SMED30015093

Overview
NameSMED30015093
Smed IDSMED30015093
Length (bp)2128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015093 (SMED30015093) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015093 (SMED30015093) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015093 (SMED30015093) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015093 (SMED30015093) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015093

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015093SMESG000009339.1 SmedASXL_015198SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30015093SMESG000009339.1 dd_Smed_v4_9636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015093SMESG000009339.1 dd_Smed_v4_9636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30015093SMESG000009339.1 dd_Smed_v4_9636_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015093 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002182:353..4244 -6686
Homology
BLAST of SMED30015093 vs. Ensembl Human
Match: FAM120B (family with sequence similarity 120B [Source:HGNC Symbol;Acc:HGNC:21109])

HSP 1 Score: 56.6102 bits (135), Expect = 1.414e-7
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHI 694
            I G ++ E  +A RDF   F   G+KLI+  DG      + +Q K   W+ R  +N R + + +  +  +   P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   I
Sbjct:   71 ICGGQWREYFSALRDFVKTFTAAGIKLIFFFDG------MVEQDKRDEWVKRRLKNNREISRIFHYIKSHKEQPGRNMF--FIPSGLA--VFTRFALKTLGQETLCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSI 205          
BLAST of SMED30015093 vs. Ensembl Human
Match: FAM120B (family with sequence similarity 120B [Source:HGNC Symbol;Acc:HGNC:21109])

HSP 1 Score: 56.6102 bits (135), Expect = 1.414e-7
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHI 694
            I G ++ E  +A RDF   F   G+KLI+  DG      + +Q K   W+ R  +N R + + +  +  +   P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   I
Sbjct:   71 ICGGQWREYFSALRDFVKTFTAAGIKLIFFFDG------MVEQDKRDEWVKRRLKNNREISRIFHYIKSHKEQPGRNMF--FIPSGLA--VFTRFALKTLGQETLCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSI 205          
BLAST of SMED30015093 vs. Ensembl Human
Match: FAM120B (family with sequence similarity 120B [Source:HGNC Symbol;Acc:HGNC:21109])

HSP 1 Score: 56.6102 bits (135), Expect = 1.481e-7
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHI 694
            I G ++ E  +A RDF   F   G+KLI+  DG      + +Q K   W+ R  +N R + + +  +  +   P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   I
Sbjct:   82 ICGGQWREYFSALRDFVKTFTAAGIKLIFFFDG------MVEQDKRDEWVKRRLKNNREISRIFHYIKSHKEQPGRNMF--FIPSGLA--VFTRFALKTLGQETLCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSI 216          
BLAST of SMED30015093 vs. Ensembl Human
Match: FAM120B (family with sequence similarity 120B [Source:HGNC Symbol;Acc:HGNC:21109])

HSP 1 Score: 56.6102 bits (135), Expect = 1.481e-7
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHI 694
            I G ++ E  +A RDF   F   G+KLI+  DG      + +Q K   W+ R  +N R + + +  +  +   P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   I
Sbjct:   82 ICGGQWREYFSALRDFVKTFTAAGIKLIFFFDG------MVEQDKRDEWVKRRLKNNREISRIFHYIKSHKEQPGRNMF--FIPSGLA--VFTRFALKTLGQETLCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSI 216          
BLAST of SMED30015093 vs. Ensembl Human
Match: FAM120B (family with sequence similarity 120B [Source:HGNC Symbol;Acc:HGNC:21109])

HSP 1 Score: 56.6102 bits (135), Expect = 1.483e-7
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHI 694
            I G ++ E  +A RDF   F   G+KLI+  DG      + +Q K   W+ R  +N R + + +  +  +   P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   I
Sbjct:   59 ICGGQWREYFSALRDFVKTFTAAGIKLIFFFDG------MVEQDKRDEWVKRRLKNNREISRIFHYIKSHKEQPGRNMF--FIPSGLA--VFTRFALKTLGQETLCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSI 193          
BLAST of SMED30015093 vs. Ensembl Zebrafish
Match: fam120b (family with sequence similarity 120B [Source:ZFIN;Acc:ZDB-GENE-040801-119])

HSP 1 Score: 53.1434 bits (126), Expect = 9.883e-7
Identity = 62/276 (22.46%), Postives = 109/276 (39.49%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFER-NMRVYKTYLDMCKNPPSPLQK-IFEKIIRPCLTSDM--FKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFS-ENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQSTKLIDSSEFESFSIDKPELKLSVQFS 1075
            + G ++ E +N  ++F   F   G++LI+  DG        +++K   WI R  R N  + K +  +  +   P  + +F      CL S +  F    +K  G        E DY++A+     N   +L  D+DF I++  P + I    ++                        +T  L S + L   L+L  HD L   S L+GND   +   + LRN     ++    ++            Q  ++  ++EF   +I KP  + +V  S
Sbjct:   59 VHGGQWKEYINILQEFINAFTAAGIRLIFFFDGTV------EERKRSEWIKRRLRVNQDIAKVFQHIKTHNQQPNSRNLF------CLPSGLATFSRFALKSLGQETFCSVREGDYEVADYALSHNCMGILGQDTDFVIYNTVPYLSISKLHLN-----------------------SMTTVLFSREKLCRVLQLHVHD-LPLLSCLLGNDVVHEQQMQRLRNIALDSYRMKCKEV------------QGDRVYAAAEF--INIHKPSCEGTVGLS 284          
BLAST of SMED30015093 vs. Ensembl Xenopus
Match: fam120b (Xenopus tropicalis family with sequence similarity 120B (fam120b), mRNA. [Source:RefSeq mRNA;Acc:NM_001367998])

HSP 1 Score: 52.7582 bits (125), Expect = 1.874e-6
Identity = 55/212 (25.94%), Postives = 92/212 (43.40%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNGCY---ETYDLVALA----KSNPDLE--ILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFER-NMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCP 682
            MGI GL +F++ N C     T +L  LA     SNP+    I+VD  G             +  +      + G ++ E L + + F   F   G++L++I DG      + ++ K + W+ R  R N  + K +  +  N   P + +F     P   S   K+ +   G  +I L + E DY++A    +     +L  DSD+ IF+  P
Sbjct:    1 MGIKGLQSFVQ-NSCSNVCSTVNLRTLAARHKSSNPESSPTIVVDAMGC------------LRTWYTPNDWVHGGQWKEYLCSLQTFISAFQAAGIRLVFIFDG------VIEKTKREEWVKRRLRDNNEISKIFDFIKANGQQPGRNMF---FIPSGISTFTKSALKSLGQEVI-LSHVEGDYEVAAYGLQHQCLGILGEDSDYLIFNTVP 189          
BLAST of SMED30015093 vs. Ensembl Xenopus
Match: fam120b (Xenopus tropicalis family with sequence similarity 120B (fam120b), mRNA. [Source:RefSeq mRNA;Acc:NM_001367998])

