Latent-transforming growth factor beta-binding protein

Overview
NameLatent-transforming growth factor beta-binding protein
Smed IDSMED30015090
Length (bp)3132
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Latent-transforming growth factor beta-binding protein (SMED30015090) t-SNE clustered cells

Violin plots show distribution of expression levels for Latent-transforming growth factor beta-binding protein (SMED30015090) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Latent-transforming growth factor beta-binding protein (SMED30015090) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Latent-transforming growth factor beta-binding protein (SMED30015090) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30015090SMESG000032548.1 SmedASXL_002114SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30015090SMESG000032548.1 dd_Smed_v4_7311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30015090SMESG000032548.1 dd_Smed_v6_7311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: LTBP2 (latent transforming growth factor beta binding protein 2 [Source:HGNC Symbol;Acc:HGNC:6715])

HSP 1 Score: 218.779 bits (556), Expect = 2.395e-57
Identity = 175/522 (33.52%), Postives = 251/522 (48.08%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDE--------------CPINMKRNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVC 2555
            C DINECE    C+     C NT GS+ C+C +G+   + G C+DI+EC +   C D + C N+ GSY C+    C  G++    +  CVDV+EC   P +C  G KC N+ GS RC          DE              CP  +  N +G   CS C++G++  ++  +CED+DEC      + G C  + VC N  GS+ C   K C  G   +  G +C D+DEC+  +  C   E C NT  SY                  +C+C  G++    ++C DV+EC    G+  C     C+N  GS+ C+    C PG   +   ++CQDVDEC T +  C    HCVN  GS+ C+C+ G+  +  +  C D++EC  +  +  C     +C N+ GSY+C   C  GF  +  P   C DI+EC     CG    C NT GS++C C QG+ +S SG  C D++EC L    C   +C NV G + C C             D++E    EG C
Sbjct:  928 CQDINECEQPGVCSGGQ--CTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTCPDGR-CVNSPGSYTCLA---CEEGYRGQ--SGSCVDVNEC-LTPGVCAHG-KCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECA-----FPGVCP-SGVCTNTAGSFSC---KDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGE-CKNTVGSY------------------QCLCPQGFQLANGTVCEDVNECM---GEEHCAPHGECLNSHGSFFCL----CAPGFVSAEGGTSCQDVDECATTD-PC-VGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYG-DPVCGTW--KCENSPGSYRCVLGCQPGFHMA--PNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLC-----------ASDLEEYDAQEGHC 1386          

HSP 2 Score: 199.519 bits (506), Expect = 3.148e-51
Identity = 175/528 (33.14%), Postives = 247/528 (46.78%), Query Frame = 3
Query: 1125 ICVNTVGSFRCDCQKGFK-HSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDE---------------------CPINMKRNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQD-SICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC--LLEPRKCLNGICVNVPGRYEC--KCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
             CVN    +RC C  G++ H     C D +EC+  + C    +C N VGSY C    P G+       T +C D++ECE  P +C  G +C N  GS+ CE D+                     CP     N+ G   C  C++G  ++ ++ SC D++EC       +G+C       NL GS+ C     C  G  +  +   C D+DEC   +  C P  +C+NT  S+ C A                 C +GY  N+D + C D+DECA  G   +C S  +C N  GS++C    +C  G   S +  +C+DVDECE  +  C     C N VGSY+C+C +G+ L +   C DVNEC+    EE C      C+N+ GS+ C C  GF  ++     C D++EC   +PC   H CVNT GS+ C C  G++ S     C DIDEC    +P  C    C N PG Y C   C PGF       C DIDEC+ ++ +C           C N  G ++C+
Sbjct:  860 TCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLR-DPCKGKGRCINRVGSYSCF-CYP-GYTLATSGATQECQDINECEQ-PGVCS-GGQCTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEG--YRGQSGSCVDVNECLTPGVCAHGKCT------NLEGSFRC----SCEQGYEVTSDEKGCQDVDECAS-RASC-PTGLCLNTEGSFACSA-----------------CENGYWVNEDGTACEDLDECAFPG---VCPS-GVCTNTAGSFSC---KDCDGGYRPSPLGDSCEDVDECEDPQSSC-LGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMG---EEHCAP-HGECLNSHGSFFCLCAPGFVSAEG-GTSCQDVDECATTDPCVGGH-CVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDP-VCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECA-NDTMCGSHG------FCDNTDGSFRCL 1329          

HSP 3 Score: 164.851 bits (416), Expect = 1.732e-40
Identity = 149/446 (33.41%), Postives = 196/446 (43.95%), Query Frame = 3
Query: 1344 VDECEA-FPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA--CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCK-CFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            +D C A    +CGPG  CVN+   +RC                   C  G+        C D +EC  +       CK    C N  GSY C     C PG  LA +G    C DI+EC+Q    C   + C NT  SYHC                   C  GY   +   C D++EC   G    C     C+N PGSY C+   E     +R    S C DV+EC T  G C  +  C N+ GS++C C++GY +TS+   C DV+EC       SCP     C+NT GS+ C   +   W +     C D++EC     C     C NT GS+ CK C  GYR S  GD+CED+DEC      CL G C N  G Y+C CP GF      +C+D++EC   E  C+   +      C+N  G + C+   C  G+   E G 
Sbjct:  845 IDRCAAGATNVCGPGT-CVNLPDGYRC------------------VCSPGYQLHPSQAYCTDDNECLRDP------CKGKGRCINRVGSYSCF----CYPGYTLATSGATQECQDINECEQPGV-CSGGQ-CTNTEGSYHC------------------ECDQGYIMVRKGHCQDINECRHPG---TCPDGR-CVNSPGSYTCLACEE----GYRGQSGS-CVDVNECLT-PGVC-AHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECAS---RASCPT--GLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVC-PSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEE-HCAPHGE------CLNSHGSFFCL---CAPGFVSAEGGT 1214          

HSP 4 Score: 133.65 bits (335), Expect = 7.028e-31
Identity = 150/505 (29.70%), Postives = 203/505 (40.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACI----------QRAECPPGMFRSSMYSNCQDVDECETGE-GKCPQNMHCVN-VVGSYKCMCDRGYILTSNNTC----ADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD 2501
            G+  +   + C D++ECE   +     E C NTVGS++C C +GF+ +   +CED++ECM    C+   +C N+ GS+ C+    C  G+        C DVDEC A  + C  G  CVN  GS  C                   C+ GF    E+  C DIDEC      Y      T  C N PGSY C+    C+PG  +A NG  C DIDEC      C     C NT  S+                  +C+C  G+  +     C DV+EC       +CG+  +C N  GS+ C+          Q   C P        +  Q + E  TG+    P  M C +   G   C    G   T    C    A   +     P E   +    C +  G    +    F  + Y     TD +EC+   P      +C+NTV  Y C C  G+    S   CED DEC  +   C NG CVN  G + C C P    D
Sbjct: 1123 GYRPSPLGDSCEDVDECEDPQSSCLGGE-CKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCL----CAPGFVSAEGGTSCQDVDEC-ATTDPCV-GGHCVNTEGSFNC------------------LCETGFQPSPESGECVDIDECED----YGDPVCGTWKCENSPGSYRCV--LGCQPGFHMAPNG-DCIDIDECANDTM-CGSHGFCDNTDGSF------------------RCLCDQGFEISPSGWDCVDVNECELMLA--VCGAA-LCENVEGSFLCLCASDLEEYDAQEGHCRP------RGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMY-----TDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDEC--QDLACENGECVNTEGSFHCFCSPPLTLD 1560          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: LTBP2 (latent transforming growth factor beta binding protein 2 [Source:HGNC Symbol;Acc:HGNC:6715])

HSP 1 Score: 218.009 bits (554), Expect = 3.817e-57
Identity = 175/522 (33.52%), Postives = 251/522 (48.08%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDE--------------CPINMKRNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVC 2555
            C DINECE    C+     C NT GS+ C+C +G+   + G C+DI+EC +   C D + C N+ GSY C+    C  G++    +  CVDV+EC   P +C  G KC N+ GS RC          DE              CP  +  N +G   CS C++G++  ++  +CED+DEC      + G C  + VC N  GS+ C   K C  G   +  G +C D+DEC+  +  C   E C NT  SY                  +C+C  G++    ++C DV+EC    G+  C     C+N  GS+ C+    C PG   +   ++CQDVDEC T +  C    HCVN  GS+ C+C+ G+  +  +  C D++EC  +  +  C     +C N+ GSY+C   C  GF  +  P   C DI+EC     CG    C NT GS++C C QG+ +S SG  C D++EC L    C   +C NV G + C C             D++E    EG C
Sbjct:  928 CQDINECEQPGVCSGGQ--CTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTCPDGR-CVNSPGSYTCLA---CEEGYRGQ--SGSCVDVNEC-LTPGVCAHG-KCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECA-----FPGVCP-SGVCTNTAGSFSC---KDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGE-CKNTVGSY------------------QCLCPQGFQLANGTVCEDVNECM---GEEHCAPHGECLNSHGSFFCL----CAPGFVSAEGGTSCQDVDECATTD-PC-VGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYG-DPVCGTW--KCENSPGSYRCVLGCQPGFHMA--PNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLC-----------ASDLEEYDAQEGHC 1386          

HSP 2 Score: 198.749 bits (504), Expect = 4.772e-51
Identity = 175/528 (33.14%), Postives = 247/528 (46.78%), Query Frame = 3
Query: 1125 ICVNTVGSFRCDCQKGFK-HSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDE---------------------CPINMKRNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQD-SICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC--LLEPRKCLNGICVNVPGRYEC--KCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
             CVN    +RC C  G++ H     C D +EC+  + C    +C N VGSY C    P G+       T +C D++ECE  P +C  G +C N  GS+ CE D+                     CP     N+ G   C  C++G  ++ ++ SC D++EC       +G+C       NL GS+ C     C  G  +  +   C D+DEC   +  C P  +C+NT  S+ C A                 C +GY  N+D + C D+DECA  G   +C S  +C N  GS++C    +C  G   S +  +C+DVDECE  +  C     C N VGSY+C+C +G+ L +   C DVNEC+    EE C      C+N+ GS+ C C  GF  ++     C D++EC   +PC   H CVNT GS+ C C  G++ S     C DIDEC    +P  C    C N PG Y C   C PGF       C DIDEC+ ++ +C           C N  G ++C+
Sbjct:  860 TCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLR-DPCKGKGRCINRVGSYSCF-CYP-GYTLATSGATQECQDINECEQ-PGVCS-GGQCTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEG--YRGQSGSCVDVNECLTPGVCAHGKCT------NLEGSFRC----SCEQGYEVTSDEKGCQDVDECAS-RASC-PTGLCLNTEGSFACSA-----------------CENGYWVNEDGTACEDLDECAFPG---VCPS-GVCTNTAGSFSC---KDCDGGYRPSPLGDSCEDVDECEDPQSSC-LGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMG---EEHCAP-HGECLNSHGSFFCLCAPGFVSAEG-GTSCQDVDECATTDPCVGGH-CVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDP-VCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECA-NDTMCGSHG------FCDNTDGSFRCL 1329          

HSP 3 Score: 164.466 bits (415), Expect = 2.620e-40
Identity = 149/446 (33.41%), Postives = 195/446 (43.72%), Query Frame = 3
Query: 1344 VDECEA-FPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA--CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCK-CFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            +D C A    +CGPG  CVN+   +RC                   C  G+        C D +EC  +       CK    C N  GSY C     C PG  LA +G    C DI+EC+Q    C   + C NT  SYHC                   C  GY   +   C D++EC   G    C     C+N PGSY C+   E     +R    S C DV+EC T  G C     C N+ GS++C C++GY +TS+   C DV+EC       SCP     C+NT GS+ C   +   W +     C D++EC     C     C NT GS+ CK C  GYR S  GD+CED+DEC      CL G C N  G Y+C CP GF      +C+D++EC   E  C+   +      C+N  G + C+   C  G+   E G 
Sbjct:  845 IDRCAAGATNVCGPGT-CVNLPDGYRC------------------VCSPGYQLHPSQAYCTDDNECLRDP------CKGKGRCINRVGSYSCF----CYPGYTLATSGATQECQDINECEQPGV-CSGGQ-CTNTEGSYHC------------------ECDQGYIMVRKGHCQDINECRHPG---TCPDGR-CVNSPGSYTCLACEE----GYRGQSGS-CVDVNECLT-PGVCAHGK-CTNLEGSFRCSCEQGYEVTSDEKGCQDVDECAS---RASCPT--GLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVC-PSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEE-HCAPHGE------CLNSHGSFFCL---CAPGFVSAEGGT 1214          

HSP 4 Score: 133.265 bits (334), Expect = 1.209e-30
Identity = 150/505 (29.70%), Postives = 203/505 (40.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACI----------QRAECPPGMFRSSMYSNCQDVDECETGE-GKCPQNMHCVN-VVGSYKCMCDRGYILTSNNTC----ADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD 2501
            G+  +   + C D++ECE   +     E C NTVGS++C C +GF+ +   +CED++ECM    C+   +C N+ GS+ C+    C  G+        C DVDEC A  + C  G  CVN  GS  C                   C+ GF    E+  C DIDEC      Y      T  C N PGSY C+    C+PG  +A NG  C DIDEC      C     C NT  S+                  +C+C  G+  +     C DV+EC       +CG+  +C N  GS+ C+          Q   C P        +  Q + E  TG+    P  M C +   G   C    G   T    C    A   +     P E   +    C +  G    +    F  + Y     TD +EC+   P      +C+NTV  Y C C  G+    S   CED DEC  +   C NG CVN  G + C C P    D
Sbjct: 1123 GYRPSPLGDSCEDVDECEDPQSSCLGGE-CKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCL----CAPGFVSAEGGTSCQDVDEC-ATTDPC-VGGHCVNTEGSFNC------------------LCETGFQPSPESGECVDIDECED----YGDPVCGTWKCENSPGSYRCV--LGCQPGFHMAPNG-DCIDIDECANDTM-CGSHGFCDNTDGSF------------------RCLCDQGFEISPSGWDCVDVNECELMLA--VCGAA-LCENVEGSFLCLCASDLEEYDAQEGHCRP------RGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMY-----TDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDEC--QDLACENGECVNTEGSFHCFCSPPLTLD 1560          

