G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30015107
Length (bp)826
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015107) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015107) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015107) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015107) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015107

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015107SMESG000040061.1 SMESG000040060.1 SmedASXL_015903SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015107SMESG000040061.1 SMESG000040060.1 SmedASXL_015902SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183SMG7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS5415 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.057e-19
Identity = 75/278 (26.98%), Postives = 131/278 (47.12%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFR--AKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTE---------TVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLFTGSGKETDTICES 802
            FLGRGL F +  +  +K+D +    CKLME+ P  MYFA++Y+MV  ++DR   IN+  QF   N   +R  A   CI +  +G + + P L    I  + + +    N +C + +          VFS ++ +F  +++      +++     I      +  ++ R+           S   +  G+LA+S+ FLL+ +PL   ++VR   T       S   + + + S+F SS+KDL YA+N  +   FL+ FR  +  L +    +    C +
Sbjct:   85 FLGRGLQFATGNQFTLKLDSTSTLACKLMEYFPNAMYFAASYLMVTFSLDRALTINRPLQF---NSFFYRKYATLTCILVFVVGFLGNLPFLL---IQKLQFNSAIPTNYTCVMNQDYPKMAKFAIVFSTLVTFFLPVLIIFALNIVIVTRLWQIHRWRRGQLKIKTRIV----------SELGRATGHLAMSTAFLLLYVPLGFVVLVRLHFTEVHGDDTSAAALRIIDLSRFFSSLKDLAYAVNVLIYAVFLKNFRTRLLRLLSCQRNDNSLNCHA 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183QJJ7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.307e-18
Identity = 77/254 (30.31%), Postives = 141/254 (55.51%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKL-TETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSL 760
            FLGRGL +L++ +   K+D    F CK +E++   MYF S+Y++V+ ++DR   I+K  +F +   H   A   CI + +IG I +SPLL+   + N T    +F   +C++ +E   ++  + F++++ F +P  +V+  NIFI  +L K +  R  L  +   +     G  ++ G+LA+S+ FLL+ +P+   +++R  ++           + + + S+  SS+KD+ YA+NF+L + FL  FR   + L
Sbjct:   73 FLGRGLYYLTNHQYYFKLDTISKFWCKSVEYLSNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSI-YHKHWALIACILVYSIGIISNSPLLFVQTLINDTSSRTNF---TCRMISEHPIAKFTIAFETIVTFTIPFCLVLFLNIFICIELWKLKIHRTTLLPTDCSRNRMEMG--RVFGHLALSTAFLLLYLPMVCFVLIRLSQSLSHVDRHKPYAMNIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRL 320          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3U5C5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1918 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.637e-18
Identity = 75/258 (29.07%), Postives = 126/258 (48.84%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLT--ETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLFTG 769
            F GRGL + + GR  +K D +    CKL+EF+PR+MYF ++Y++VV ++DR   +    ++ A      +A   C+ +V IGAI ++P L        T E +    T+C++   ET+  +   +F      V     VI      V  +L+     +   ++         G  ++ G+LA+++ FLL+ +PL   ++VR   T       +     +   SKF SS+KD+ YA+N ++  AFL  FR  +  L  G
Sbjct:   83 FFGRGLAYATDGRFFLKFDATSEAACKLLEFLPRMMYFVASYLVVVFSIDRTLAVYNPIKYHACRYQR-QAIIACLVVVFIGAIGNTPTLVVQ-----TLERQEGGCTACRMVHNETILKD---FFIVSTTLVTFFIPVIAVFALNVVIVLRLWRAHQWRQTAGVSGGAQEVG--RITGHLAMTTCFLLLYIPLGFVVLVRLHYTLHHSEDYTPRATQVINLSKFFSSLKDIAYAVNCFIYAAFLGNFRARLVRLCKG 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: G4VJR3 (Putative peptide (Allatostatin/somatostatin)-like receptor OS=Schistosoma mansoni OX=6183 GN=Smp_041880 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.092e-17
Identity = 75/254 (29.53%), Postives = 139/254 (54.72%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKL-TETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSL 760
            FLGRGL +L++ +   K+D    F CK +E++   MYF S+Y++V+ ++DR   I+K  +F +   H   A   C+ +  IG I +SPLL+   +  +  +     N +C++ +E   ++  + F++++ F +P  +V+  NIFI  +L K +  R  L  +   +     G  ++ G+LA+S+ FLL+ +P+   +++R  +T           + + + S+  SS+KD+ YA+NF+L + FL  FR   + L
Sbjct:   73 FLGRGLYYLTNHQFYFKLDTISKFWCKSVEYLSNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIY-HKHWALIACLLVYFIGIISNSPLLF---VQTLMIDISSRTNFTCRMISEHPIAKFTIAFETIVTFTIPFCLVLFLNIFICIELWKLKVHRTALLPADCSRNRMEMG--RVFGHLALSTAFLLLYLPMVCFVLIRLSQTLSHVDRHKPYAMNIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRL 320          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUG5 (GCR157 OS=Schmidtea mediterranea OX=79327 GN=gcr157 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.905e-17
Identity = 79/261 (30.27%), Postives = 129/261 (49.43%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYN------INNITYENRHFANTSCKLTETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLFT 766
            FLGRG+ + +  +I IKID      C+ M FIP  MY A+AY++V ++VDRY ++ K  ++ A    V      C+ IV +  +L+ PLL  Y       +NN + EN       C L  +  +   +Y +S    +  + I     IF+   ++ +   R    S      +  S   + +G+LA+S  F ++ +PL+I I++R +     KA   D  + L   SKF SS+KD+ +  N +L + F+  FRK  K + T
Sbjct:   77 FLGRGISYATDWKIVIKIDVYSTGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADK-GVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNN-SVENILNPEFECSLDNSALAHFELYSKS----LFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRLLHNS--KADNFDY-LFLKALSKFLSSVKDISFGGNIFLYLLFMPNFRKRCKQMVT 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040060.1 (SMESG000040060.1)