HSP 1 Score: 52.7582 bits (125), Expect = 1.960e-6
Identity = 55/212 (25.94%), Postives = 92/212 (43.40%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNGCY---ETYDLVALA----KSNPDLE--ILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFER-NMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCP 682
            MGI GL +F++ N C     T +L  LA     SNP+    I+VD  G             +  +      + G ++ E L + + F   F   G++L++I DG      + ++ K + W+ R  R N  + K +  +  N   P + +F     P   S   K+ +   G  +I L + E DY++A    +     +L  DSD+ IF+  P
Sbjct:    1 MGIKGLQSFVQ-NSCSNVCSTVNLRTLAARHKSSNPESSPTIVVDAMGC------------LRTWYTPNDWVHGGQWKEYLCSLQTFISAFQAAGIRLVFIFDG------VIEKTKREEWVKRRLRDNNEISKIFDFIKANGQQPGRNMF---FIPSGISTFTKSALKSLGQEVI-LSHVEGDYEVAAYGLQHQCLGILGEDSDYLIFNTVP 189          
BLAST of SMED30015093 vs. Ensembl Mouse
Match: Fam120b (family with sequence similarity 120, member B [Source:MGI Symbol;Acc:MGI:1914794])

HSP 1 Score: 54.299 bits (129), Expect = 4.877e-7
Identity = 39/146 (26.71%), Postives = 65/146 (44.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIG 697
            + G ++ E   A R+F   F + G+KLI+  DG      + +  K   W+ R  +N R + K +  +      P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   IG
Sbjct:   59 VCGGQWREYYCALRNFVAAFTSAGIKLIFFFDG------MVEPGKRDEWVKRRLKNNREISKIFHYIKSKRDQPGRNMF--FIPSGLA--IFTRFALKTLGQETFCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSIG 194          
BLAST of SMED30015093 vs. UniProt/SwissProt
Match: sp|A6QNT4|F120B_BOVIN (Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Bos taurus OX=9913 GN=FAM120B PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 5.518e-7
Identity = 39/151 (25.83%), Postives = 68/151 (45.03%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDID 712
            + G ++ E  ++ R+F   F  +G+KLI+  DG      + +Q K   W+ R  +N R + K +  +      P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   I    +D
Sbjct:   59 VCGGQWREYYSSLREFVRTFTAVGIKLIFFFDG------MVEQSKRDEWVKRRLKNNREIAKIFHYIKSRREQPGRNMF--FIPSGLA--IFTRFALKALGQETLCSLQEADYEVASYGFQNNCLGILGEDTDYLIYDTCPYFSISELSLD 199          
BLAST of SMED30015093 vs. UniProt/SwissProt
Match: sp|Q96EK7|F120B_HUMAN (Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=FAM120B PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 7.120e-7
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHI 694
            I G ++ E  +A RDF   F   G+KLI+  DG      + +Q K   W+ R  +N R + + +  +  +   P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   I
Sbjct:   59 ICGGQWREYFSALRDFVKTFTAAGIKLIFFFDG------MVEQDKRDEWVKRRLKNNREISRIFHYIKSHKEQPGRNMF--FIPSGLA--VFTRFALKTLGQETLCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSI 193          
BLAST of SMED30015093 vs. UniProt/SwissProt
Match: sp|Q6RI63|F120B_MOUSE (Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Mus musculus OX=10090 GN=Fam120b PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 3.412e-6
Identity = 39/146 (26.71%), Postives = 65/146 (44.52%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIG 697
            + G ++ E   A R+F   F + G+KLI+  DG      + +  K   W+ R  +N R + K +  +      P + +F   I   L   +F    +K  G        EADY++A+   + N   +L  D+D+ I+  CP   IG
Sbjct:   59 VCGGQWREYYCALRNFVAAFTSAGIKLIFFFDG------MVEPGKRDEWVKRRLKNNREISKIFHYIKSKRDQPGRNMF--FIPSGLA--IFTRFALKTLGQETFCSLQEADYEVASYGLQHNCLGILGEDTDYLIYDTCPYFSIG 194          
BLAST of SMED30015093 vs. TrEMBL
Match: A0A210QAR5 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT01511 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.060e-43
Identity = 167/633 (26.38%), Postives = 264/633 (41.71%), Query Frame = 2
Query:   77 MGIPGLFT--FLKRNGCYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKN--PPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRER-NSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDF--SENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQSTKLIDSSEFESFSIDKPELKLSVQF------SMDFYKQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEY-EVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFF 1933
            MG+ GL +    +RN C    DL+ +A+    +EILVD+Y  E  ++E+    L     N+YL I G EY  L    +        +G++L++  DG +G      ++K  +WI R  R +   +  + +C    P + LQ    + +R  L  + FK+ + +    +     GEAD  IA    +R  ++AV +NDSDF IF +C  I    FD+  D   G  V D        I P+RL VG+ +   +M  L L  HD L++ SI+ GND+T  +     L+   EIK +           VA+W+        D +  E+  +   E++ ++ F      S +FY       +P             L    ++G   +  + + + F + R  V+ +  G        L PL+  +Y ++LQ+  S V EY   P  P  T  +   + S         PDK          W+   F  I    E+       +F R+G + GF  Y LR    ++        +L +TENEF ++      R            ++ Y  I  R            P+  C T   W Q +Y+ AY   GK L+I+  FP   E  SG V T F+
Sbjct:    1 MGVRGLLSACMRQRNACVHEVDLIQVARERGGIEILVDYYSFELFVMEQFWFSLCHHQHNDYLWILGGEYASLDVYLKKLIQHLKALGIQLVFFVDGARGASTETTREKLDTWIERHHRELGKIRDIMSVCCGFMPITELQ----ENVRATLQEEQFKHTLRQCDCEVYQDPAGEADCVIAQALHQREKAYAVFSNDSDFCIFRDCTFIPRTQFDLMGDLQLG-AVCDM------PIKPERLMVGVITTDRVMAILGLPRHDLLVELSIVGGNDFTGQYIHKGGLQQKLEIKGR-------GIEGVADWIR-------DHTVPETHPVFAQEMRHNMGFRGAVVHSRNFYNL----GVPPLKPSKTGHLSQILEKGIREGHFVARVMGMHNNFYWHRAVVEDLSEG-QPCAEVALAPLRAHVYRIVLQRHESMVEEYGRSPWEPMRTAGVLAVEDSNIPSIHRIQPDK--------IFWNLKHFHYIMSHMERRTGSESKWFERYGRKTGFSVYLLRYFLLLNWGR-----NLFVTENEFLALLAMSLGR----------PSAAKYQGICVR------------PTPRCVTLGSWYQDLYYHAYCFLGKLLSISHEFPLPCEAYSGAVWTVFY 568          
BLAST of SMED30015093 vs. TrEMBL
Match: A0A1S3HAE6 (uncharacterized protein LOC106153553 OS=Lingula unguis OX=7574 GN=LOC106153553 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.072e-40
Identity = 163/623 (26.16%), Postives = 259/623 (41.57%), Query Frame = 2
Query:   77 MGIPGLFTFL--KRNGCYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKI-IRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRER-NSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQSTKLIDSSEFESFSIDKPELKLSVQFSMDFYKQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFF 1933
            MG+ GL ++    +  C E YDL+  A     LEIL+D+Y  +Q IL      L +   N YL + G EY  L            ++G+ +++  DG KG    + QQK ++W  R  + +R  K   D+CK     +Q + + + +RP L        + K    II    GEAD+ IA     R  ++AVL+NDSDF I  N   I   LFD+D     G   + +L   +P      L VG+ + + ++      +H  L+D SI+ GND+T  + ++L N  +++      +    M+  + +E      I + E +      P+   +V  S  FY        P      +E    YL    Q G + S  +++   F + R  ++    G+       L  L+T IY ++L +  + V EY      D   +      +         PD+      F+   S   F  I   QE +    L++F R+G + GF    LR    ++        +L IT  EF SV  T F                      + + + W+  + I PSS C T   W Q +Y  AY   G+ L +   FP  +E  +G   TAF+