HSP 5 Score: 70.0922 bits (170), Expect = 2.502e-11
Identity = 140/559 (25.04%), Postives = 205/559 (36.67%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDE------------CMNVN-----ICSDD--------KKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCED--------------DECPINMKRNNKGICSRCK-----DGFYFKKETRSCEDIDECTMNVGWY--NGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCG--------SLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGE------------GKCPQNMH----------CVNVVGSYKCMCDRGYILTSNNTCADVNECL--LFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC--LLEPR-KCLNGICVNVPGRYECKCPPGFAAD 2501
            C DI+EC     C +    C NT GSFRC C +GF+ S  G  C D++E            C NV      +C+ D          C+      + +   P G      P   DC    +  A          C ++ G +  +               D CP         IC   K     +G +   +T    D DEC +       NGRC  T     +PG Y C+    C PG     +   C D DEC+ +   CE  E CVNT  S+HC    C+P    D S  +CM      ++       +D C +   +++C         +   C    G     Q A CPP    S +Y+   +V   E               G  P ++H            N +G    + +  +  T+ ++ AD    L    +P E  P   A           + P GFE      ++C  +N C       +  +CV     Y C CF+G++L  +   C D++EC  L  P   C++G C N  G Y C C PG+ A+
Sbjct: 1301 CIDIDECANDTMCGSHG-FCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAPTG-DHAPAPTRMDCYSGQKGHA---------PCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMY-TDADECVIFGPGLCPNGRCLNT-----VPG-YVCL----CNPGFHYDASHKKCEDHDECQDLA--CENGE-CVNTEGSFHCF---CSPPLTLDLSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQCALCPP--RSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYLGPEDTVPEPAFPNTAGHS-ADRTPILESPLQPSELQPHYVAS--------HPEPPAGFE--GLQAEECGILNGC-------ENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAE 1811          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: LTBP4 (latent transforming growth factor beta binding protein 4 [Source:HGNC Symbol;Acc:HGNC:6717])

HSP 1 Score: 214.157 bits (544), Expect = 5.961e-56
Identity = 177/518 (34.17%), Postives = 229/518 (44.21%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            C++    + C C  GF+ S  G  C D+DEC  V       +C+N+ GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR      C NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDECA +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P          C NT GS++C C  G+         C D+NECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C D+DEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  494 CISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCV----CGPGFRAGPRAAECLDVDECHRVPPPCDLG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GACKNLPGSFRCVCPAGFR--------GSACEEDVDECAQEPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECARSPPPCTYGR---CENTEGSFQCV----CPMGFQPNTAGSECEDVDECEN-HLACP-GQECVNSPGSFQCRTCPSGHHL-HRGRCTDVDECSSGAPPCG---PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHAGPEGT 935          

HSP 2 Score: 199.134 bits (505), Expect = 3.657e-51
Identity = 187/571 (32.75%), Postives = 245/571 (42.91%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHS-KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGWYN-GRCKETDV-----------------------------------CFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPC--APSQQ--------------FDYSVGKCM---------CRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDEC-ETGEGKCPQNMHCVNVVGSYKCM--CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCP 2483
            GF  +     C D++EC      CA     C N+ GSFRC C  GF+   +   C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G  C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC  +      GRC+ T+                                    C N PGS+ C   + C  G  L +    C D+DEC      C P   C NT  S+ C  +P   APS +              F +  G+C+         C  GYR   + + C DVDEC+E   ++LC S  IC N  GS+ CI    CPPG       ++C DVDEC E G   C  +  C N  GSY+C+  CD GY      TC DV+EC  + PE        RC NT GSY+C   C  G++ +  P   C D++EC   + CG    C N  GS++C C QGY  +  G  C D++EC      C   +C NV G + C CP
Sbjct:  508 GFRLSPQGTRCIDVDECRRVPPPCAPGR--CENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGA-CKNLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQC---RTCPSGHHLHRG--RCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSE---EDLCQS-GICTNTDGSFECI----CPPGHRAGPDLASCLDVDECRERGPALC-GSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEIC---GAQRCENTPGSYRCTPACDPGYQPT--PGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCP 1052          

HSP 3 Score: 149.828 bits (377), Expect = 8.613e-36
Identity = 142/437 (32.49%), Postives = 186/437 (42.56%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC-----------------------EDDEC-PINMKRNNKG-ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF        C D++EC  +      +  C NT GSF+C C  GF+ +  G  CED+DEC N   C   ++C N+ GS++C R+ P G           C DVDEC +    CGP   C N  GS RC                       E D C P     N  G     C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C D+DEC++        + C N+  SY CV                  C  GY    +  C DVDEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  673 GFRSRGPGAPCQDVDECARSPP-PCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPG-QECVNSPGSFQC-RTCPSGHHLHR----GRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHAGPEGTCDDVDECQEYG-PEICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETL--QGVC--GAALCENVEGSFLCVCPNSPEEFDPMTGRCV 1066          

HSP 4 Score: 113.235 bits (282), Expect = 1.381e-24
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             C++    Y C CD G+ L+   T C DV+EC    P    P    RC N+ GS++C C  GF        +C D++EC    P     +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  493 RCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPP----PCAPGRCENSPGSFRCVCGPGFRAGPR-AAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACE--EDVDECAQEPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 680          

HSP 5 Score: 85.8853 bits (211), Expect = 3.449e-16
Identity = 113/423 (26.71%), Postives = 158/423 (37.35%), Query Frame = 3
Query: 1062 LEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            L  C D++EC          + C N+ GS+RC  DC  G+     G C+D+DEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C                +  N  +E   M  RC P      T+      + P AP+                     Q     G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+    +  ++  CVN    Y C C  GY   T    C D +EC    P         RCVNT GSY C C
Sbjct:  889 LASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICG-AQRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAVCQNLPGSFQC------------------LCDQGYEGARDGRHCVDVNECET----LQGVCGAA-LCENVEGSFLC----------------VCPNSPEEFDPMTGRCVPPRTSAGTFPG----SQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACE----GGRCVNTVGSYHCTC 1256          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: LTBP4 (latent transforming growth factor beta binding protein 4 [Source:HGNC Symbol;Acc:HGNC:6717])

HSP 1 Score: 214.157 bits (544), Expect = 6.200e-56
Identity = 177/518 (34.17%), Postives = 229/518 (44.21%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            C++    + C C  GF+ S  G  C D+DEC  V       +C+N+ GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR      C NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDECA +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P          C NT GS++C C  G+         C D+NECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C D+DEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  524 CISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCV----CGPGFRAGPRAAECLDVDECHRVPPPCDLG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GACKNLPGSFRCVCPAGFR--------GSACEEDVDECAQEPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECARSPPPCTYGR---CENTEGSFQCV----CPMGFQPNTAGSECEDVDECEN-HLACP-GQECVNSPGSFQCRTCPSGHHL-HRGRCTDVDECSSGAPPCG---PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHAGPEGT 965          

HSP 2 Score: 199.134 bits (505), Expect = 3.731e-51
Identity = 187/571 (32.75%), Postives = 245/571 (42.91%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHS-KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGWYN-GRCKETDV-----------------------------------CFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPC--APSQQ--------------FDYSVGKCM---------CRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDEC-ETGEGKCPQNMHCVNVVGSYKCM--CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCP 2483
            GF  +     C D++EC      CA     C N+ GSFRC C  GF+   +   C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G  C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC  +      GRC+ T+                                    C N PGS+ C   + C  G  L +    C D+DEC      C P   C NT  S+ C  +P   APS +              F +  G+C+         C  GYR   + + C DVDEC+E   ++LC S  IC N  GS+ CI    CPPG       ++C DVDEC E G   C  +  C N  GSY+C+  CD GY      TC DV+EC  + PE        RC NT GSY+C   C  G++ +  P   C D++EC   + CG    C N  GS++C C QGY  +  G  C D++EC      C   +C NV G + C CP
Sbjct:  538 GFRLSPQGTRCIDVDECRRVPPPCAPGR--CENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGA-CKNLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQC---RTCPSGHHLHRG--RCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSE---EDLCQS-GICTNTDGSFECI----CPPGHRAGPDLASCLDVDECRERGPALC-GSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEIC---GAQRCENTPGSYRCTPACDPGYQPT--PGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCP 1082          

HSP 3 Score: 149.443 bits (376), Expect = 8.955e-36
Identity = 142/437 (32.49%), Postives = 186/437 (42.56%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC-----------------------EDDEC-PINMKRNNKG-ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF        C D++EC  +      +  C NT GSF+C C  GF+ +  G  CED+DEC N   C   ++C N+ GS++C R+ P G           C DVDEC +    CGP   C N  GS RC                       E D C P     N  G     C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C D+DEC++        + C N+  SY CV                  C  GY    +  C DVDEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  703 GFRSRGPGAPCQDVDECARSPP-PCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPG-QECVNSPGSFQC-RTCPSGHHLHR----GRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHAGPEGTCDDVDECQEYG-PEICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETL--QGVC--GAALCENVEGSFLCVCPNSPEEFDPMTGRCV 1096          

HSP 4 Score: 113.235 bits (282), Expect = 1.417e-24
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             C++    Y C CD G+ L+   T C DV+EC    P    P    RC N+ GS++C C  GF        +C D++EC    P     +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  523 RCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPP----PCAPGRCENSPGSFRCVCGPGFRAGPR-AAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACE--EDVDECAQEPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 710          

HSP 5 Score: 85.8853 bits (211), Expect = 3.242e-16
Identity = 113/423 (26.71%), Postives = 158/423 (37.35%), Query Frame = 3
Query: 1062 LEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            L  C D++EC          + C N+ GS+RC  DC  G+     G C+D+DEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C                +  N  +E   M  RC P      T+      + P AP+                     Q     G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+    +  ++  CVN    Y C C  GY   T    C D +EC    P         RCVNT GSY C C
Sbjct:  919 LASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICG-AQRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAVCQNLPGSFQC------------------LCDQGYEGARDGRHCVDVNECET----LQGVCGAA-LCENVEGSFLC----------------VCPNSPEEFDPMTGRCVPPRTSAGTFPG----SQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACE----GGRCVNTVGSYHCTC 1286          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: LTBP4 (latent transforming growth factor beta binding protein 4 [Source:HGNC Symbol;Acc:HGNC:6717])

HSP 1 Score: 214.157 bits (544), Expect = 6.413e-56
Identity = 177/518 (34.17%), Postives = 229/518 (44.21%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            C++    + C C  GF+ S  G  C D+DEC  V       +C+N+ GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR      C NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDECA +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P          C NT GS++C C  G+         C D+NECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C D+DEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  561 CISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCV----CGPGFRAGPRAAECLDVDECHRVPPPCDLG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GACKNLPGSFRCVCPAGFR--------GSACEEDVDECAQEPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECARSPPPCTYGR---CENTEGSFQCV----CPMGFQPNTAGSECEDVDECEN-HLACP-GQECVNSPGSFQCRTCPSGHHL-HRGRCTDVDECSSGAPPCG---PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHAGPEGT 1002          

HSP 2 Score: 198.749 bits (504), Expect = 4.130e-51
Identity = 187/571 (32.75%), Postives = 245/571 (42.91%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHS-KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICS--------RCKDGFYFKKETRSCEDIDECTMNVGWYN-GRCKETDV-----------------------------------CFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPC--APSQQ--------------FDYSVGKCM---------CRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDEC-ETGEGKCPQNMHCVNVVGSYKCM--CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCP 2483
            GF  +     C D++EC      CA     C N+ GSFRC C  GF+   +   C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G  C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC  +      GRC+ T+                                    C N PGS+ C   + C  G  L +    C D+DEC      C P   C NT  S+ C  +P   APS +              F +  G+C+         C  GYR   + + C DVDEC+E   ++LC S  IC N  GS+ CI    CPPG       ++C DVDEC E G   C  +  C N  GSY+C+  CD GY      TC DV+EC  + PE        RC NT GSY+C   C  G++ +  P   C D++EC   + CG    C N  GS++C C QGY  +  G  C D++EC      C   +C NV G + C CP
Sbjct:  575 GFRLSPQGTRCIDVDECRRVPPPCAPGR--CENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGA-CKNLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQC---RTCPSGHHLHRG--RCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSE---EDLCQS-GICTNTDGSFECI----CPPGHRAGPDLASCLDVDECRERGPALC-GSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEIC---GAQRCENTPGSYRCTPACDPGYQPT--PGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCP 1119          

HSP 3 Score: 149.828 bits (377), Expect = 9.017e-36
Identity = 142/437 (32.49%), Postives = 186/437 (42.56%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC-----------------------EDDEC-PINMKRNNKG-ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF        C D++EC  +      +  C NT GSF+C C  GF+ +  G  CED+DEC N   C   ++C N+ GS++C R+ P G           C DVDEC +    CGP   C N  GS RC                       E D C P     N  G     C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C D+DEC++        + C N+  SY CV                  C  GY    +  C DVDEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  740 GFRSRGPGAPCQDVDECARSPP-PCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPG-QECVNSPGSFQC-RTCPSGHHLHR----GRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHAGPEGTCDDVDECQEYG-PEICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETL--QGVC--GAALCENVEGSFLCVCPNSPEEFDPMTGRCV 1133          

HSP 4 Score: 113.235 bits (282), Expect = 1.456e-24
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             C++    Y C CD G+ L+   T C DV+EC    P    P    RC N+ GS++C C  GF        +C D++EC    P     +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  560 RCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPP----PCAPGRCENSPGSFRCVCGPGFRAGPR-AAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACE--EDVDECAQEPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 747          