HSP 1 Score: 424.091 bits (1089), Expect = 3.010e-150
Identity = 251/274 (91.61%), Postives = 263/274 (95.99%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLFTGSGKETDTICESKHQLTQT 823
            FLGRGLDFLSSGRINIKIDQSVNFMCKL+EFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSLIVFVLPIFIVIICNIFIVNKLLKRRTLRKRLSSSSSIKKDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKD+HYAINFYLN+ FLE+FRKDVK LF+ + ++ +    +K  LT++
Sbjct:   72 FLGRGLDFLSSGRINIKIDQSVNFMCKLLEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSLIVFVLPIFIVIICNIFIVNKLLKRRTLRKRLSSSSSIKKDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDMHYAINFYLNITFLERFRKDVKKLFSFNRRQIENENSTKRHLTKS 345          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040061.1 (SMESG000040061.1)

HSP 1 Score: 421.009 bits (1081), Expect = 3.949e-149
Identity = 240/275 (87.27%), Postives = 259/275 (94.18%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLFTGSGKETDTICESKHQLTQTD 826
            F GRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVI+KG+QFPAP+  V RAKFIC+ ++ IG IL SPLLWYYNINN++YEN HF+N SCKL ++VFSEIL+YFQSL+VFVLPI IVIICN FIVNK+ +RR LRKRLSS+SSIKKDPNSGSMKLIGYLAISSGFLLISMPLAINIIVR++ TGPFKA+KSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLFTGSGKETDTICESKHQLTQTD
Sbjct:   68 FFGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVISKGSQFPAPSRQVKRAKFICVLVLFIGMILCSPLLWYYNINNLSYENSHFSNKSCKLYDSVFSEILLYFQSLLVFVLPIIIVIICNFFIVNKVRQRRILRKRLSSASSIKKDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRSIITGPFKASKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLFTGSGKETDTICESKHQLTQTD 342          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040059.1 (SMESG000040059.1)

HSP 1 Score: 213.386 bits (542), Expect = 9.713e-68
Identity = 121/254 (47.64%), Postives = 172/254 (67.72%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLF 763
            FLG+GL FL+S R+++K+DQS N +CKL EFIP +MYF+SAY++VVMAVDRY VI+KG ++P P+LH+ RAK +C  I+TIG + + PLLW YNIN  ++ N +F N SCK+  T+ +E ++  QS  + +  + I ++    I+      +  ++R   +S  K + NS  +KLIGYLAISS FL ISMP+AI   +  +    F+   +    +L E  KFTSSIKD+HY +NFY+N+ FL+QFR DVK LF
Sbjct:   69 FLGQGLSFLTSKRLHLKLDQSSNVICKLFEFIPNIMYFSSAYIIVVMAVDRYHVISKGVKYPLPHLHLSRAKILCTIIITIGGVFNIPLLWSYNINYESHGNINFNNKSCKVNHTLVTEWILNGQS--LVIFVLPIFVVIIYNILIVRKLIKRHKRRKRITSLSKANSNSELLKLIGYLAISSVFLFISMPMAITTSLMCLSKKYFELYYN----SLLEFYKFTSSIKDIHYGLNFYINLIFLKQFRNDVKRLF 316          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000016714.1 (SMESG000016714.1)

HSP 1 Score: 111.309 bits (277), Expect = 2.669e-28
Identity = 88/276 (31.88%), Postives = 160/276 (57.97%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLF-------TGSGKETDTICESKH 808
            FLGRG+++L+SG  + K +   N  C+L+EF P +MYF SAYV+VV  +DR  V++   +F  PN H+ +  F+   ++ +  I+S PL + +++    +  ++ +N SC+++++  S + +Y +SL++FV P  I+I+ N+ I+ +L + +  ++  +     + + N    ++ G++A+S  FL++++PL++ II+R           +D    L++ SK  SSIKD+ Y  N +L V FL  FRK   SLF       T   K +D+  ++KH
Sbjct:   69 FLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKF-VPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHL----FITKNISN-SCEVSKSHLSVVSLYIKSLLIFVSPTLIIIVLNVVIIYQLTQMQKYQRITTMLPVSRPEMN----RIFGHMALSIAFLILTIPLSLVIILRLSLNK--SEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNKLTTIFKISDSTTQAKH 332          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000072348.1 (SMESG000072348.1)