Sbjct:    1 MGVRGLLSYCLCNQEQCVEYYDLIEEANRKGGLEILIDYYSFQQMILTNFWKSLRAVKHNPYLRLEGGEYSTLDAYLSKLVQDLQSLGIHMVFYIDGAKGSSYFSTQQKLETWKSRHYKELRTLKQLTDVCKGVMD-IQALPDDVNVRPVLLEVQVLGTLKKCNCEIIQNSCGEADFVIAEGLIHRPKAFAVLSNDSDFCIMQNSRFIPNELFDLDNAIQLG---QASLLPQKPI----SLKVGVITTERVLQLFGFRSHRLLVDLSIVNGNDFTAHYMKSLYNLLDVRGAKKVENFAGWMRHYKGIENHP---ILARELQY----NPQFATAVMTSRQFYTLTAPPDRPTMKCPLSE----YLEQAVQHGALPSNIMAMHSNFYWHRFLLEDSTPGL-PCAEVALQSLRTFIYRMVLPRYENYVYEYGRTPDSDLKTIQVHAAHASLPPVSNIKPDRT-----FE---SLKLFHRIMMHQEPDFE--LNFFQRYGRKSGFIFCILRYFLVLNWGQ-----NLYITPVEFLSVLATAFG--------------------WEHHKDQWYQNIAIRPSSRCVTIGNWFQALYRYAYNFLGQMLYLNQEFPPPHEIFAGARWTAFY 568          
BLAST of SMED30015093 vs. TrEMBL
Match: A0A0L8GFX0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22034150mg PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.013e-38
Identity = 156/638 (24.45%), Postives = 274/638 (42.95%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNG--CYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMK-VAEWVEKQSTKLIDSSEFESFSIDKPELKLSVQFSMDFYKQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLL---QKGI-------------STVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFF 1933
            MG+ GLF++  +N   C    DLV +A+    +EILVD+Y     + ++ +  L++  +N+YLL+ G EY  L            ++ + L ++ DG +G  K   +++  +W+ R +++MR  K  L +  N  S    + + I+RP L   +F + + + G  ++N   GEAD  +A    +  ++A+ + DSDF +F +C  I   LFDI  D      +        P   P  L +GL S + +     LS+ D+LI+ +I+ GND T   S  +RN   + +K D  +  + ++ +  WV K   ++ +    ++   +  E  L+VQ S  FYK    E +  +   +       +++R +   +    L   HG  +Q+   +  +      I +LL  L++ IY +LL   + G+              TV+  +   +P +  +     S            +   W   D  W R                  +YF R+G   GF  YCLR    ++ +      +L ITE EF ++ C +F         + ++Y        +RYP        + P+S C T   W+Q I+  AY   G  L +   FP      SG+    ++
Sbjct:    1 MGVQGLFSYCLKNQKQCCTFVDLVEVAREQKGIEILVDYYCFANWVYDKFMTNLLNINKNKYLLLYGGEYSSLSLYVTALIKNLQSVDIHLTFLIDGARGSCKETTKRRLNTWLSRSQKDMRKIKNMLSVFYNEISIEDLLCDDIVRPVLRDMIFTSALTECGCKVVN-CSGEADDMMAKQLLDSKAFAIFSYDSDFCLFKDCCCIPPKLFDIHND------MELEYCGEVPK-KPLHLQIGLISTERVSHMFGLSS-DELIELAIVCGNDLT---SHYMRNNQTLLYKLDIRERKNQLENIVAWV-KSYKRIENHPLLDNEMRNNSEFALAVQLSRSFYK---LELVQDYDDNNKGSLTELVIERLKTKTLHPKMLGAHHGLYWQKVLFED-LYNYWPGIETLLSNLRSCIYRILLPLNEMGVIDYGWDQSLTIMPHTVSVAKWKWLPQFEEIKKENISHNLKIFHKIITQQEPGWKTQD--WPR------------------NYFIRYGRHNGFIFYCLRYFLLLNWQH-----NLFITEREFLTLICLLF------THKEEKQY--------QRYP--------LTPTSRCITINNWMQDIFHHAYGYLGTLLFLTEEFPRPATLFSGSTWVVYY 574          
BLAST of SMED30015093 vs. TrEMBL
Match: A0A2T7PUB9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04002 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.959e-38
Identity = 157/631 (24.88%), Postives = 275/631 (43.58%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNG--CYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQ-NEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRER-NSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQSTKLIDSSEFESFSIDKPELKLSVQFSMDFYKQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYNAWDFFDANWSRTD--------FTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFF 1933
            MGI GL + ++++   C +T +L+ +A     +E++VDFY  E  ++  +L K +  ++ NE L I GAEY  +            ++G+  +++ DG KG    + + K  +W  R   +++  +  L+MC       +   +  IRP L        +   G  +I +  GEAD  IA    ER  ++AVL+NDSDF IF N   I   LFDI+ D   G+++        P   P +L  G+ + + +   L+    + L++ SI+ GND+T     +   F +     ++  I   +  A+WV +Q  ++ ++  F+   +    L  +V+ S  FY  +  + I +   KD   F N +VDR + G+  +  +S++  F + R  +    +    +   LL PL+  +Y++LL +  + VTEY      D+ ++ N                  N  +    N  R +        F  I    E    P   +F+++G + GF  Y LR    ++         L +TE EF ++  T F          + + SS             + +L++CP   C T     Q IY  A+   G  L++   FP   E  SG++ T  +
Sbjct:    1 MGIRGLMSVIQKHSSECSQTVNLIEIAHEKGGIELVVDFYSFEHLVITDSLWKSLGSFKMNESLRIMGAEYATIDAYISKLITDLKSLGISFVFVLDGSKGSSYADTRHKIDTWKRRHRNDVQRKRDILEMCSGHKLMTELQEDAAIRPVLLEIQVVQALRDAGCEVIQVAEGEADLIIAKQFAEREKAYAVLSNDSDFCIFKNTCFIPKCLFDINGDLGLGQSLA------LPQ-KPTQLICGVVASQRVQQFLKFPAVEMLVELSIVAGNDFTGPHMPH--GFADRLQVANYRSI---LSYADWV-RQHVQVENNQVFKQEMMRNRNLANAVEHSRKFYS-LDADLIGE-AGKDGYIF-NLIVDRVKSGQYPANFVSIYRCFYWYRYILDDKYLCAPAE--ELLAPLRADLYAILLPRHKAFVTEYGQTMRQDFQQMQNYAV---------------NDKNLPSLNHIRENQIFRNMRLFHYIMTRLEPGQAPEKTWFDKYGRKTGFIFYILRYFLLLNWGQC-----LNVTEAEFLALVATAF---------GASKESS-------------WQELRVCPDPRCLTIAALFQDIYRHAFLFLGSVLHLKHEFPLPKEIFSGSMWTVLY 571          
BLAST of SMED30015093 vs. TrEMBL
Match: K1QJE9 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10014990 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 7.198e-36
Identity = 158/683 (23.13%), Postives = 273/683 (39.97%), Query Frame = 2
Query:   77 MGIPGLFT--FLKRNGCYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRER-NSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDF-SENLRNFCEIKWKYDFSDIPHSMKVAEWVEK----QSTKLIDSSEFESFSIDKPELKLSVQFSMDFY--KQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEY----------------EVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHNDG--QRVRNLESKNINSIYEMM-STIYDEFYPV 2038
            MGI GL +    +R  C +  DLVALAKS   +EI+VDFY  E  ++ +    L S   N++L I G EY  L    + F  +F  + +  ++I D  KG  + N QQK  +W+ R  + +      +++C+          +   RP          ++  G  II  + GEAD+ IA    +R  ++A+ +NDSDF +F  C  I   LFDI      G  +          + P+ +  G+ S + +   L   +   +++ SI+ GND+T  + S  L    +I+ +            AEWV++    ++  +++     + S  +     +V+ S  FY  +  P E +          F   L ++    +  S  +++ + F + R   +    G        L  L+  IY ++L +  + V EY                + PN+P   ++                 DK          W+   F  I   QE    P   +F+R+G + GF  YCLR                             +     R +Q Q Q + +L   +  R   + + +++I P+  C +   W   +Y  A+   GK L +   FP   E  SG+V T F+    +D      R    + ++ I + M + I D+ +P+
Sbjct:    1 MGIRGLLSHCLRRREECVDEVDLVALAKSRGGIEIIVDFYSFEHMVVPKFWKGLSSLRNNQFLKILGGEYKSLETFIKRFIEIFRQLKISFVFIKDATKGCSEANSQQKLDTWMKRHHKEVENLNEVINVCRGRKEMSNLDEQMFTRPVCLEIQIVETLMSCGCEIIQSVTGEADFMIAKALHDREKAFAIWSNDSDFCVFDKCRFIPNDLFDIYNGLQMGLPI-------EVPVKPESVWCGIISSEKVRFSLGFQSPHLMVELSIIAGNDFTSQYVSTGLNRQIDIRGRIGVETF------AEWVKRYRGIENHPMLNREMSRNVSFAR-----AVEHSRMFYCLQSNPEEIV------HKGYFSKLLAEKISSLKYPSHLMAMHNNFYWHRLLQEDTTRG-QPCAEEALTELRALIYRIVLPRRENLVNEYGRSPWDTLRIEGVLAIDDPNLPALHKIQE---------------DK--------IFWNLNSFHYIMSHQEPVERP--KWFDRYGRKNGFIVYCLRYF---------------------------LLLNWGRNLQLQQQEFLALCALVFARPREEHYQQIQIRPTPRCVSIGNWFLDVYRHAFLFLGKLLYLTHEFPLPEEIYSGSVWTCFYMCCKDDTYYAASRQTTQEVLSWIQDQMNAVISDKRHPI 606          
BLAST of SMED30015093 vs. Ensembl Cavefish
Match: fam120b (family with sequence similarity 120B [Source:ZFIN;Acc:ZDB-GENE-040801-119])