HSP 5 Score: 85.8853 bits (211), Expect = 3.492e-16
Identity = 113/423 (26.71%), Postives = 158/423 (37.35%), Query Frame = 3
Query: 1062 LEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            L  C D++EC          + C N+ GS+RC  DC  G+     G C+D+DEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C                +  N  +E   M  RC P      T+      + P AP+                     Q     G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+    +  ++  CVN    Y C C  GY   T    C D +EC    P         RCVNT GSY C C
Sbjct:  956 LASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICG-AQRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAVCQNLPGSFQC------------------LCDQGYEGARDGRHCVDVNECET----LQGVCGAA-LCENVEGSFLC----------------VCPNSPEEFDPMTGRCVPPRTSAGTFPG----SQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACE----GGRCVNTVGSYHCTC 1323          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 239.195 bits (609), Expect = 5.608e-67
Identity = 179/588 (30.44%), Postives = 271/588 (46.09%), Query Frame = 3
Query: 1365 PEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCM---CRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAE-CPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRK----CLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT-----KKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVI--MKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTRYP 3077
            P +   G +C +    H C D        R  + +   C+ GF    +  +C DIDEC   +      C E+  C N PGS+ CI    C  G  +      C D+DEC      C P   C NT  SY C A  C   +  +   G+C    C +GY   ++ +C D+DEC    G N CG+   C+N PGS+ C Q+   C  G   +     C+DV+EC+  +G C  +M C+N+ G+YKC C  GY    +   C DV+EC+ F       DL A C+NT GS++C+C  GF+ +    ++C D+NEC        + +CVN  GSY+C C +G+ L   G  CEDIDEC +        C+ G C+N  G Y C+CPPG+        C D+DEC+  E   S        ++C+N LG +KC +  CP  Y      K +  +G+ C      +C   D +CL     ++ Y+F          R +        P+  SRI   +    + + N     +  F + ++R    NI ++  +K +  P VE +      K    + L  +E+ I + +++YP
Sbjct:  150 PHVLHLGDRCASSHCEHLCHD--------RGGEKVECSCRSGFDLAPDGMACVDIDECATLMD----DCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYP-KNGMCNDIDECVT--GHN-CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQ--QGVC-GSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVC--DLSAECINTIGSFECKCKPGFQLASDG-RRCEDVNECTTGIA-ACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSD-------KVCVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSC----IKVCSTEDTECLGNHTREVLYQF----------RAVPSLKTIISPIEVSRIVTHMGVPFSVDYNLDYVGQRHFRIVQER----NIGIVQLVKPISGPTVETIKVNIHTKSRTGVILAFNEAIIEISVSKYP 688          

HSP 2 Score: 196.052 bits (497), Expect = 3.495e-52
Identity = 150/408 (36.76%), Postives = 211/408 (51.72%), Query Frame = 3
Query: 1149 FRCDCQKGFKHSKLGI-CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN-NKGICSR--CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKK-CRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDL-EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC 2348
              C C+ GF  +  G+ C DIDEC  + + C + ++C N  GS+KCIR++ CG G+  D +T  C DVDEC      CGP  +C N +GS+RC+  +C     +N   G C+   C +G+Y K     C DIDEC   V  +N  C   + C N PGS+ C  K   C  G  +      C D++EC+Q    C   E C+N   +Y C    C P  +F+ +  +              C DVDEC +  G ++C     CIN  GS+ C    +C PG   +S    C+DV+EC TG   C Q   CVN+ GSY+C+CDRG+ L  + T C D++EC ++    +  DL    C+NT GSY CQCP G++      + C D++EC      G    CVNT+GS+KC
Sbjct:  176 VECSCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGM--CNDIDEC---VTGHN--CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQGV--CGSME-CINLPGTYKC---KCGPGYEFNDAKKR--------------CEDVDECIKFAG-HVCDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGN--DLCMGGCINTKGSYLCQCPPGYKIQPDG-RTCVDVDECAMGECAGSDKVCVNTLGSFKC 546          

HSP 3 Score: 139.428 bits (350), Expect = 1.172e-33
Identity = 122/388 (31.44%), Postives = 173/388 (44.59%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD---------------------CQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKC-IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECA--ENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTSNN 2120
            G+  +   E C D++EC   +        C NT GS+RCD                     C  G+ + K G+C DIDEC+  + C   ++C N  GS++C  +   C  G++ +  T  C DV+EC+    +CG  M+C+N+ G+++C                  +C  G+ F    + CED+DEC    G     C  +  C N  GS++C    KC+PG  LA +G  C D++EC      CE  + CVN   SY C+                  C  G+    D   C D+DEC+     G++LC  +  CIN  GSY C    +CPPG         C DVDEC  GE      + CVN +GS+KC    C   YI  S N
Sbjct:  230 GYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGY-YPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQ--GVCGS-MECINLPGTYKC------------------KCGPGYEFNDAKKRCEDVDECIKFAGHV---CDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAACE--QKCVNIPGSYQCI------------------CDRGFALGPDGTKCEDIDECSIWAGSGNDLC--MGGCINTKGSYLC----QCPPGYKIQPDGRTCVDVDECAMGECAGSDKV-CVNTLGSFKCHSIDCPTNYIHDSLN 561          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 225.713 bits (574), Expect = 4.794e-62
Identity = 172/563 (30.55%), Postives = 265/563 (47.07%), Query Frame = 3
Query: 1365 PEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCM---CRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAE-CPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRK----CLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKF---RRTISRFNMSHMPMGSSRIN--LKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVK 3008
            P +   G +C +    H C D        R  + +   C+ GF    +  +C DIDEC   +      C E+  C N PGS+ CI    C  G  +      C D+DEC      C P   C NT  SY C A  C   +  +   G+C    C +GY   ++ +C D+DEC    G N CG+   C+N PGS+ C Q+   C  G   +     C+DV+EC+  +G C  +M C+N+ G+YKC C  GY    +   C DV+EC+ F       DL A C+NT GS++C+C  GF+ +    ++C D+NEC        + +CVN  GSY+C C +G+ L   G  CEDIDEC +        C+ G C+N  G Y C+CPPG+        C D+DEC+  E   S        ++C+N LG +KC +  CP  Y   ++ N   C  +  +   P +    ++ P  ++Y+FI ++  +     R  I+ F +S      + +N  L++K  +    N    ++  F L K       + V ++  ++ P  + L L ++
Sbjct:  150 PHVLHLGDRCASSHCEHLCHD--------RGGEKVECSCRSGFDLAPDGMACVDIDECATLMD----DCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYP-KNGMCNDIDECVT--GHN-CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQ--QGVC-GSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVC--DLSAECINTIGSFECKCKPGFQLASDG-RRCEDVNECTTGIA-ACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSD-------KVCVNTLGSFKCHSIDCPTNYI-HDSLNKNRCNRQPSACGLPEEC---SKVPLFLTYQFISLARAVPISSHRPAITLFKVSAPNHADTEVNFELQLKTTIVGAPNVLPAIRANFLLQKGEKRNSAV-VTLRDSLDGPQTVKLQLLLR 676          

HSP 2 Score: 196.823 bits (499), Expect = 2.665e-52
Identity = 150/408 (36.76%), Postives = 211/408 (51.72%), Query Frame = 3
Query: 1149 FRCDCQKGFKHSKLGI-CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN-NKGICSR--CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKK-CRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDL-EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC 2348
              C C+ GF  +  G+ C DIDEC  + + C + ++C N  GS+KCIR++ CG G+  D +T  C DVDEC      CGP  +C N +GS+RC+  +C     +N   G C+   C +G+Y K     C DIDEC   V  +N  C   + C N PGS+ C  K   C  G  +      C D++EC+Q    C   E C+N   +Y C    C P  +F+ +  +              C DVDEC +  G ++C     CIN  GS+ C    +C PG   +S    C+DV+EC TG   C Q   CVN+ GSY+C+CDRG+ L  + T C D++EC ++    +  DL    C+NT GSY CQCP G++      + C D++EC      G    CVNT+GS+KC
Sbjct:  176 VECSCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGM--CNDIDEC---VTGHN--CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQGV--CGSME-CINLPGTYKC---KCGPGYEFNDAKKR--------------CEDVDECIKFAG-HVCDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGN--DLCMGGCINTKGSYLCQCPPGYKIQPDG-RTCVDVDECAMGECAGSDKVCVNTLGSFKC 546          

HSP 3 Score: 140.969 bits (354), Expect = 3.823e-34
Identity = 122/388 (31.44%), Postives = 173/388 (44.59%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD---------------------CQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKC-IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECA--ENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTSNN 2120
            G+  +   E C D++EC   +        C NT GS+RCD                     C  G+ + K G+C DIDEC+  + C   ++C N  GS++C  +   C  G++ +  T  C DV+EC+    +CG  M+C+N+ G+++C                  +C  G+ F    + CED+DEC    G     C  +  C N  GS++C    KC+PG  LA +G  C D++EC      CE  + CVN   SY C+                  C  G+    D   C D+DEC+     G++LC  +  CIN  GSY C    +CPPG         C DVDEC  GE      + CVN +GS+KC    C   YI  S N
Sbjct:  230 GYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGY-YPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQ--GVCG-SMECINLPGTYKC------------------KCGPGYEFNDAKKRCEDVDECIKFAGHV---CDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAACE--QKCVNIPGSYQCI------------------CDRGFALGPDGTKCEDIDECSIWAGSGNDLC--MGGCINTKGSYLC----QCPPGYKIQPDGRTCVDVDECAMGECAGSDKV-CVNTLGSFKCHSIDCPTNYIHDSLN 561          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 206.838 bits (525), Expect = 1.370e-55
Identity = 183/619 (29.56%), Postives = 276/619 (44.59%), Query Frame = 3
Query: 1296 CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE---DDECPINMKRNNKGIC-SRCKDGFYFK----KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKC---MCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAE-CPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRK----CLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT-----KKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVI--MKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTRYP 3077
            C  G+   PD   CVD +EC      C     CVN  G + C+       P   + N  G    R +D  Y +    +E         C M   + +G C + D C NL GS+DC P  +CR                                NT  SY C A  C   +  +   G+C    C +GY   ++ +C D+DEC    G N CG+   C+N PGS+ C Q+   C  G   +     C+DV+EC+  +G C  +M C+N+ G+YKC C  GY    +   C DV+EC+ F       DL A C+NT GS++C+C  GF+ +    ++C D+NEC        + +CVN  GSY+C C +G+ L   G  CEDIDEC +        C+ G C+N  G Y C+CPPG+        C D+DEC+  E   S        ++C+N LG +KC +  CP  Y      K +  +G+ C      +C   D +CL     ++ Y+F  + S    +  IS       P+  SRI   +    + + N     +  F + ++R    NI ++  +K +  P VE +      K    + L  +E+ I + +++YP
Sbjct:  180 CRSGFDLAPDGMACVDRNECLTRQSPCTQSEDCVNTIGGYICQRRISRLVPHRHRANRIGNAPRRMRDDPYSRAGEYREASQANTEFGCPMGWLFQHGHCVDVDEC-NL-GSHDCGPLYQCR--------------------------------NTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYP-KNGMCNDIDECVT--GHN-CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQ--QGVC-GSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVC--DLSAECINTIGSFECKCKPGFQLASDG-RRCEDVNECTTGIA-ACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSD-------KVCVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSC----IKVCSTEDTECLGNHTREVLYQFRAVPS---LKTIIS-------PIEVSRIVTHMGVPFSVDYNLDYVGQRHFRIVQER----NIGIVQLVKPISGPTVETIKVNIHTKSRTGVILAFNEAIIEISVSKYP 727          

HSP 2 Score: 137.502 bits (345), Expect = 5.683e-33
Identity = 126/399 (31.58%), Postives = 177/399 (44.36%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD---------------------CQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKC-IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECA--ENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTS--NNTCADVNECL 2147
            G+LF      C D++EC   +        C NT GS+RCD                     C  G+ + K G+C DIDEC+  + C   ++C N  GS++C  +   C  G++ +  T  C DV+EC+    +CG  M+C+N+ G+++C                  +C  G+ F    + CED+DEC    G     C  +  C N  GS++C    KC+PG  LA +G  C D++EC      CE  + CVN   SY C+                  C  G+    D   C D+DEC+     G++LC  +  CIN  GSY C    +CPPG         C DVDEC  GE      + CVN +GS+KC    C   YI  S   N  AD   C+
Sbjct:  271 GWLFQHGH--CVDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGY-YPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQ--GVCGS-MECINLPGTYKC------------------KCGPGYEFNDAKKRCEDVDECIKFAGHV---CDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAACE--QKCVNIPGSYQCI------------------CDRGFALGPDGTKCEDIDECSIWAGSGNDLC--MGGCINTKGSYLC----QCPPGYKIQPDGRTCVDVDECAMGECAGSDKV-CVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSCI 611          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 193.741 bits (491), Expect = 4.647e-51
Identity = 174/594 (29.29%), Postives = 267/594 (44.95%), Query Frame = 3
Query: 1296 CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE---DDECPINMKRNNKGIC-SRCKDGFYFK----KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKC---MCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAE-CPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRK----CLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKF---RRTISRFNMSHMPMGSSRIN--LKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVK 3008
            C  G+   PD   CVD +EC      C     CVN  G + C+       P   + N  G    R +D  Y +    +E         C M   + +G C + D C NL GS+DC P  +CR                                NT  SY C A  C   +  +   G+C    C +GY   ++ +C D+DEC    G N CG+   C+N PGS+ C Q+   C  G   +     C+DV+EC+  +G C  +M C+N+ G+YKC C  GY    +   C DV+EC+ F       DL A C+NT GS++C+C  GF+ +    ++C D+NEC        + +CVN  GSY+C C +G+ L   G  CEDIDEC +        C+ G C+N  G Y C+CPPG+        C D+DEC+  E   S        ++C+N LG +KC +  CP  Y   ++ N   C  +  +   P +    ++ P  ++Y+FI ++  +     R  I+ F +S      + +N  L++K  +    N    ++  F L K       + V ++  ++ P  + L L ++
Sbjct:  180 CRSGFDLAPDGMACVDRNECLTRQSPCTQSEDCVNTIGGYICQRRISRLVPHRHRANRIGNAPRRMRDDPYSRAGEYREASQANTEFGCPMGWLFQHGHCVDVDEC-NL-GSHDCGPLYQCR--------------------------------NTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYP-KNGMCNDIDECVT--GHN-CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQ--QGVC-GSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVC--DLSAECINTIGSFECKCKPGFQLASDG-RRCEDVNECTTGIA-ACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSD-------KVCVNTLGSFKCHSIDCPTNYI-HDSLNKNRCNRQPSACGLPEEC---SKVPLFLTYQFISLARAVPISSHRPAITLFKVSAPNHADTEVNFELQLKTTIVGAPNVLPAIRANFLLQKGEKRNSAV-VTLRDSLDGPQTVKLQLLLR 715          

