScoord: 602..1137
NoneNo IPR availableCDDcd07302CHDcoord: 955..1131
e-value: 3.16679E-64
score: 213.21
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..28
score: 0.604
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 487..509
IPR001170Adenylyl cyclase class-4/guanylyl cyclasePRINTSPR00255NATPEPTIDERcoord: 488..510
score: 17.39
coord: 259..277
score: 25.66
coord: 408..425
score: 40.28
coord: 123..141
score: 36.84
coord: 370..388
score: 44.41
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 920..1114
e-value: 1.7E-101
score: 353.2
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 948..1133
e-value: 1.2E-64
score: 217.4
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 956..1086
score: 48.771
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 69..431
e-value: 2.7E-38
score: 132.0
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 941..1135
e-value: 8.9E-73
score: 245.9
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 942..1131
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 634..880
e-value: 3.5E-37
score: 128.1
IPR018297Adenylyl cyclase class-4/guanylyl cyclase, conserved sitePROSITEPS00452GUANYLATE_CYCLASE_1coord: 1063..1086
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 616..884
score: 24.047
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 635..920
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 49..476