HSP 1 Score: 53.9138 bits (128), Expect = 4.051e-7
Identity = 38/156 (24.36%), Postives = 68/156 (43.59%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERN----MRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDM--FKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDID 712
            + G ++ E ++   +F   F   G++L++  DG        ++QK   W+ R  R      R+++   + C+ P    + +F      CL S +  F    +K  G  +     E DY+IA      N  A+L ND+DF I+   P + I    ++
Sbjct:   59 VHGGQWQEYMHFLEEFVGAFTRAGLRLVFFFDGTV------EEQKRAEWVKRRLRVNKDIARMFQYIKNHCQQPD---RDMF------CLPSGLATFSRFALKSLGQEVWCSVREGDYEIAQFALSNNCMAILGNDTDFVIYDTVPYLSIAKLKLE 199          
BLAST of SMED30015093 vs. Ensembl Cavefish
Match: fam120b (family with sequence similarity 120B [Source:ZFIN;Acc:ZDB-GENE-040801-119])

HSP 1 Score: 53.9138 bits (128), Expect = 5.066e-7
Identity = 38/156 (24.36%), Postives = 68/156 (43.59%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERN----MRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDM--FKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDID 712
            + G ++ E ++   +F   F   G++L++  DG        ++QK   W+ R  R      R+++   + C+ P    + +F      CL S +  F    +K  G  +     E DY+IA      N  A+L ND+DF I+   P + I    ++
Sbjct:   59 VHGGQWQEYMHFLEEFVGAFTRAGLRLVFFFDGTV------EEQKRAEWVKRRLRVNKDIARMFQYIKNHCQQPD---RDMF------CLPSGLATFSRFALKSLGQEVWCSVREGDYEIAQFALSNNCMAILGNDTDFVIYDTVPYLSIAKLKLE 199          
BLAST of SMED30015093 vs. Ensembl Sea Lamprey
Match: fam120b (family with sequence similarity 120B [Source:ZFIN;Acc:ZDB-GENE-040801-119])

HSP 1 Score: 54.299 bits (129), Expect = 6.862e-8
Identity = 39/167 (23.35%), Postives = 72/167 (43.11%), Query Frame = 2
Query:  263 IPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMR-VYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDH 760
            + G ++ E L +  +F     ++G+ L++  DG        QQ K + W  R  +N R +   +  + +    PL  +   +I   L S  F    ++  G  +     EADY++A   R +N   +L  D+D+ ++   P + I   D++        VR  L +H
Sbjct:   59 VQGGQWKEYLQSLDNFLRRLADVGLHLVFFFDGS------TQQPKRQEWARRRHQNSREISCIFRHIQQTGQQPLDNM--SVIPSGLCS--FTRAALQALGAEVIRTTREADYEVAEFARSKNCIGILGQDTDYLVYDTVPYLSINSLDLE-TLTTVMYVRGRLCEH 214          
BLAST of SMED30015093 vs. Ensembl Medaka
Match: fam120b (family with sequence similarity 120B [Source:NCBI gene;Acc:101166119])

HSP 1 Score: 60.4622 bits (145), Expect = 5.024e-9
Identity = 56/223 (25.11%), Postives = 100/223 (44.84%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNGCYETYDLVAL--------AKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFER-NMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDM--FKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDID 712
            MG+ GL +F++R  C E    V L        A++  D  ++VD            +  L   Y  E  +  G ++ E ++  + +   F + G++L++  DG      + +Q+K + WI R  R N  V K +  + ++   P +++F      CL S +  F    ++  G  +     EADY+IA+  R+  S  +L  DSDF I+ + P   +    I+
Sbjct:    1 MGVKGLQSFMERC-CPEACVTVNLREMARRHAAQTQQDPTLVVD-----------GMACLCHWYSCEDWVC-GGQWKEYVDVLKSWVDAFTSAGIQLVFFFDG------VVEQRKRQEWIKRRRRVNGDVSKIFRHIKEHGEKPHKELF------CLPSALATFTPFALRFLGQPVFCSVREADYEIASYARQYGSMGILGQDSDFIIYDSVPYFSVAKLRIN 198          
BLAST of SMED30015093 vs. Ensembl Medaka
Match: fam120b (family with sequence similarity 120B [Source:NCBI gene;Acc:101166119])

HSP 1 Score: 60.4622 bits (145), Expect = 5.024e-9
Identity = 56/223 (25.11%), Postives = 100/223 (44.84%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNGCYETYDLVAL--------AKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFER-NMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDM--FKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDID 712
            MG+ GL +F++R  C E    V L        A++  D  ++VD            +  L   Y  E  +  G ++ E ++  + +   F + G++L++  DG      + +Q+K + WI R  R N  V K +  + ++   P +++F      CL S +  F    ++  G  +     EADY+IA+  R+  S  +L  DSDF I+ + P   +    I+
Sbjct:    1 MGVKGLQSFMERC-CPEACVTVNLREMARRHAAQTQQDPTLVVD-----------GMACLCHWYSCEDWVC-GGQWKEYVDVLKSWVDAFTSAGIQLVFFFDG------VVEQRKRQEWIKRRRRVNGDVSKIFRHIKEHGEKPHKELF------CLPSALATFTPFALRFLGQPVFCSVREADYEIASYARQYGSMGILGQDSDFIIYDSVPYFSVAKLRIN 198          
BLAST of SMED30015093 vs. Planmine SMEST
Match: SMESG000009339.1 (SMESG000009339.1)

HSP 1 Score: 1342.02 bits (3472), Expect = 0.000e+0
Identity = 660/662 (99.70%), Postives = 661/662 (99.85%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNGCYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQSTKLIDSSEFESFSIDKPELKLSVQFSMDFYKQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHNDGQRVRNLESKNINSIYEMMSTIYDEFYPVYKAILEPF 2062
            MGIPGLFTFLKRNGCYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQSTKLIDSSEFE FSIDKPELKLSVQFSMDFYKQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLINIPKSSINIKSFLEFPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSS+CETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHNDGQRVRNLESKNINSIYEMMSTIYDEFYPVYKAILEPF
Sbjct:    1 MGIPGLFTFLKRNGCYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQSTKLIDSSEFERFSIDKPELKLSVQFSMDFYKQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLINIPKSSINIKSFLEFPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSICETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHNDGQRVRNLESKNINSIYEMMSTIYDEFYPVYKAILEPF 662          
BLAST of SMED30015093 vs. Planmine SMEST
Match: SMESG000001486.1 (SMESG000001486.1)