HSP 2 Score: 161.384 bits (407), Expect = 1.413e-40
Identity = 147/447 (32.89%), Postives = 203/447 (45.41%), Query Frame = 3
Query: 1155 CDCQKGFKHSKLGI-CEDIDECMN-VNICSDDKKCKNNVGSYKCIRSIP-----------------------------------------CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN-NKGICSR--CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKK-CRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDL-EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC 2348
            C C+ GF  +  G+ C D +EC+   + C+  + C N +G Y C R I                                          C  GW        CVDVDEC      CGP  +C N +GS+RC+  +C     +N   G C+   C +G+Y K     C DIDEC   V  +N  C   + C N PGS+ C  K   C  G  +      C D++EC+Q    C   E C+N   +Y C    C P  +F+ +  +              C DVDEC +  G ++C     CIN  GS+ C    +C PG   +S    C+DV+EC TG   C Q   CVN+ GSY+C+CDRG+ L  + T C D++EC ++    S  DL    C+NT GSY CQCP G++      + C D++EC      G    CVNT+GS+KC
Sbjct:  178 CSCRSGFDLAPDGMACVDRNECLTRQSPCTQSEDCVNTIGGYICQRRISRLVPHRHRANRIGNAPRRMRDDPYSRAGEYREASQANTEFGCPMGWLFQ--HGHCVDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGM--CNDIDEC---VTGHN--CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQGV--CGSME-CINLPGTYKC---KCGPGYEFNDAKKR--------------CEDVDECIKFAG-HVCDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIW--AGSGNDLCMGGCINTKGSYLCQCPPGYKIQPDG-RTCVDVDECAMGECAGSDKVCVNTLGSFKC 585          

HSP 3 Score: 139.043 bits (349), Expect = 1.950e-33
Identity = 123/388 (31.70%), Postives = 173/388 (44.59%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD---------------------CQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKC-IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECA--ENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTSNN 2120
            G+LF      C D++EC   +        C NT GS+RCD                     C  G+ + K G+C DIDEC+  + C   ++C N  GS++C  +   C  G++ +  T  C DV+EC+    +CG  M+C+N+ G+++C                  +C  G+ F    + CED+DEC    G     C  +  C N  GS++C    KC+PG  LA +G  C D++EC      CE  + CVN   SY C+                  C  G+    D   C D+DEC+     G++LC  +  CIN  GSY C    +CPPG         C DVDEC  GE      + CVN +GS+KC    C   YI  S N
Sbjct:  271 GWLFQH--GHCVDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGY-YPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQ--GVCG-SMECINLPGTYKC------------------KCGPGYEFNDAKKRCEDVDECIKFAGHV---CDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAACE--QKCVNIPGSYQCI------------------CDRGFALGPDGTKCEDIDECSIWAGSGNDLC--MGGCINTKGSYLC----QCPPGYKIQPDGRTCVDVDECAMGECAGSDKV-CVNTLGSFKCHSIDCPTNYIHDSLN 600          

HSP 4 Score: 120.168 bits (300), Expect = 1.783e-27
Identity = 106/322 (32.92%), Postives = 143/322 (44.41%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCD-----CQKGFK-HSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFP-EICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEI----CVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN 1997
            +C DI+EC T + C    E CVNT GSFRC      C  G++ +   G CED++EC    +C    +C N  G+YKC     CG G++ +     C DVDEC  F   +C    +C+N  GS  C                  +CK GF    + R CED++ECT  +      C++   C N+PGSY CI    C  G  L  +G  C DIDEC    +    +++    C+NT  SY C   P                  GY+   D   C DVDECA        GS  +C+N  GS+ C    +CP      S+  N
Sbjct:  340 MCNDIDECVTGHNCG-AGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECQQ-GVCG-SMECINLPGTYKC----KCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGSFEC------------------KCKPGFQLASDGRRCEDVNECTTGIAA----CEQK--CVNIPGSYQCI----CDRGFALGPDGTKCEDIDECS--IWAGSGNDLCMGGCINTKGSYLCQCPP------------------GYKIQPDGRTCVDVDECAMG---ECAGSDKVCVNTLGSFKC-HSIDCPTNYIHDSLNKN 602          

HSP 5 Score: 104.375 bits (259), Expect = 1.568e-22
Identity = 91/282 (32.27%), Postives = 131/282 (46.45%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKL-GICEDIDECMNV--NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAE 1877
            G+  N     C D+NEC+    C +    C+N  G+++C C  G++ +     CED+DEC+    ++C    +C N +GS++C     C  G++   D   C DV+EC      C    KCVNI GS++C               IC R   GF    +   CEDIDEC++  G  N  C     C N  GSY C    +C PG  +  +G  C D+DEC  M      D++CVNT  S+ C +  C P+     S+ K  C       Q S C   +EC++
Sbjct:  378 GYEVNGATGFCEDVNECQQG-VCGSME--CINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGSFEC----KCKPGFQLASDGRRCEDVNECTTGIAAC--EQKCVNIPGSYQC---------------ICDR---GFALGPDGTKCEDIDECSIWAGSGNDLC--MGGCINTKGSYLC----QCPPGYKIQPDGRTCVDVDECA-MGECAGSDKVCVNTLGSFKCHSIDC-PTNYIHDSLNKNRC-----NRQPSACGLPEECSK 619          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 169.088 bits (427), Expect = 1.098e-43
Identity = 139/463 (30.02%), Postives = 204/463 (44.06%), Query Frame = 3
Query: 1806 KCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC---------------------MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQ-----CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRK----CLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT-----KKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVI--MKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTRYP 3077
            +C CR G+    D + C D+DECA    D  C     C+N PGS+ CI+   C  G    S    C+DVDEC  G   C     C N  GSY+C                      C  GY    N  C D++EC+      +C   E  CVNT GS++CQ     C  G+E +      C D+NEC        + +CVN  GSY+C C +G+ L   G  CEDIDEC +        C+ G C+N  G Y C+CPPG+        C D+DEC+  E   S        ++C+N LG +KC +  CP  Y      K +  +G+ C      +C   D +CL     ++ Y+F  + S    +  IS       P+  SRI   +    + + N     +  F + ++R    NI ++  +K +  P VE +      K    + L  +E+ I + +++YP
Sbjct:  177 ECSCRSGFDLAPDGMACVDIDECATLMDD--CLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGY-YPKNGMCNDIDECV---TGHNCGAGE-ECVNTPGSFRCQQKGNLCAHGYEVNG-ATGFCEDVNECTTGIA-ACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGG-CINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSD-------KVCVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSC----IKVCSTEDTECLGNHTREVLYQFRAVPS---LKTIIS-------PIEVSRIVTHMGVPFSVDYNLDYVGQRHFRIVQER----NIGIVQLVKPISGPTVETIKVNIHTKSRTGVILAFNEAIIEISVSKYP 604          

HSP 2 Score: 167.933 bits (424), Expect = 2.582e-43
Identity = 117/334 (35.03%), Postives = 163/334 (48.80%), Query Frame = 3
Query: 1365 PEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKC---MCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAE-CPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDL-EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC 2348
            P +   G +C +    H C D        R  + +   C+ GF    +  +C DIDEC   +      C E+  C N PGS+ CI    C  G  +      C D+DEC      C P   C NT  SY C A  C   +  +   G+C    C +GY   ++ +C D+DEC    G N CG+   C+N PGS+ C Q+   C  G   +     C+DV+EC TG   C Q   CVN+ GSY+C+CDRG+ L  + T C D++EC ++    +  DL    C+NT GSY CQCP G++      + C D++EC      G    CVNT+GS+KC
Sbjct:  150 PHVLHLGDRCASSHCEHLCHD--------RGGEKVECSCRSGFDLAPDGMACVDIDECATLM----DDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYP-KNGMCNDIDECVT--GHN-CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGN--DLCMGGCINTKGSYLCQCPPGYKIQPDG-RTCVDVDECAMGECAGSDKVCVNTLGSFKC 462          

HSP 3 Score: 140.969 bits (354), Expect = 1.990e-34
Identity = 120/336 (35.71%), Postives = 160/336 (47.62%), Query Frame = 3
Query: 1149 FRCDCQKGFKHSKLGI-CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN-NKGICSR--CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKK-CRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECA--ENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTSNN 2120
              C C+ GF  +  G+ C DIDEC  + + C + ++C N  GS+KCIR++ CG G+  D +T  C DVDEC      CGP  +C N +GS+RC+  +C     +N   G C+   C +G+Y K     C DIDEC   V  +N  C   + C N PGS+ C  K   C  G  +      C D++EC      CE  + CVN   SY C+                  C  G+    D   C D+DEC+     G++LC  +  CIN  GSY C    +CPPG         C DVDEC  GE      + CVN +GS+KC    C   YI  S N
Sbjct:  176 VECSCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGM--CNDIDEC---VTGHN--CGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECTTGIAACE--QKCVNIPGSYQCI------------------CDRGFALGPDGTKCEDIDECSIWAGSGNDLC--MGGCINTKGSYLC----QCPPGYKIQPDGRTCVDVDECAMGECAGSDKV-CVNTLGSFKCHSIDCPTNYIHDSLN 477          

HSP 4 Score: 107.457 bits (267), Expect = 1.162e-23
Identity = 108/346 (31.21%), Postives = 148/346 (42.77%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRC----DCQKGFKH-SKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCV----------------DVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEI----CVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN 1997
            GF        C DI+EC T      + + C+NT GSF+C     C  G+   S+   C D+DEC +  + C    +C+N  GSY+C  +  CG G  ++P T +C                 D+DEC      CG G +CVN  GS RC+            KG  + C  G+     T  CED++ECT  +      C++   C N+PGSY CI    C  G  L  +G  C DIDEC    +    +++    C+NT  SY C   P                  GY+   D   C DVDECA        GS  +C+N  GS+ C    +CP      S+  N
Sbjct:  183 GFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRC-DAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDEC-VTGHNCGAGEECVNTPGSFRCQ-----------QKG--NLCAHGYEVNGATGFCEDVNECTTGIAA----CEQK--CVNIPGSYQCI----CDRGFALGPDGTKCEDIDECS--IWAGSGNDLCMGGCINTKGSYLCQCPP------------------GYKIQPDGRTCVDVDECAMG---ECAGSDKVCVNTLGSFKC-HSIDCPTNYIHDSLNKN 479          

HSP 5 Score: 106.686 bits (265), Expect = 2.187e-23
Identity = 92/285 (32.28%), Postives = 127/285 (44.56%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD---------------------CQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKC-IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGY 1829
            G+  +   E C D++EC   +        C NT GS+RCD                     C  G+ + K G+C DIDEC+  + C   ++C N  GS++C  +   C  G++ +  T  C DV+EC      C    KCVNI GS++C               IC R   GF    +   CEDIDEC++  G  N  C     C N  GSY C    +C PG  +  +G  C D+DEC  M      D++CVNT  S+ C +  C P+     S+ K    DGY
Sbjct:  230 GYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGY-YPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECTTGIAAC--EQKCVNIPGSYQC---------------ICDR---GFALGPDGTKCEDIDECSIWAGSGNDLCMGG--CINTKGSYLC----QCPPGYKIQPDGRTCVDVDECA-MGECAGSDKVCVNTLGSFKCHSIDC-PTNYIHDSLNKNQIADGY 485          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: CG31999 (gene:FBgn0051999 transcript:FBtr0344870)

HSP 1 Score: 221.09 bits (562), Expect = 2.700e-59
Identity = 197/661 (29.80%), Postives = 295/661 (44.63%), Query Frame = 3
Query: 1161 CQKGFKHSKLGICEDIDECMN--VNIC--SDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSR---CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN----NTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC-LLEPRKCLNGICVNVPGRYECKCPPGF--AADRKEICQDIDECSTSE--GVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNE----KPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYA-LNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTRY 3074
            C KGF     G C DIDEC +  +N C  + +++C N VGSY C     C  G+  D   N CVD++EC      C P  +C N  GS+                 IC+R   C  G+    ET +C+D DECT++       C     C N  GS+ C  K      T      +    ++  ++      P  + V  +  Y       + +++ D       C  G+ +N    C D +EC E    N CG+   CIN  G + C    +C PG   +    +C D+DEC+TGE  C +   C N  G + C C  G+ L  +    +TC D NEC L   +  CP L A+C NT G+Y C+C  GF+         +C DI+EC    P   + +C+N  G Y+C C  GY+L     TC DI+EC + +  K   G+C+N PG Y+C CP G+  AAD    C+D+DEC+T     VC+  +D     +C N+ G YKC   +CP+GY+          + + ++ C  N   C  E    +P   +Y FI   S +              P+    I   +K   + + TN        F   ++      + VI+KK +  P +I L L +  Y   M  G S + + L+++++
Sbjct:  315 CDKGFSLHN-GTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSC----NCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSY-----------------ICTRLQSCGTGYTLNAETGNCDDDDECTLSTH----NCPSNYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYPLAV--HPEYSQNNDSISTNRRVD-------CSPGFYRNTLGACIDTNECMEQ---NPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVDTNECAL--EQRVCP-LNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVI-PGLCQQKCLNFWGGYRCTCNSGYQLGPDNRTCNDINECEVHKDYKLCMGLCINTPGSYQCSCPRGYILAADMN-TCRDVDECATDSINQVCTGRND-----ICTNIRGSYKCTTVNCPLGYSI---------DPEQKNRCRQNLNFCEGEECYTQPSAFTYNFITFVSKLMIPPDGRTIFTLRGPLWYDNIEFDLKIVRIQATTNIQKATDGSFDTLQNN---NQVNVILKKSLEGPQDIELELSMTVYTNGMPRGKSVAKLFLFVSQH 915          