HSP 1 Score: 106.301 bits (264), Expect = 1.773e-26
Identity = 81/259 (31.27%), Postives = 139/259 (53.67%), Query Frame = 2
Query:    2 FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNSGSM----KLIGYLAISSGFLLISMPLAINIIVR-NVKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLF 763
            FLGRGL FL+  + +IKI++     C  ME++P VMYFAS+YVMV  ++DR  V+    ++ +P        FIC+ +  +GAI++ PLL+ Y++      N +    SC++  +      +Y +S     L IF++    +   N ++    L+ +    +   +  N GS     +++ +LA+S+ FLL+++PL+I II+R  +K              +   +K  SSIKDL YA+NF+L + F+  F+ +  S+F
Sbjct:   72 FLGRGLGFLTKNKFSIKIEELCQGSCLFMEYVPNVMYFASSYVMVAFSLDRMLVLALPIKY-SPYRGYRYTIFICLAVGVMGAIVAGPLLFSYSLEK---TNANSTEMSCQMINSKMVTFGLYLKS-----LVIFVIPTVFVASFNIVIYCLLLQTKKRRQNLSSRKTNRGSSSEMGRIVAHLALSTVFLLLTIPLSITIILRLIIKKNSLYNYSYSYKNNVIHLTKLLSSIKDLSYAVNFFLYLIFIPSFKYEFFSIF 321          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SMG72.057e-1926.98G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183QJJ71.307e-1830.31G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3U5C52.637e-1829.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
G4VJR31.092e-1729.53Putative peptide (Allatostatin/somatostatin)-like ... [more]
A0A193KUG52.905e-1730.27GCR157 OS=Schmidtea mediterranea OX=79327 GN=gcr15... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040060.13.010e-15091.61SMESG000040060.1[more]
SMESG000040061.13.949e-14987.27SMESG000040061.1[more]
SMESG000040059.19.713e-6847.64SMESG000040059.1[more]
SMESG000016714.12.669e-2831.88SMESG000016714.1[more]
SMESG000072348.11.773e-2631.27SMESG000072348.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015107 ID=SMED30015107|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=826bp
TTTTCTTGGAAGAGGTTTGGACTTTCTCAGCAGTGGACGTATCAATATCA
AAATCGATCAATCGGTAAATTTTATGTGCAAATTGATGGAATTCATTCCG
AGAGTCATGTACTTTGCTAGTGCATATGTCATGGTCGTGATGGCTGTTGA
CAGATATTTTGTCATCAACAAAGGCGCACAATTTCCCGCCCCAAATCTTC
ATGTATTTCGCGCTAAATTTATTTGTATTTTTATTGTAACAATTGGAGCA
ATTCTCTCCAGTCCCCTGTTGTGGTATTACAATATCAACAATATCACCTA
CGAAAATAGACATTTTGCTAACACAAGCTGTAAATTAACGGAAACCGTAT
TTTCTGAAATTTTAATGTATTTCCAGTCGTTGATTGTTTTCGTTTTGCCG
ATATTTATTGTCATTATTTGCAATATTTTTATTGTTAATAAACTTTTGAA
AAGAAGAACTTTAAGGAAACGTCTCAGTTCATCATCGAGTATTAAAAAAG
ATCCGAATTCGGGCTCAATGAAGTTGATTGGATATTTGGCGATTAGTTCG
GGATTTCTCCTGATTTCCATGCCATTGGCAATTAATATCATTGTAAGAAA
TGTCAAAACTGGTCCGTTCAAAGCCACTAAATCCGATGTTGGCGTTACGT
TGTCTGAAGCAAGCAAATTTACGTCATCAATTAAAGACCTGCATTATGCG
ATAAATTTCTATCTCAATGTGGCATTCCTTGAACAATTTCGTAAAGATGT
TAAAAGTTTATTTACGGGCAGTGGCAAGGAGACTGATACCATTTGCGAGA
GTAAGCATCAATTAACACAAACTGAC
back to top

protein sequence of SMED30015107-orf-1

>SMED30015107-orf-1 ID=SMED30015107-orf-1|Name=SMED30015107-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
FLGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVD
RYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITY
ENRHFANTSCKLTETVFSEILMYFQSLIVFVLPIFIVIICNIFIVNKLLK
RRTLRKRLSSSSSIKKDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRN
VKTGPFKATKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDV
KSLFTGSGKETDTICESKHQLTQTD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 122..145
score: 19.44
coord: 33..55
score: 27.45
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 23..201
e-value: 7.5E-18
score: 64.8
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 39..55
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 14..250
e-value: 7.3E-27
score: 96.1
NoneNo IPR availablePANTHERPTHR24229:SF40GH14208Pcoord: 22..249
NoneNo IPR availablePANTHERPTHR24229NEUROPEPTIDES RECEPTORcoord: 22..249
NoneNo IPR availableCDDcd152037tmA_NPYR-likecoord: 23..155
e-value: 9.8111E-12
score: 61.4663
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 24..248
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 31..53
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 1..239
score: 16.339