HSP 1 Score: 236.498 bits (602), Expect = 3.633e-68
Identity = 186/687 (27.07%), Postives = 323/687 (47.02%), Query Frame = 2
Query:   77 MGIPGLFTFLKRNG-CYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLD--MCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVR----DNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCE-IKWKYDFSDIPHSMKVAEWVEKQST---KLIDSSEFESFSIDKPELKLSVQFSMDFY------KQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDI---NSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYN--------AWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHND-GQRVRNLESKNINSIYEMMSTIYDEFYPVYKAI 2050
            MGI GLFT +  +   Y  +DLV  AK    +EIL+DF+  ++H++E   +K++ +Y NEYLL    EYD    AF +FH +F +IG+K ++I DGPKG+D+L   +K ++WI R ++++   K  LD  + K+PP  L       + P L  ++    + K G  II L+ G +D  IA+   +R S+AV+T D+DF +F +C  I   L  I     +G  ++    DN +  +    P      + + K +      +++D+++  SI+ GND T D+++ L+ + + IK +   + + H   VA ++ K       +      + F  + P+ + S++F  +FY      +    + I    +  ++   ++   +  K EIS    S   G  Y       I+   N++    +SL+  ++++IY  +L   +  V E+   +  D   +I +  +          P+  N          D FD  WS  +               L +F +F  EIGF CY LR  + ++K       +L +++ EF+++F T+F+          Q   S   +   +   D F  +KICP   C     W   IYF+     G + N+   FP A + +S +VL AF+EY  ND  +RV +L+   + SI ++  ++   F   Y A+
Sbjct:    1 MGIRGLFTMIANDERAYTMFDLVKEAKDRDGIEILIDFHAFQRHLVEIISIKMVQEYDNEYLLFSSGEYDIFSKAFSEFHKIFSDIGIKFVWIIDGPKGVDELASTRKTETWIKRDKQDIAQLKGVLDGTLKKSPPKDLNN-----LGPMLGFELSIESLRKCGAEIIQLLQGGSDEFIASEFLKRKSFAVITGDTDFLVFRDCIVIFPRLMTIH----YGDTLKLPFIDNENPGQIFKTPASFHCPVITHKEMYKLFNFTSYDQIVALSIIKGNDNTEDYAQKLQFYLKIIKNQTKHAHVTH---VANYIVKNKVTPDNIFRLPGMDRFLNENPQCRESIKFCYEFYTLKIYKENYENDKIIFDPNVASDSLTDFFRKKLSKSEISKKIYSAHKGTFYD----VVIMEKPNEECPSNSSLMSTIRSKIYPYVLDTELHEVKEWRFRD-SDKEFIIPVEHAPFKTDLIKAKPESENERDDSIIYGVDLFDETWSHLERGS------------LHFFKKFDLEIGFLCYILRYFYKLTKNK-----NLKVSQVEFKALFITIFY----------QYGVSQEIKFETKLKRDIFLGMKICPMEKCLIMYSWFMNIYFMGKYFTGGAFNLTKDFPTAEKVMSASVLYAFYEYYMNDRNRRVEHLDETVVESIKDLGESVLAHFSDQYDAV 643          
BLAST of SMED30015093 vs. Planmine SMEST
Match: SMESG000001486.1 (SMESG000001486.1)