HSP 2 Score: 121.709 bits (304), Expect = 1.011e-27
Identity = 103/331 (31.12%), Postives = 145/331 (43.81%), Query Frame = 3
Query: 1152 RCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPIN--MKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNG---IACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGK---CPQNMHCVNVVGSYKCM---CDRGYIL 2108
            R DC  GF  + LG C D +ECM  N C + ++C N  G ++C   + C  G+K   D   C+D+DEC+     CG    C N  G   C    CPI   +KR+  G                +C D +EC +        C     CFN  G+Y C    +C+ G     +G     C DIDEC+ +   C+  + C+N +  Y                  +C C  GY+   D+  C D++EC  +    LC  + +CIN PGSY C     CP G   ++  + C+DVDEC T         +N  C N+ GSYKC    C  GY +
Sbjct:  502 RVDCSPGFYRNTLGACIDTNECMEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVC---SCPIGHELKRSIGG--------------ASTCVDTNECALE----QRVCPLNAQCFNTIGAYYC----ECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQ--QKCLNFWGGY------------------RCTCNSGYQLGPDNRTCNDINECEVHKDYKLC--MGLCINTPGSYQC----SCPRGYILAADMNTCRDVDECATDSINQVCTGRNDICTNIRGSYKCTTVNCPLGYSI 781          

HSP 3 Score: 97.8265 bits (242), Expect = 2.652e-20
Identity = 127/463 (27.43%), Postives = 181/463 (39.09%), Query Frame = 3
Query: 1584 VCFNLPGSYDCIPKKKCRPGTVLAQNGIACN---------------------DIDECKQMKFRCEPDEICVNTYSSYHCV---ASPCAPSQQFDYSVGKCMCRDGYR----------------QNQDSICTDVDECAENGGDN-LCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM----CDRGYILTS-NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQ----------------CPKGFE------WSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNG-ICVNVPGRYEC----KCPPGF--AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY-TKKETGNGFICELKSESICE----PNDADCLN 2729
            +C N   +Y C    KC PG +L  N + C+                     DIDEC++    C+  + C NT   YHC+      C P   +D+      C+D Y+                   +  C+D+DEC+    +N    S   C+N  GSY+C     C PG    +  + C D++EC      C     C N +GSY C     C  GY L +    C D +EC L     +CP     C NT GS++C                  P   E       S YP          LA +P   + +  ++T  + +  C  G+  +  G  C D +EC +E   C N   C+N  G + C    +C PG+    D K  C DIDEC T E  C         ++C N  G + C   SCP+G+  K+  G    C   +E   E    P +A C N
Sbjct:  203 ICENTFDAYQC----KCHPGFMLDNNNVTCSPMKTQICPSGYNLDKLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVKEKECPPGFHYDHDYD--ACKDDYKCKDRKCVKIQSCDKGFSLHNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSC----NCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCDDDDECTL--STHNCPS-NYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYP--------LAVHPEYSQNNDSIST--NRRVDCSPGFYRNTLG-ACIDTNEC-MEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKS-CIDIDECDTGEHNCGER------QICRNRNGGFVC---SCPIGHELKRSIGGASTCVDTNECALEQRVCPLNAQCFN 630          

HSP 4 Score: 87.8113 bits (216), Expect = 3.592e-17
Identity = 77/262 (29.39%), Postives = 102/262 (38.93%), Query Frame = 3
Query: 1881 GGDNLCGSL-----YICINHPGSYAC-----------------IQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM------------------------------------CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKC----KCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYEC 2474
            G D++CG +     +IC N   +Y C                 ++   CP G     + + C D+DEC      C  + +C N  G Y C+                                    CD+G+ L  N TC+D++EC          +    CVNT GSY C C  GF   D  + KC DINEC   N  C    +C NT+GSY C     C  GY L+     C+D DEC L    C  N  C N  G + C
Sbjct:  188 GDDDICGKIENLCAHICENTFDAYQCKCHPGFMLDNNNVTCSPMKTQICPSGYNLDKLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVKEKECPPGFHYDHDYDACKDDYKCKDRKCVKIQSCDKGFSL-HNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNL-DATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCDDDDECTLSTHNCPSNYDCHNTRGSFRC 447          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: CG31999 (gene:FBgn0051999 transcript:FBtr0089144)

HSP 1 Score: 221.09 bits (562), Expect = 2.700e-59
Identity = 197/661 (29.80%), Postives = 295/661 (44.63%), Query Frame = 3
Query: 1161 CQKGFKHSKLGICEDIDECMN--VNIC--SDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSR---CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN----NTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC-LLEPRKCLNGICVNVPGRYECKCPPGF--AADRKEICQDIDECSTSE--GVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNE----KPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYA-LNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTRY 3074
            C KGF     G C DIDEC +  +N C  + +++C N VGSY C     C  G+  D   N CVD++EC      C P  +C N  GS+                 IC+R   C  G+    ET +C+D DECT++       C     C N  GS+ C  K      T      +    ++  ++      P  + V  +  Y       + +++ D       C  G+ +N    C D +EC E    N CG+   CIN  G + C    +C PG   +    +C D+DEC+TGE  C +   C N  G + C C  G+ L  +    +TC D NEC L   +  CP L A+C NT G+Y C+C  GF+         +C DI+EC    P   + +C+N  G Y+C C  GY+L     TC DI+EC + +  K   G+C+N PG Y+C CP G+  AAD    C+D+DEC+T     VC+  +D     +C N+ G YKC   +CP+GY+          + + ++ C  N   C  E    +P   +Y FI   S +              P+    I   +K   + + TN        F   ++      + VI+KK +  P +I L L +  Y   M  G S + + L+++++
Sbjct:  315 CDKGFSLHN-GTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSC----NCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSY-----------------ICTRLQSCGTGYTLNAETGNCDDDDECTLSTH----NCPSNYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYPLAV--HPEYSQNNDSISTNRRVD-------CSPGFYRNTLGACIDTNECMEQ---NPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVDTNECAL--EQRVCP-LNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVI-PGLCQQKCLNFWGGYRCTCNSGYQLGPDNRTCNDINECEVHKDYKLCMGLCINTPGSYQCSCPRGYILAADMN-TCRDVDECATDSINQVCTGRND-----ICTNIRGSYKCTTVNCPLGYSI---------DPEQKNRCRQNLNFCEGEECYTQPSAFTYNFITFVSKLMIPPDGRTIFTLRGPLWYDNIEFDLKIVRIQATTNIQKATDGSFDTLQNN---NQVNVILKKSLEGPQDIELELSMTVYTNGMPRGKSVAKLFLFVSQH 915          

HSP 2 Score: 121.709 bits (304), Expect = 1.011e-27
Identity = 103/331 (31.12%), Postives = 145/331 (43.81%), Query Frame = 3
Query: 1152 RCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPIN--MKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNG---IACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGK---CPQNMHCVNVVGSYKCM---CDRGYIL 2108
            R DC  GF  + LG C D +ECM  N C + ++C N  G ++C   + C  G+K   D   C+D+DEC+     CG    C N  G   C    CPI   +KR+  G                +C D +EC +        C     CFN  G+Y C    +C+ G     +G     C DIDEC+ +   C+  + C+N +  Y                  +C C  GY+   D+  C D++EC  +    LC  + +CIN PGSY C     CP G   ++  + C+DVDEC T         +N  C N+ GSYKC    C  GY +
Sbjct:  502 RVDCSPGFYRNTLGACIDTNECMEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVC---SCPIGHELKRSIGG--------------ASTCVDTNECALE----QRVCPLNAQCFNTIGAYYC----ECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQ--QKCLNFWGGY------------------RCTCNSGYQLGPDNRTCNDINECEVHKDYKLC--MGLCINTPGSYQC----SCPRGYILAADMNTCRDVDECATDSINQVCTGRNDICTNIRGSYKCTTVNCPLGYSI 781          

HSP 3 Score: 97.8265 bits (242), Expect = 2.652e-20
Identity = 127/463 (27.43%), Postives = 181/463 (39.09%), Query Frame = 3
Query: 1584 VCFNLPGSYDCIPKKKCRPGTVLAQNGIACN---------------------DIDECKQMKFRCEPDEICVNTYSSYHCV---ASPCAPSQQFDYSVGKCMCRDGYR----------------QNQDSICTDVDECAENGGDN-LCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM----CDRGYILTS-NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQ----------------CPKGFE------WSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNG-ICVNVPGRYEC----KCPPGF--AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY-TKKETGNGFICELKSESICE----PNDADCLN 2729
            +C N   +Y C    KC PG +L  N + C+                     DIDEC++    C+  + C NT   YHC+      C P   +D+      C+D Y+                   +  C+D+DEC+    +N    S   C+N  GSY+C     C PG    +  + C D++EC      C     C N +GSY C     C  GY L +    C D +EC L     +CP     C NT GS++C                  P   E       S YP          LA +P   + +  ++T  + +  C  G+  +  G  C D +EC +E   C N   C+N  G + C    +C PG+    D K  C DIDEC T E  C         ++C N  G + C   SCP+G+  K+  G    C   +E   E    P +A C N
Sbjct:  203 ICENTFDAYQC----KCHPGFMLDNNNVTCSPMKTQICPSGYNLDKLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVKEKECPPGFHYDHDYD--ACKDDYKCKDRKCVKIQSCDKGFSLHNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSC----NCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCDDDDECTL--STHNCPS-NYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYP--------LAVHPEYSQNNDSIST--NRRVDCSPGFYRNTLG-ACIDTNEC-MEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKS-CIDIDECDTGEHNCGER------QICRNRNGGFVC---SCPIGHELKRSIGGASTCVDTNECALEQRVCPLNAQCFN 630          

HSP 4 Score: 87.8113 bits (216), Expect = 3.592e-17
Identity = 77/262 (29.39%), Postives = 102/262 (38.93%), Query Frame = 3
Query: 1881 GGDNLCGSL-----YICINHPGSYAC-----------------IQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM------------------------------------CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKC----KCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYEC 2474
            G D++CG +     +IC N   +Y C                 ++   CP G     + + C D+DEC      C  + +C N  G Y C+                                    CD+G+ L  N TC+D++EC          +    CVNT GSY C C  GF   D  + KC DINEC   N  C    +C NT+GSY C     C  GY L+     C+D DEC L    C  N  C N  G + C
Sbjct:  188 GDDDICGKIENLCAHICENTFDAYQCKCHPGFMLDNNNVTCSPMKTQICPSGYNLDKLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVKEKECPPGFHYDHDYDACKDDYKCKDRKCVKIQSCDKGFSL-HNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNL-DATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCDDDDECTLSTHNCPSNYDCHNTRGSFRC 447          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0290277)

HSP 1 Score: 188.734 bits (478), Expect = 3.138e-48
Identity = 169/544 (31.07%), Postives = 240/544 (44.12%), Query Frame = 3
Query: 1146 SFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPG-TVLAQNGIA--CNDIDECKQMKFRCEPDEICVNTYSSYHCVASP---CAPSQQFDYSVGKCMCRDGYRQNQDS--ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISG-----------------------------------DTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPV 2639
            SF C C  G++      C+DIDEC  + ++CS    C+N  G Y+C    P G    E+     C+  + CE     C     C+  RG                  G+C+ C++GF    + +SCED+DEC +N    NG C++  VC NLPGSY CI    C  G  +L  +GI   C DIDEC Q    C    +C N   SY C+  P            S+      D       S   C D+DEC+   G+      + C N PG + C     CP G   S     CQD+DEC    G+C Q   C+N  G + C C+ G+ LT +   CAD++EC   +   +C D+   C+N  G++ C C +G+E +   +  C D++EC      G  H+C+N  G+++C C  GY L+  G                                   D C DIDEC  +   C +  C N  G ++C CPPG+  D  ++ CQDIDEC   +  C   +       CIN +G ++C     PV
Sbjct:  534 SFSCICPTGYRSEAFS-CQDIDECAEDTHLCS--HTCQNTPGGYQC--QCPEGLNLVEE---YTCLAENLCEVNNNGCE--QICLTARG------------------GVCA-CREGFRLSADGKSCEDVDECLVN----NGGCQQ--VCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGN----CSHFCQNEPGGFQCA----CPLGYALSEDMRTCQDIDECLDSNGQCSQ--LCLNQPGGFACACETGFELTPDGFGCADIDEC--SQDYGNCSDI---CINLLGTHACACERGYELAKDKLS-CLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHR-CSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGT-------CINEIGGFRCEFPKFPV 1014          