HSP 1 Score: 227.254 bits (578), Expect = 7.163e-65
Identity = 179/672 (26.64%), Postives = 314/672 (46.73%), Query Frame = 2
Query:  119 CYETYDLVALAKSNPDLEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLD--MCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNCPTIHIGLFDIDRDFMHGRNVR----DNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCE-IKWKYDFSDIPHSMKVAEWVEKQST---KLIDSSEFESFSIDKPELKLSVQFSMDFY------KQIPTEPIPQFTSKDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDI---NSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPDKYN--------AWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHND-GQRVRNLESKNINSIYEMMSTIYDEFYPVYKAI 2050
             Y  +DLV  AK    +EIL+DF+  ++H++E   +K++ +Y NEYLL    EYD    AF +FH +F +IG+K ++I DGPKG+D+L   +K ++WI R ++++   K  LD  + K+PP  L       + P L  ++    + K G  II L+ G +D  IA+   +R S+AV+T D+DF +F +C  I   L  I     +G  ++    DN +  +    P      + + K +      +++D+++  SI+ GND T D+++ L+ + + IK +   + + H   VA ++ K       +      + F  + P+ + S++F  +FY      +    + I    +  ++   ++   +  K EIS    S   G  Y       I+   N++    +SL+  ++++IY  +L   +  V E+   +  D   +I +  +          P+  N          D FD  WS  +               L +F +F  EIGF CY LR  + ++K       +L +++ EF+++F T+F+          Q   S   +   +   D F  +KICP   C     W   IYF+     G + N+   FP A + +S +VL AF+EY  ND  +RV +L+   + SI ++  ++   F   Y A+
Sbjct:    8 AYTMFDLVKEAKDRDGIEILIDFHAFQRHLVEIISIKMVQEYDNEYLLFSSGEYDIFSKAFSEFHKIFSDIGIKFVWIIDGPKGVDELASTRKTETWIKRDKQDIAQLKGVLDGTLKKSPPKDLNN-----LGPMLGFELSIESLRKCGAEIIQLLQGGSDEFIASEFLKRKSFAVITGDTDFLVFRDCIVIFPRLMTIH----YGDTLKLPFIDNENPGQIFKTPASFHCPVITHKEMYKLFNFTSYDQIVALSIIKGNDNTEDYAQKLQFYLKIIKNQTKHAHVTH---VANYIVKNKVTPDNIFRLPGMDRFLNENPQCRESIKFCYEFYTLKIYKENYENDKIIFDPNVASDSLTDFFRKKLSKSEISKKIYSAHKGTFYD----VVIMEKPNEECPSNSSLMSTIRSKIYPYVLDTELHEVKEWRFRD-SDKEFIIPVEHAPFKTDLIKAKPESENERDDSIIYGVDLFDETWSHLERGS------------LHFFKKFDLEIGFLCYILRYFYKLTKNK-----NLKVSQVEFKALFITIFY----------QYGVSQEIKFETKLKRDIFLGMKICPMEKCLIMYSWFMNIYFMGKYFTGGAFNLTKDFPTAEKVMSASVLYAFYEYYMNDRNRRVEHLDETVVESIKDLGESVLAHFSDQYDAV 635          
BLAST of SMED30015093 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 208.764 bits (530), Expect = 2.406e-58
Identity = 192/656 (29.27%), Postives = 309/656 (47.10%), Query Frame = 2
Query:  167 LEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNC----PTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQST---KLIDSSEFESFSIDKPELKLSVQFSMDFY-----KQIPTEPIPQF-TSKDNEEFWNYLVDRYQKGEIS-SMCLSVFHGFCYQRNCV----QPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPD---------KYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHND-GQRVRNLESKNINSIYEMMSTIYDEFYPVYKAI 2050
            +EILVDF    + + E  L K+I+ + N++L I   E D    A+ +FH MF  IG+KL++I DG KGLD++   +K ++W YR  +        L+ CKN   P++  F+ +I    +    +N +   G  +I L+ G +D  IA+    R S+A+ +ND+DF +F +C    P I   ++  +  FM   N  +     RPT    +L   + +   +   L+ STH+++I  SIL GND T ++S+NL     I    D    PH  +VA++++        L D     +F  + PE K +V F  DFY     ++   + +  F     +    ++L  +  K EIS S+ +S F  +    +CV    +PI       I +++  +++RIY  +L   +  VTE++  +      LIN+  S       +  PD         KY   D F+  WS        +SQ+      L++  +FG E GF CY LR L+ V+    +E     +T  EF ++F  VF+R   R+       ++L  +I        F  +KICP+  C T   W   IY  A    G +LN+   FP A   +S TV  AF+E   ND  +RV +L+   I  I ++ + I +     Y+AI
Sbjct:    1 MEILVDFSSFRRGLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNSVDAVLECCKN-KMPVKN-FKDVISWAYSLTALEN-LKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFF--KRPT----KLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLD--RWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRY----SCVFWIEKPI--DAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGI--LINVVHSPFKSNLIISKPDPESERQNGVKY-GIDIFEEIWSHL------ESQDS-----LNFVYQFGLEKGFLCYILRYLYKVTHGLNIE-----MTAKEFDAIFAMVFYRY--RLSINMPFRTNLNQDI--------FLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAI 610          
BLAST of SMED30015093 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 206.068 bits (523), Expect = 1.748e-57
Identity = 190/656 (28.96%), Postives = 307/656 (46.80%), Query Frame = 2
Query:  167 LEILVDFYGIEQHILERTLLKLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLDKLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTSDMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHNC----PTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDRLRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVAEWVEKQST---KLIDSSEFESFSIDKPELKLSVQFSMDFY-----KQIPTEPIPQF-TSKDNEEFWNYLVDRYQKGEIS-SMCLSVFHGFCYQRNCV----QPIIVGVNKDINSLLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLXXXXXXXXXXXXFLEFPD---------KYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCYCLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSSLYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIALHFPDAYEFISGTVLTAFFEYVHND-GQRVRNLESKNINSIYEMMSTIYDEFYPVYKAI 2050
            +EILVDF    + + E  L K+I+ + N++L I   E D    A+ +FH MF  IG+KL++I DG KGLD++   +K ++W YR  +        L+ CKN   P++  F+ +I    +    +N +   G  +I L+ G +D  IA+    R S+A+ +ND+DF +F +C    P I   ++  +  FM   N  +     RPT    +L   + +   +   L+ STH+++I  SIL GND T ++S+NL     I    D    PH  +VA++++        L D     +F  + PE K +V F  DFY     ++   + +  F     +    ++L  +  K EIS S+ +S F  +    +CV    +PI       I +++  +++RIY  +L   +  VTE++  +      LIN+  S       +  PD         KY   D F+  WS  + +             L++  +FG E GF CY LR L+ V+    +E     +T  EF ++F  VF+R   R+       ++L  +I        F  +KICP+  C T   W   IY  A    G +LN+   FP A   +S TV  AF+E   ND  +RV +L+   I  I ++ + I +     Y+AI
Sbjct:    1 MEILVDFSSFRRGLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNSVDAVLECCKN-KMPVKN-FKDVISWAYSLTALEN-LKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFF--KRPT----KLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLD--RWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRY----SCVFWIEKPI--DAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGI--LINVVHSPFKSNLIISKPDPESERQNGVKY-GIDIFEEIWSHLENS-------------LNFVYQFGLEKGFLCYILRYLYKVTHGLNIE-----MTAKEFDAIFAMVFYRY--RLSINMPFRTNLNQDI--------FLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAI 608          