HSP 2 Score: 187.578 bits (475), Expect = 7.943e-48
Identity = 213/768 (27.73%), Postives = 304/768 (39.58%), Query Frame = 3
Query:  807 QISLKANPMTTTSDATSALLKISQTTSSPTVLCDQ-GKKWEPLLHVCVQLII----------SCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNVNICSD-DKKCKNNVGSYKCIRSI--------------------------------PCGFGWKEDPDTNDCVDVDECEAFPEICGP---------GMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLP-GSYDCI-PK------------------------KKCRPGTVLA----------------QNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSV----------------------GKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-----------------------TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQ-CVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECS-TSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            +  LKA   T   ++++A +K++     PT L +  G+      H+C +L+            C + + L PN                          C DI+EC E+   C+   EIC N  G ++C CQ+G+   + G  C DI+EC N  + S+    C+N  GSY+C+  +                                 C  G++   D  DC D++EC    E+ GP           KC N  GS RC                   C +G++  ++ RSC  +D CT        R +    C +LP GSY C+ PK                        +KC PGT LA                    +C DIDEC +    C     C NT   Y C   P   +   +Y+                       G C CR+G+R + D   C DVDEC  N G    G   +C N PGSY CI    C  G   +    +   C D+DEC      C   M C N+ GSY C+C  GY L  +N                       TC D++EC L     +C      C N  G ++C CP G+  S+  ++ C DI+ECL +N  G+  Q C+N  G + C C  G+ L+  G  C DIDEC  +   C + IC+N+ G + C C  G+   + ++ C D+DEC+    G CS E        CIN  G ++C    CP+GY   + G
Sbjct:  213 ETPLKAEVQTDVLNSSNASVKVTNDPYEPTFLDNNCGEDNGGCAHICKRLLYPDENQPINKCDCREGYTLDPNDYAS----------------------CLDIDECLESNGGCS---EICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINEC----EVDGPEDLDNNAVCQQKCENTIGSFRC------------------TCVEGYHLLEDQRSCA-LDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLC--SHTCQNTPGGYQC-QCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNG----GCQQVCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLAN--GNCSHF---CQNEPGGFQCACPLGYALSE-DMRTCQDIDECLDSN--GQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNC-SDICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHE--------CINKAGTFEC---GCPLGYILNDDG 901          

HSP 3 Score: 114.775 bits (286), Expect = 2.081e-25
Identity = 120/434 (27.65%), Postives = 174/434 (40.09%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKL----GICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGW--------------------KEDPDTNDCVDVDECEAFPEICG-------PGMKCVNIRGSHRCED-------DECPINMKRNNK----------GICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------ASPCAPS--------QQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNE 2141
            GF  +   + C D++EC   N      ++C N  GS+ C C  G++  KL    G C DIDEC    + CSD   C+N  GSY C+   P G+                       E P  + C+D+DEC      C         G +C    G    ED       DEC   +  N +          G    C+ GF    +   C DIDEC+ + G     C  +D+C NL G++ C     C  G  LA++ ++C D+DEC  +       E C+N   ++ C              C+P+        Q+         C  GY    D  C D+DEC +  G    G  + C N  GS+ C     CPPG    S    CQD+DEC+  +  C     C+N +G ++C   +  +L    T + + E
Sbjct:  620 GFRLSADGKSCEDVDECLVNNGGCQ--QVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCL--CPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDEC---LDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYG----NC--SDICINLLGTHAC----ACERGYELAKDKLSCLDVDECAGLLSGGCSHE-CINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNG----GCSHRCSNTEGSFKC----SCPPGYELDSDQKTCQDIDECDQDKTSCITGT-CINEIGGFRCEFPKFPVLPEIPTASSLPE 1026          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301222)

HSP 1 Score: 188.734 bits (478), Expect = 3.138e-48
Identity = 169/544 (31.07%), Postives = 240/544 (44.12%), Query Frame = 3
Query: 1146 SFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPG-TVLAQNGIA--CNDIDECKQMKFRCEPDEICVNTYSSYHCVASP---CAPSQQFDYSVGKCMCRDGYRQNQDS--ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISG-----------------------------------DTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPV 2639
            SF C C  G++      C+DIDEC  + ++CS    C+N  G Y+C    P G    E+     C+  + CE     C     C+  RG                  G+C+ C++GF    + +SCED+DEC +N    NG C++  VC NLPGSY CI    C  G  +L  +GI   C DIDEC Q    C    +C N   SY C+  P            S+      D       S   C D+DEC+   G+      + C N PG + C     CP G   S     CQD+DEC    G+C Q   C+N  G + C C+ G+ LT +   CAD++EC   +   +C D+   C+N  G++ C C +G+E +   +  C D++EC      G  H+C+N  G+++C C  GY L+  G                                   D C DIDEC  +   C +  C N  G ++C CPPG+  D  ++ CQDIDEC   +  C   +       CIN +G ++C     PV
Sbjct:  534 SFSCICPTGYRSEAFS-CQDIDECAEDTHLCS--HTCQNTPGGYQC--QCPEGLNLVEE---YTCLAENLCEVNNNGCE--QICLTARG------------------GVCA-CREGFRLSADGKSCEDVDECLVN----NGGCQQ--VCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGN----CSHFCQNEPGGFQCA----CPLGYALSEDMRTCQDIDECLDSNGQCSQ--LCLNQPGGFACACETGFELTPDGFGCADIDEC--SQDYGNCSDI---CINLLGTHACACERGYELAKDKLS-CLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHR-CSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGT-------CINEIGGFRCEFPKFPV 1014          

HSP 2 Score: 187.578 bits (475), Expect = 7.943e-48
Identity = 213/768 (27.73%), Postives = 304/768 (39.58%), Query Frame = 3
Query:  807 QISLKANPMTTTSDATSALLKISQTTSSPTVLCDQ-GKKWEPLLHVCVQLII----------SCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNVNICSD-DKKCKNNVGSYKCIRSI--------------------------------PCGFGWKEDPDTNDCVDVDECEAFPEICGP---------GMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLP-GSYDCI-PK------------------------KKCRPGTVLA----------------QNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSV----------------------GKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-----------------------TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQ-CVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECS-TSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            +  LKA   T   ++++A +K++     PT L +  G+      H+C +L+            C + + L PN                          C DI+EC E+   C+   EIC N  G ++C CQ+G+   + G  C DI+EC N  + S+    C+N  GSY+C+  +                                 C  G++   D  DC D++EC    E+ GP           KC N  GS RC                   C +G++  ++ RSC  +D CT        R +    C +LP GSY C+ PK                        +KC PGT LA                    +C DIDEC +    C     C NT   Y C   P   +   +Y+                       G C CR+G+R + D   C DVDEC  N G    G   +C N PGSY CI    C  G   +    +   C D+DEC      C   M C N+ GSY C+C  GY L  +N                       TC D++EC L     +C      C N  G ++C CP G+  S+  ++ C DI+ECL +N  G+  Q C+N  G + C C  G+ L+  G  C DIDEC  +   C + IC+N+ G + C C  G+   + ++ C D+DEC+    G CS E        CIN  G ++C    CP+GY   + G
Sbjct:  213 ETPLKAEVQTDVLNSSNASVKVTNDPYEPTFLDNNCGEDNGGCAHICKRLLYPDENQPINKCDCREGYTLDPNDYAS----------------------CLDIDECLESNGGCS---EICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINEC----EVDGPEDLDNNAVCQQKCENTIGSFRC------------------TCVEGYHLLEDQRSCA-LDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLC--SHTCQNTPGGYQC-QCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNG----GCQQVCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLAN--GNCSHF---CQNEPGGFQCACPLGYALSE-DMRTCQDIDECLDSN--GQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNC-SDICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHE--------CINKAGTFEC---GCPLGYILNDDG 901          

HSP 3 Score: 114.775 bits (286), Expect = 2.081e-25
Identity = 120/434 (27.65%), Postives = 174/434 (40.09%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKL----GICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGW--------------------KEDPDTNDCVDVDECEAFPEICG-------PGMKCVNIRGSHRCED-------DECPINMKRNNK----------GICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------ASPCAPS--------QQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNE 2141
            GF  +   + C D++EC   N      ++C N  GS+ C C  G++  KL    G C DIDEC    + CSD   C+N  GSY C+   P G+                       E P  + C+D+DEC      C         G +C    G    ED       DEC   +  N +          G    C+ GF    +   C DIDEC+ + G     C  +D+C NL G++ C     C  G  LA++ ++C D+DEC  +       E C+N   ++ C              C+P+        Q+         C  GY    D  C D+DEC +  G    G  + C N  GS+ C     CPPG    S    CQD+DEC+  +  C     C+N +G ++C   +  +L    T + + E
Sbjct:  620 GFRLSADGKSCEDVDECLVNNGGCQ--QVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCL--CPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDEC---LDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYG----NC--SDICINLLGTHAC----ACERGYELAKDKLSCLDVDECAGLLSGGCSHE-CINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNG----GCSHRCSNTEGSFKC----SCPPGYELDSDQKTCQDIDECDQDKTSCITGT-CINEIGGFRCEFPKFPVLPEIPTASSLPE 1026          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301221)

HSP 1 Score: 188.734 bits (478), Expect = 3.138e-48
Identity = 169/544 (31.07%), Postives = 240/544 (44.12%), Query Frame = 3
Query: 1146 SFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPG-TVLAQNGIA--CNDIDECKQMKFRCEPDEICVNTYSSYHCVASP---CAPSQQFDYSVGKCMCRDGYRQNQDS--ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISG-----------------------------------DTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPV 2639
            SF C C  G++      C+DIDEC  + ++CS    C+N  G Y+C    P G    E+     C+  + CE     C     C+  RG                  G+C+ C++GF    + +SCED+DEC +N    NG C++  VC NLPGSY CI    C  G  +L  +GI   C DIDEC Q    C    +C N   SY C+  P            S+      D       S   C D+DEC+   G+      + C N PG + C     CP G   S     CQD+DEC    G+C Q   C+N  G + C C+ G+ LT +   CAD++EC   +   +C D+   C+N  G++ C C +G+E +   +  C D++EC      G  H+C+N  G+++C C  GY L+  G                                   D C DIDEC  +   C +  C N  G ++C CPPG+  D  ++ CQDIDEC   +  C   +       CIN +G ++C     PV
Sbjct:  534 SFSCICPTGYRSEAFS-CQDIDECAEDTHLCS--HTCQNTPGGYQC--QCPEGLNLVEE---YTCLAENLCEVNNNGCE--QICLTARG------------------GVCA-CREGFRLSADGKSCEDVDECLVN----NGGCQQ--VCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGN----CSHFCQNEPGGFQCA----CPLGYALSEDMRTCQDIDECLDSNGQCSQ--LCLNQPGGFACACETGFELTPDGFGCADIDEC--SQDYGNCSDI---CINLLGTHACACERGYELAKDKLS-CLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHR-CSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGT-------CINEIGGFRCEFPKFPV 1014          

HSP 2 Score: 187.578 bits (475), Expect = 7.943e-48
Identity = 213/768 (27.73%), Postives = 304/768 (39.58%), Query Frame = 3
Query:  807 QISLKANPMTTTSDATSALLKISQTTSSPTVLCDQ-GKKWEPLLHVCVQLII----------SCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNVNICSD-DKKCKNNVGSYKCIRSI--------------------------------PCGFGWKEDPDTNDCVDVDECEAFPEICGP---------GMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLP-GSYDCI-PK------------------------KKCRPGTVLA----------------QNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSV----------------------GKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-----------------------TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQ-CVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECS-TSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            +  LKA   T   ++++A +K++     PT L +  G+      H+C +L+            C + + L PN                          C DI+EC E+   C+   EIC N  G ++C CQ+G+   + G  C DI+EC N  + S+    C+N  GSY+C+  +                                 C  G++   D  DC D++EC    E+ GP           KC N  GS RC                   C +G++  ++ RSC  +D CT        R +    C +LP GSY C+ PK                        +KC PGT LA                    +C DIDEC +    C     C NT   Y C   P   +   +Y+                       G C CR+G+R + D   C DVDEC  N G    G   +C N PGSY CI    C  G   +    +   C D+DEC      C   M C N+ GSY C+C  GY L  +N                       TC D++EC L     +C      C N  G ++C CP G+  S+  ++ C DI+ECL +N  G+  Q C+N  G + C C  G+ L+  G  C DIDEC  +   C + IC+N+ G + C C  G+   + ++ C D+DEC+    G CS E        CIN  G ++C    CP+GY   + G
Sbjct:  213 ETPLKAEVQTDVLNSSNASVKVTNDPYEPTFLDNNCGEDNGGCAHICKRLLYPDENQPINKCDCREGYTLDPNDYAS----------------------CLDIDECLESNGGCS---EICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINEC----EVDGPEDLDNNAVCQQKCENTIGSFRC------------------TCVEGYHLLEDQRSCA-LDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLC--SHTCQNTPGGYQC-QCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNG----GCQQVCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLAN--GNCSHF---CQNEPGGFQCACPLGYALSE-DMRTCQDIDECLDSN--GQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNC-SDICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHE--------CINKAGTFEC---GCPLGYILNDDG 901          

HSP 3 Score: 114.775 bits (286), Expect = 2.081e-25
Identity = 120/434 (27.65%), Postives = 174/434 (40.09%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKL----GICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGW--------------------KEDPDTNDCVDVDECEAFPEICG-------PGMKCVNIRGSHRCED-------DECPINMKRNNK----------GICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------ASPCAPS--------QQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNE 2141
            GF  +   + C D++EC   N      ++C N  GS+ C C  G++  KL    G C DIDEC    + CSD   C+N  GSY C+   P G+                       E P  + C+D+DEC      C         G +C    G    ED       DEC   +  N +          G    C+ GF    +   C DIDEC+ + G     C  +D+C NL G++ C     C  G  LA++ ++C D+DEC  +       E C+N   ++ C              C+P+        Q+         C  GY    D  C D+DEC +  G    G  + C N  GS+ C     CPPG    S    CQD+DEC+  +  C     C+N +G ++C   +  +L    T + + E
Sbjct:  620 GFRLSADGKSCEDVDECLVNNGGCQ--QVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCL--CPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDEC---LDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYG----NC--SDICINLLGTHAC----ACERGYELAKDKLSCLDVDECAGLLSGGCSHE-CINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNG----GCSHRCSNTEGSFKC----SCPPGYELDSDQKTCQDIDECDQDKTSCITGT-CINEIGGFRCEFPKFPVLPEIPTASSLPE 1026          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: BX663503.3 (latent-transforming growth factor beta-binding protein 4 [Source:NCBI gene;Acc:100333499])

HSP 1 Score: 221.09 bits (562), Expect = 2.548e-58
Identity = 215/658 (32.67%), Postives = 301/658 (45.74%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------------EDDECPINMKRNNKGI--CSRCKDGFYFKKETRSCEDIDECTMN------------VGWYNGRCKE---------TDV-------------CFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRY----ECK------------------------CPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEF 2759
            G+  N    +C D++EC +  N C N    C NT+GSFRC C+ G+K      C DIDEC++   C   K+C N+ GSY+C+   P GF    D     C D+DEC   P  C P  +C N  GS RC                    +  +CP     N++G   C  C+ GF  +    +C DIDEC               +G +   C+          TDV             C N  GSY C+    CRPG  L +NG AC+DIDEC+Q    C  +  C NT  SY                   C CR G+R  +++IC DV+EC     + L      C+N  GS+ C+    C PG     +   CQDVDEC     +C  N  C N  GS++C+CD G+ L  +  C D++EC+    ++ C   ++ CVNT GSY+C C  G+  +    ++C DINECL  + C  + +CVNT GSYKC C QGY+   +G +C+D+DEC L+   C +G C N  G +    EC+                        C PG+       C D++EC+ +E VC   +       C NL+G Y C+   C  GY  + TG+G IC   +E  CE     C + + + +   F
Sbjct:  621 GYQTNSQQTLCVDLDECRQVPNPCINGR--CENTLGSFRCVCRTGYKLQD-NSCIDIDECVDPLRCPG-KECVNSQGSYRCVSCRP-GF----DLLNGQCSDIDECRRTPSPC-PDGRCENTAGSFRCSCRTGYRLQANTCVDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGLRNG--ACSDIDECRQTPSPCQNGLCENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQCPGQECLNSQGSYRCV---SCRPGFGL-RNG-ACSDIDECRQTPDLCV-NGRCENTMGSY------------------SCSCRPGFRL-EENICKDVNECE----NELQCPGMECVNSVGSFKCV---SCKPGF--QLLDGQCQDVDECSRTPRRC-TNGQCKNTPGSFRCVCDVGFHL-QDGVCTDIDECV---SDQVC-GAQSVCVNTDGSYRCDCAPGYRAAGAG-RQCRDINECLEGDFCFPRGECVNTDGSYKCVCSQGYKSVANGTSCQDVDECALD-GVCQDGRCSNTEGSFLYVNECQDSTGLICGSQRCENTIGSFHCVASCEPGYQITSTAECVDVNECA-NETVCGAHA------FCQNLIGTYHCL---CDQGY--ESTGDGKICVDINE--CEAMQGVCGSARCWNVEGSF 1210          

HSP 2 Score: 216.853 bits (551), Expect = 5.334e-57
Identity = 211/576 (36.63%), Postives = 290/576 (50.35%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFK-HSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC---------------EDDECPINMKRNNKGICSRCKDGFY------FKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV--------------------ASPCAPSQQFDYSVG--KCM-CRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN-CQDVDECETGEGKCPQNMHCVNVVGSYKCM-CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVN 2624
            GF+ N     C D NEC       +  E CVNT GSFRC C  G++ +S+  +C D+DEC  V     + +C+N +GS++C+    C  G+K     N C+D+DEC   P  C PG +CVN +GS+RC               + DEC         G C      F       ++ +  +C D++EC         +C   + C N  GSY C+    CRPG  L +NG AC+DIDEC+Q    C+ + +C NT  S+ CV                     S C P Q+   S G  +C+ CR G+   ++  C+D+DEC +    +LC +   C N  GSY+C     C PG FR  +  N C+DV+ECE  E +CP  M CVN VGS+KC+ C  G+ L  +  C DV+EC   R    C +   +C NT GS++C C  GF   D     CTDI+EC++   CG +  CVNT GSY+C C  GYR + +G  C DI+ECL        G CVN  G Y+C C  G+ +      CQD+DEC+  +GVC      Q+GR C N  G +  VN
Sbjct:  579 GFILNPQQGHCQDKNECVLTPRPCSVGE-CVNTPGSFRCVCPAGYQTNSQQTLCVDLDECRQVPNPCINGRCENTLGSFRCV----CRTGYKL--QDNSCIDIDEC-VDPLRC-PGKECVNSQGSYRCVSCRPGFDLLNGQCSDIDECRRTPSPCPDGRCENTAGSFRCSCRTGYRLQANTCVDVNECED-----PSQCPGQE-CLNSQGSYRCV---SCRPGFGL-RNG-ACSDIDECRQTPSPCQ-NGLCENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQC-PGQECLNSQGSYRCVSCRPGFGL-RNGACSDIDECRQT--PDLCVNGR-CENTMGSYSC----SCRPG-FR--LEENICKDVNECEN-ELQCP-GMECVNSVGSFKCVSCKPGFQLL-DGQCQDVDEC--SRTPRRCTN--GQCKNTPGSFRCVCDVGFHLQD---GVCTDIDECVSDQVCGAQSVCVNTDGSYRCDCAPGYRAAGAGRQCRDINECLEGDFCFPRGECVNTDGSYKCVCSQGYKSVANGTSCQDVDECAL-DGVC------QDGR-CSNTEGSFLYVN 1103          

HSP 3 Score: 205.297 bits (521), Expect = 2.484e-53
Identity = 187/585 (31.97%), Postives = 260/585 (44.44%), Query Frame = 3
Query: 1050 FNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------------EDDECPINMKRNNKGI--CSRCKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQF-------------------------DYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLL---------------FRPEESCPDLEA------RCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGR 2585
            F+     C DI+EC  T + C +    C NT GSFRC C+ G++  +   C D++EC + + C   ++C N+ GSY+C+   P GFG +       C D+DEC   P  C  G+ C N  GS RC                    +  +CP     N++G   C  C+ GF  +    +C DIDEC        NGRC+      N  GSY C     CRPG  L +N   C D++EC+  + +C P   CVN+  S+ CV+  C P  Q                               +C+C  G+   QD +CTD+DEC     D +CG+  +C+N  GSY C    +C PG   +     C+D++EC  G+   P+   CVN  GSYKC+C +GY   +N T C DV+EC L               F     C D         RC NT GS+ C   C  G++ +     +C D+NEC     CG    C N +G+Y C C QGY  +  G  C DI+EC      C +  C NV G + C+C  G    ++E       C + EG  S        R
Sbjct:  704 FDLLNGQCSDIDECRRTPSPCPDGR--CENTAGSFRCSCRTGYRL-QANTCVDVNECEDPSQCPG-QECLNSQGSYRCVSCRP-GFGLR----NGACSDIDECRQTPSPCQNGL-CENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGLRNG--ACSDIDECRQTPDLCVNGRCE------NTMGSYSC----SCRPGFRLEEN--ICKDVNECEN-ELQC-PGMECVNSVGSFKCVS--CKPGFQLLDGQCQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGFHL-QDGVCTDIDECVS---DQVCGAQSVCVNTDGSYRC----DCAPGYRAAGAGRQCRDINECLEGDFCFPRG-ECVNTDGSYKCVCSQGYKSVANGTSCQDVDECALDGVCQDGRCSNTEGSFLYVNECQDSTGLICGSQRCENTIGSFHCVASCEPGYQITS--TAECVDVNECANETVCGAHAFCQNLIGTYHCLCDQGYESTGDGKICVDINECEAMQGVCGSARCWNVEGSFTCECENG----QEEFDPIAGRCLSREGTASASRSLPQSR 1245          

HSP 4 Score: 178.718 bits (452), Expect = 6.321e-45
Identity = 195/599 (32.55%), Postives = 259/599 (43.24%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRC-DCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC---------------EDDECPINMKRNNKGICS------RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPS-------QQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKC------TDINECLAANPCGKKHQCVNTVGS-YKCKCF--------------QGYRLSISGDTC----------------------------EDIDEC-LLEPRKCLNGICV-NVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            C D+NECE  + C  +   C+N+ GS+RC  C+ GF   + G C DIDEC        + +C+N +GSY C  S   GF  +E    N C DV+ECE   E+  PGM+CVN  GS +C               + DEC    +R   G C       RC     F  +   C DIDEC  +       C    VC N  GSY C     C PG   A  G  C DI+EC +  F C P   CVNT  SY CV S    S       Q  D      +C+DG   N +     V+EC ++ G  +CGS   C N  GS+ C+  A C PG ++ +  + C DV+EC   E  C  +  C N++G+Y C+CD+GY  T +   C D+NEC   +         ARC N  GS+ C+C  G E  D    +C         +  L  +  G++ +C   +   Y CK                QG+ L    D C                            +D+DEC L +P  C  G CV N+PG Y C C  G   D + + C D DEC  SE  CS       G  C+N  G + C 
Sbjct:  831 CTDVNECEDPSQCPGQE--CLNSQGSYRCVSCRPGFGL-RNGACSDIDECRQTPDLCVNGRCENTMGSYSC--SCRPGFRLEE----NICKDVNECEN--ELQCPGMECVNSVGSFKCVSCKPGFQLLDGQCQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGFHLQDGVCTDIDECVSDQ-----VCGAQSVCVNTDGSYRC----DCAPGYRAAGAGRQCRDINECLEGDF-CFPRGECVNTDGSYKCVCSQGYKSVANGTSCQDVDECALDGVCQDGRCSNTEGSFLYVNECQDSTG-LICGSQR-CENTIGSFHCV--ASCEPG-YQITSTAECVDVNEC-ANETVCGAHAFCQNLIGTYHCLCDQGYESTGDGKICVDINECEAMQGVCG----SARCWNVEGSFTCECENGQEEFDPIAGRCLSREGTASASRSLPQSRPGEQKECYYGISQPYSCKILAVNTTLQECCCTAGQGWGLMCKYDICPEAGTAEFQTLCPNGKGYVTTEAGAFNYKDVDECKLFDPEVCKGGTCVNNIPG-YACYCRSGSYYDTELLECTDNDECE-SEDTCS-------GGRCVNTQGTFYCT 1389          

HSP 5 Score: 174.481 bits (441), Expect = 1.275e-43
Identity = 179/525 (34.10%), Postives = 232/525 (44.19%), Query Frame = 3
Query: 1266 GSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC----------------EDDECP------INMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNE--------------------CLLFRP-----EESCPDLE-----------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC-KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            G + C+    C  G+  +P    C D +EC   P  C  G +CVN  GS RC                + DEC       IN +  N     RC     +K +  SC DIDEC   +     RC   + C N  GSY C+    CRPG  L  NG  C+DIDEC++    C PD  C NT  S+                  +C CR GYR  Q + C DV+EC +    + C     C+N  GSY C+    C PG    +    C D+DEC      C QN  C N +GS++C+C  GY L    TC DVNE                    C+  RP       +C D++            RC NT GSY C C  GF   +     C D+NEC     C    +CVN+VGS+KC  C  G++L + G  C+D+DEC   PR+C NG C N PG + C C  GF   +  +C DIDEC  S+ VC  +S      +C+N  G Y+C    C  GY     G
Sbjct:  570 GRHTCV----CNTGFILNPQQGHCQDKNECVLTPRPCSVG-ECVNTPGSFRCVCPAGYQTNSQQTLCVDLDECRQVPNPCINGRCENTLGSFRCVCRTGYKLQDNSCIDIDECVDPL-----RCPGKE-CVNSQGSYRCV---SCRPGFDLL-NG-QCSDIDECRRTPSPC-PDGRCENTAGSF------------------RCSCRTGYRL-QANTCVDVNECED---PSQCPGQE-CLNSQGSYRCV---SCRPGFGLRN--GACSDIDECRQTPSPC-QNGLCENTLGSFRCVCRTGYRL-QGGTCTDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGLRNGACSDIDECRQTPDLCVNGRCENTMGSYSCSCRPGFRLEE---NICKDVNECENELQC-PGMECVNSVGSFKCVSCKPGFQL-LDGQ-CQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGFHL-QDGVCTDIDEC-VSDQVCGAQS------VCVNTDGSYRC---DCAPGYRAAGAG 1030          

HSP 6 Score: 144.821 bits (364), Expect = 1.793e-34
Identity = 162/559 (28.98%), Postives = 217/559 (38.82%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRC-DCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQ----MKFRCEPDE--------------------ICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY---------ILTSNNTCADVNECLLFRPEE------------SCPDLEA-----RCVNTAGS------------------YKCQCP--KGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD 2501
            GF   +   IC D+NECE    C      CVN+VGSF+C  C+ GF+    G C+D+DEC        + +CKN  GS++C+  +  GF  ++      C D+DEC +  ++CG    CVN  GS+RC+                  C  G+      R C DI+EC          C     C N  GSY C+    C  G     NG +C D+DEC         RC   E                     C NT  S+HCVAS                C  GY+    + C DV+ECA    + +CG+   C N  G+Y C+    C  G   +     C D++ECE  +G C  +  C NV GS+ C C+ G           L+   T +        RP E            SC  L        C  TAG                   ++  CP  KG+  ++       D++EC   +P   K   CVN +  Y C C  G         C D DEC  E   C  G CVN  G + C C P    D
Sbjct:  903 GFRLEE--NICKDVNECENELQCPGME--CVNSVGSFKCVSCKPGFQLLD-GQCQDVDECSRTPRRCTNGQCKNTPGSFRCVCDV--GFHLQD----GVCTDIDECVS-DQVCGAQSVCVNTDGSYRCD------------------CAPGYRAAGAGRQCRDINEC-----LEGDFCFPRGECVNTDGSYKCV----CSQGYKSVANGTSCQDVDECALDGVCQDGRCSNTEGSFLYVNECQDSTGLICGSQRCENTIGSFHCVAS----------------CEPGYQITSTAECVDVNECAN---ETVCGAHAFCQNLIGTYHCL----CDQGYESTGDGKICVDINECEAMQGVC-GSARCWNVEGSFTCECENGQEEFDPIAGRCLSREGTASASRSLPQSRPGEQKECYYGISQPYSCKILAVNTTLQECCCTAGQGWGLMCKYDICPEAGTAEFQTLCPNGKGYVTTEAGAFNYKDVDECKLFDPEVCKGGTCVNNIPGYACYCRSGSYYDTELLECTDNDECESE-DTCSGGRCVNTQGTFYCTCEPPLVLD 1397          