The following BLAST results are available for this feature:
BLAST of SMED30015093 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM120B1.414e-727.59family with sequence similarity 120B [Source:HGNC ... [more]
FAM120B1.414e-727.59family with sequence similarity 120B [Source:HGNC ... [more]
FAM120B1.481e-727.59family with sequence similarity 120B [Source:HGNC ... [more]
FAM120B1.481e-727.59family with sequence similarity 120B [Source:HGNC ... [more]
FAM120B1.483e-727.59family with sequence similarity 120B [Source:HGNC ... [more]
back to top
BLAST of SMED30015093 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015093 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015093 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam120b9.883e-722.46family with sequence similarity 120B [Source:ZFIN;... [more]
back to top
BLAST of SMED30015093 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam120b1.874e-625.94Xenopus tropicalis family with sequence similarity... [more]
fam120b1.960e-625.94Xenopus tropicalis family with sequence similarity... [more]
back to top
BLAST of SMED30015093 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fam120b4.877e-726.71family with sequence similarity 120, member B [Sou... [more]
back to top
BLAST of SMED30015093 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A6QNT4|F120B_BOVIN5.518e-725.83Constitutive coactivator of peroxisome proliferato... [more]
sp|Q96EK7|F120B_HUMAN7.120e-727.59Constitutive coactivator of peroxisome proliferato... [more]
sp|Q6RI63|F120B_MOUSE3.412e-626.71Constitutive coactivator of peroxisome proliferato... [more]
back to top
BLAST of SMED30015093 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QAR51.060e-4326.38Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A1S3HAE62.072e-4026.16uncharacterized protein LOC106153553 OS=Lingula un... [more]
A0A0L8GFX01.013e-3824.45Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2T7PUB94.959e-3824.88Uncharacterized protein OS=Pomacea canaliculata OX... [more]
K1QJE97.198e-3623.13Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
back to top
BLAST of SMED30015093 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam120b4.051e-724.36family with sequence similarity 120B [Source:ZFIN;... [more]
fam120b5.066e-724.36family with sequence similarity 120B [Source:ZFIN;... [more]
back to top
BLAST of SMED30015093 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam120b6.862e-823.35family with sequence similarity 120B [Source:ZFIN;... [more]
back to top
BLAST of SMED30015093 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015093 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015093 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam120b5.024e-925.11family with sequence similarity 120B [Source:NCBI ... [more]
fam120b5.024e-925.11family with sequence similarity 120B [Source:NCBI ... [more]
back to top
BLAST of SMED30015093 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009339.10.000e+099.70SMESG000009339.1[more]
SMESG000001486.13.633e-6827.07SMESG000001486.1[more]
SMESG000001486.17.163e-6526.64SMESG000001486.1[more]
SMESG000033479.12.406e-5829.27SMESG000033479.1[more]
SMESG000033479.11.748e-5728.96SMESG000033479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015093 ID=SMED30015093|Name=SMED30015093|organism=Schmidtea mediterranea sexual|type=transcript|length=2128bp
TTTTAAAATTGCATTTATTAGAATTTTATAATATTTTATATTTGTAAAAT
AAAAATATTAAGTTTTATTATTTATAATGGGGATTCCTGGGTTGTTCACG
TTTTTAAAAAGAAATGGATGTTATGAAACTTATGACTTGGTTGCATTAGC
GAAAAGTAATCCGGATCTTGAAATCCTTGTTGATTTTTATGGTATTGAGC
AGCATATATTGGAAAGAACATTGCTGAAACTTATTAGCAAATATCAAAAT
GAATATTTATTGATTCCCGGTGCAGAGTACGATGAACTTCTAAATGCTTT
TCGAGATTTTCATATGATGTTCGTTAATATTGGTGTTAAATTAATTTATA
TTGCTGATGGACCAAAAGGACTTGATAAATTGAACCAACAACAAAAAGAA
AAATCATGGATTTATCGTTTTGAAAGAAATATGCGAGTATATAAAACTTA
TTTGGATATGTGTAAAAATCCGCCGAGTCCATTGCAGAAAATTTTTGAAA
AAATTATCCGACCATGTTTGACATCTGACATGTTTAAAAACATAATTATC
AAAGAAGGGGGAACAATTATCAATTTAATTTATGGTGAAGCCGATTATCA
AATTGCCAATATGCGCAGAGAACGAAATTCATGGGCCGTGTTGACAAACG
ATAGCGATTTTTTTATTTTTCACAATTGTCCAACAATACACATTGGGCTT
TTTGACATTGACAGAGATTTTATGCACGGCCGTAATGTCCGAGACAATTT
AGACGATCACAGACCGACTATTAATCCGAAAAGGTTGACAGTTGGATTGA
CATCCGATAAAATTTTAATGGATCGTTTGCGATTGTCAACGCATGATAAA
TTAATTGATTTTTCAATTTTAATGGGCAATGATTATACTGTGGATTTCTC
GGAGAATTTGAGGAATTTTTGCGAAATTAAATGGAAATATGATTTCAGTG
ATATTCCACATTCGATGAAAGTGGCAGAATGGGTTGAAAAGCAATCAACT
AAACTGATAGACAGCAGTGAATTTGAAAGCTTTTCGATAGATAAGCCAGA
ACTGAAATTGTCAGTTCAATTCAGTATGGATTTCTACAAGCAAATTCCAA
CTGAACCAATTCCACAATTCACGTCGAAAGACAACGAAGAATTTTGGAAT
TATCTAGTCGATCGTTATCAGAAGGGAGAAATATCTAGCATGTGTTTATC
GGTTTTCCATGGATTCTGTTATCAAAGAAATTGTGTTCAGCCAATAATTG
TTGGCGTTAACAAAGACATTAATAGTTTGTTAGTGCCGTTGAAAACGAGA
ATTTATTCGCTTTTGCTTCAAAAAGGAATATCAACTGTTACTGAATATGA
AGTCCCTAATATGCCGGATTATACTAGATTGATAAATATTCCAAAAAGCT
CAATTAATATAAAATCTTTTCTGGAATTTCCAGATAAATATAATGCTTGG
GACTTTTTTGATGCAAATTGGTCACGAACAGATTTTACAGATATCAATCA
GTCACAAGAACAAAACTGTGTTCCATTGTTAGATTATTTCAATAGATTCG
GGACCGAAATTGGATTTTGCTGTTATTGTCTAAGAATATTATGGTGTGTA
TCTAAAAGAACAAAAGTGGAAGAATTAGATTTGGTTATAACAGAAAATGA
ATTTCGTTCAGTATTTTGCACAGTTTTCTTCCGATTGATTCGAAGAATTC
AAACTCAGTCACAGCGCTATTCTTCATTATATACAGAAATTGTCAAAAGA
TATCCAAATGATTGGTTTTATAAATTGAAGATTTGCCCAAGTTCCGTTTG
TGAAACAACCCAGGAATGGTTACAAATCATTTATTTTGTTGCCTATACAT
TGTACGGTAAAAGTTTGAATATCGCGCTGCATTTTCCAGATGCATATGAA
TTCATTTCTGGGACGGTATTGACCGCATTTTTCGAATATGTACACAATGA
CGGTCAAAGAGTACGAAATCTGGAATCGAAAAACATTAATTCCATCTATG
AAATGATGTCGACTATTTATGATGAATTTTATCCTGTTTACAAAGCCATT
TTAGAGCCCTTTTGAGTTTCCCAAAACATAATCTGCTGCATTGATGTCAT
TTTTGTCTATTTATTATGTAAAATGGAG
back to top

protein sequence of SMED30015093-orf-1

>SMED30015093-orf-1 ID=SMED30015093-orf-1|Name=SMED30015093-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=663bp
MGIPGLFTFLKRNGCYETYDLVALAKSNPDLEILVDFYGIEQHILERTLL
KLISKYQNEYLLIPGAEYDELLNAFRDFHMMFVNIGVKLIYIADGPKGLD
KLNQQQKEKSWIYRFERNMRVYKTYLDMCKNPPSPLQKIFEKIIRPCLTS
DMFKNIIIKEGGTIINLIYGEADYQIANMRRERNSWAVLTNDSDFFIFHN
CPTIHIGLFDIDRDFMHGRNVRDNLDDHRPTINPKRLTVGLTSDKILMDR
LRLSTHDKLIDFSILMGNDYTVDFSENLRNFCEIKWKYDFSDIPHSMKVA
EWVEKQSTKLIDSSEFESFSIDKPELKLSVQFSMDFYKQIPTEPIPQFTS
KDNEEFWNYLVDRYQKGEISSMCLSVFHGFCYQRNCVQPIIVGVNKDINS
LLVPLKTRIYSLLLQKGISTVTEYEVPNMPDYTRLINIPKSSINIKSFLE
FPDKYNAWDFFDANWSRTDFTDINQSQEQNCVPLLDYFNRFGTEIGFCCY
CLRILWCVSKRTKVEELDLVITENEFRSVFCTVFFRLIRRIQTQSQRYSS
LYTEIVKRYPNDWFYKLKICPSSVCETTQEWLQIIYFVAYTLYGKSLNIA
LHFPDAYEFISGTVLTAFFEYVHNDGQRVRNLESKNINSIYEMMSTIYDE
FYPVYKAILEPF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR026832Asteroid
IPR006086XPG-I_dom
IPR029060PIN-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004518nuclease activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006086XPG-I domainPFAMPF00867XPG_Icoord: 170..269
e-value: 1.9E-6
score: 28.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.1010coord: 44..279
e-value: 2.2E-12
score: 48.7
NoneNo IPR availableCDDcd18676PIN_asteroid-likecoord: 65..198
e-value: 1.27823E-5
score: 43.7872
IPR026832AsteroidPANTHERPTHR15665ASTEROID PROTEINcoord: 1..502
IPR029060PIN-like domain superfamilySUPERFAMILYSSF88723PIN domain-likecoord: 1..220