HSP 7 Score: 72.4034 bits (176), Expect = 2.882e-12
Identity = 56/156 (35.90%), Postives = 74/156 (47.44%), Query Frame = 3
Query: 2184 ARCVNT-AGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
             RC++   G + C C  GF  +      C D NEC L   PC    +CVNT GS++C C  GY+ +     C D+DEC   P  C+NG C N  G + C C  G+   +   C DIDEC               G+ C+N  G Y+CV  SC  G+
Sbjct:  562 GRCIDLPGGRHTCVCNTGFILNPQQ-GHCQDKNECVLTPRPC-SVGECVNTPGSFRCVCPAGYQTNSQQTLCVDLDECRQVPNPCINGRCENTLGSFRCVCRTGYKL-QDNSCIDIDECVDPLRC--------PGKECVNSQGSYRCV--SCRPGF 704          

HSP 8 Score: 53.9138 bits (128), Expect = 1.175e-6
Identity = 31/80 (38.75%), Postives = 42/80 (52.50%), Query Frame = 3
Query: 2286 LAANPCG-----KKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR-KCLNGICVNVPGRYECKCPPGFAADRK 2507
            L++  CG     +  +C+     Y C C+ GY+L I+  TC D+DEC  E    C+NG CVN  G Y C C  GF   R+
Sbjct: 1592 LSSEECGIVRGCENGRCIRVEEGYTCDCYDGYQLDITTMTCIDVDECEDEDSLDCINGRCVNTEGSYRCVCLRGFILSRR 1671          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: si:dkey-30j22.1 (si:dkey-30j22.1 [Source:ZFIN;Acc:ZDB-GENE-041001-184])

HSP 1 Score: 218.394 bits (555), Expect = 3.849e-57
Identity = 187/591 (31.64%), Postives = 252/591 (42.64%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-------CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWK-EDPD-----TNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDC---IPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQ-------NQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSI------SGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            + C DI+EC  +      +  C N +GS+ C C  GF    L +       C+D+DEC+ + ++C  +  C N +GS+ C     C  G+   DP+      N C D+DEC   P +CGP   C N  GS+ C                   C DGF    +        +C DIDEC  +       C     C N  GSY+C          P   ++ N   C D+DEC +M   C P+ IC NT  SY+                  C C  GY         N  + CTD+DEC      ++CG    C N  GSY  +C+            S  + C+DV+EC      C  N  C N +GSY C C  GY ++       S+NTC D+NECL   P        + C N  GSY C C  GF  ++  I       C D++EC+  ++ CG    C NT+GSY C C  GY +S       S +TC DIDECL  P  C     C N  G Y C C  GF A    +       C+D+DEC  S  +C  +S+      C N +G Y C   SC  G+T   +
Sbjct: 6702 QFCQDIDECLDSPPVCGPYSNCTNQLGSYNCSCLDGFTAENLNLTVSINNTCKDVDECVEMSDVCGPNSICNNTIGSHNC----SCLSGYNVSDPNLPIHSNNTCTDIDECLFSPPVCGPYSNCTNEIGSYNC------------------SCLDGFTATNQNLTISINNTCLDIDECLFSP----SVCGPNSNCTNEIGSYNCSCLSGFTTTNPNLTISINN-TCRDVDECVEMSDVCGPNSICNNTIGSYN------------------CSCMSGYNVTDPNLPINSSNTCTDIDECLF--SPSICGPDSNCTNDIGSYNCSCLSGFTATNSNLTISNDNTCRDVNECVEMSDICGPNSICNNTIGSYNCSCMSGYNVSDPNLPINSSNTCTDINECLFSAPVCG---PNSNCTNEIGSYNCSCLSGFTATNPNITISNNNTCRDVDECVEMSDVCGPNSICNNTIGSYNCSCMSGYNVSDPNLPINSNNTCTDIDECLFSPSVCGPYSNCTNEIGSYNCSCLSGFTATNSNLTISNDNTCRDVDECLFSPSICGPDSN------CTNDIGSYNC---SCLSGFTATNS 7233          

HSP 2 Score: 209.92 bits (533), Expect = 1.693e-54
Identity = 188/583 (32.25%), Postives = 253/583 (43.40%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-------CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFK------KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA------CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECLAA-NPCGKKHQCVNTVGSYKCKCFQGY-----RLSIS-GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAA-------DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            C D+NEC   +       IC NT+GS+ C C+ G+  +   +       C DI+EC+ +  IC     C N +GSY C  S   GF       T    N C DVDEC     +CGP   C N  GS+ C                   C+ G+             +C DI+EC  +       C     C N  GSY+C     C  G   A + +       C D++EC +M   C P+ IC NT  SY+C       S    Y+V           N ++ CTD++EC  +    +CG    C N  GSY  +C+            S+ + C+DVDEC    G C  N +C N +GSY C C  GY ++       SNNTC D+NEC LF P    P+  + C N  GSY C C  GF  ++  +       C DINECL   + CG    C N +GSY C C  G+      L+IS  +TC D+DEC+     C  N IC N  G Y C C  G+         +R   C DI+EC  S  +C   S+      C N +G + C   SC  G+T   +
Sbjct: 8168 CRDVNECVEMSEICGPNSICNNTIGSYNCSCRSGYNVTDPNLPINSNNTCTDINECLFSPPICGPYSNCTNEIGSYNC--SCLSGFTATNSNFTISINNTCRDVDECVEMSNVCGPNSICNNTIGSYNC------------------SCRSGYNVSDSNLPINSNNTCTDINECLFSPLI----CGPNSNCTNEIGSYNC----TCLSGFTTANSNLTITINNTCRDVEECVEMSEICGPNSICNNTIGSYNC-------SCMSGYNVSD----PNLPINSNNTCTDINECLFSPP--ICGPYSNCTNEIGSYNCSCLSGFTATNSNITISINNTCRDVDECVEMSGVCGPNSNCNNTIGSYNCSCMSGYNVSDPNLPINSNNTCTDINEC-LFSPSICGPN--SNCTNEIGSYNCSCLSGFTTTNSNLTISINNTCGDINECLIIPSICGPYSNCTNDIGSYNCSCLDGFTATNSNLTISINNTCRDVDECVEMSNICGPNSICNNTIGSYNCSCRSGYNVTDPTLPINRNNTCTDINECLFSPPICGPYSN------CTNEIGSFNC---SCLSGFTATNS 8697          

HSP 3 Score: 208.764 bits (530), Expect = 3.468e-54
Identity = 198/593 (33.39%), Postives = 250/593 (42.16%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFK--HSKLGI-----CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI---PKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-------CTDVDECAENGGDNLCGSLYICINHPGSYACI----QRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDL---EARCVNTAGSYKCQCPKGFEWSD--YPIKK---CTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGY-----RLSIS-GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            C DI+EC  + +    +  C N +GS+ C C  GF   +S L I     C D+DEC+ + +IC  D  C N++GSY C  S   GF       T    N C DVDEC     +CGP   C N  GS+ C         D   PIN                     + +C DIDEC  +       C     C N  GSY+C       K      ++ N I C D+DEC      C P   C N   SY+C                   C DG+     ++       C DVDEC E    ++CG   IC N  GSY C          P  +  S+  + C DVDEC      C  N +C N +GSY C C  G+  T        NNTC DV+EC+         D+    + C NT GSY C C  G+  S+   PI     CTDINECL + P CG    C N +GSY C C  G+      L+IS  +TCED+DECL  P  C     C N  G Y C C  GF A    +       C+D+DEC     VC   S      +C N +G Y C   SC  GY   +
Sbjct: 7145 CTDIDECLFSPSVCGPYSNCTNEIGSYNCSCLSGFTATNSNLTISNDNTCRDVDECLFSPSICGPDSNCTNDIGSYNC--SCLSGFTATNSNLTISNDNTCRDVDECVELLNVCGPNSICNNTIGSYNCSCMSGYNVTDPNLPIN--------------------SSNTCTDIDECLFSPS----VCGPYSNCTNEIGSYNCSCLDGFTKTNSNLTISINNI-CRDVDECLFTPSICGPYSNCTNEIGSYNC------------------SCLDGFTATNSNLTISINNTCRDVDECVE--MSDVCGPNSICNNTIGSYNCSCMSGYNVSDPNVLINSN--NTCTDVDECLFSPSVCGPNSNCTNKIGSYNCSCLSGFTATDSNLTISINNTCRDVDECVEMS------DICGPNSICNNTIGSYNCSCMSGYNVSEPNLPINSNNTCTDINECLFSPPICGPYSNCTNLIGSYNCSCLSGFTVTNSNLTISINNTCEDVDECLFTPSICGPYSNCTNEIGSYNCSCLSGFTATNPNLTISINNTCRDVDECVEMSDVCGPNS------ICNNTIGSYNC---SCMSGYNVSD 7673          

HSP 4 Score: 206.453 bits (524), Expect = 1.746e-53
Identity = 188/581 (32.36%), Postives = 249/581 (42.86%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-------CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDC--IPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGY-----RLSISGD-TCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAA-------DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            C DI+EC  +      +  C N +GS+ C C  GF  +   +       C DIDEC+ + ++C  +  C N +GSY C  S   GF       T    N C DVDEC    ++CGP   C N  GS+ C         D   PIN                     + +C DIDEC  +       C     C N  GSY+C  +         +   N   C D++EC +M   C P+ IC NT  SY+C       S    Y+V           N  + CTD++EC  +    +CG    C N  GSY  +C+            S  + C+DVDEC      C  N  C N +GSY C C  GY ++       SNNTC D++EC LF P    P   + C N  GSY C C  GF  ++  +       C D++ECL + + CG    C N +GSY C C  G+      L+IS D TC D+DEC+     C  N IC N  G Y C C  G+         +    C DIDEC  S  VC   S+      C N +G Y C   SC  G+TK  +
Sbjct: 6802 CTDIDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTATNQNLTISINNTCLDIDECLFSPSVCGPNSNCTNEIGSYNC--SCLSGFTTTNPNLTISINNTCRDVDECVEMSDVCGPNSICNNTIGSYNCSCMSGYNVTDPNLPIN--------------------SSNTCTDIDECLFSPSI----CGPDSNCTNDIGSYNCSCLSGFTATNSNLTISNDNTCRDVNECVEMSDICGPNSICNNTIGSYNC-------SCMSGYNVSD----PNLPINSSNTCTDINECLFSAP--VCGPNSNCTNEIGSYNCSCLSGFTATNPNITISNNNTCRDVDECVEMSDVCGPNSICNNTIGSYNCSCMSGYNVSDPNLPINSNNTCTDIDEC-LFSPSVCGP--YSNCTNEIGSYNCSCLSGFTATNSNLTISNDNTCRDVDECLFSPSICGPDSNCTNDIGSYNCSCLSGFTATNSNLTISNDNTCRDVDECVELLNVCGPNSICNNTIGSYNCSCMSGYNVTDPNLPINSSNTCTDIDECLFSPSVCGPYSN------CTNEIGSYNC---SCLDGFTKTNS 7331          

HSP 5 Score: 206.453 bits (524), Expect = 1.762e-53
Identity = 186/586 (31.74%), Postives = 250/586 (42.66%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWK-EDPDT-----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI------ACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGY-----RLSI-SGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            IC D++EC    +    +  C N +GS+ C C  GF   +S L I     C D+DEC+ + ++C  +  C N +GSY C     C  G+   DP+      N C DVDEC   P +CGP   C N  GS+ C                   C  GF             +C D+DEC       +  C    +C N  GSY+C     C  G  +++  +       C DI+EC      C P   C N   SY+C               G  +       + ++ C DVDEC      ++CG    C N  GSY  +C+            S+ + C+DVDEC      C  N  C N +GSY C C  GY ++       SNNTC D+NEC LF P    P   + C N  GSY C C  GF  ++  +       C D++EC+  ++ CG    C NT+GSY C C  GY      L I S + C+DIDECL  P  C     C N  G Y C C  G+ A    +       C+DIDEC  S  +C   S+      C N +G Y C   SC  G+T   +
Sbjct: 7340 ICRDVDECLFTPSICGPYSNCTNEIGSYNCSCLDGFTATNSNLTISINNTCRDVDECVEMSDVCGPNSICNNTIGSYNC----SCMSGYNVSDPNVLINSNNTCTDVDECLFSPSVCGPNSNCTNKIGSYNC------------------SCLSGFTATDSNLTISINNTCRDVDECVE----MSDICGPNSICNNTIGSYNC----SCMSGYNVSEPNLPINSNNTCTDINECLFSPPICGPYSNCTNLIGSYNCSCLS-----------GFTVTNSNLTISINNTCEDVDECLFT--PSICGPYSNCTNEIGSYNCSCLSGFTATNPNLTISINNTCRDVDECVEMSDVCGPNSICNNTIGSYNCSCMSGYNVSDPNLPINSNNTCTDINEC-LFSPSICGP--YSNCTNEIGSYNCSCLSGFTTTNSNLTISINNTCRDVDECVEMSDVCGPNSICNNTIGSYNCSCMSGYNETDPNLPINSNNMCKDIDECLFSPSICGPYSNCTNEIGSYNCSCLDGYTASNSNLTISINNTCEDIDECLFSPSICGPYSN------CTNEVGSYNC---SCLSGFTTTNS 7870          

HSP 6 Score: 205.682 bits (522), Expect = 3.450e-53
Identity = 189/588 (32.14%), Postives = 248/588 (42.18%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFK--HSKLGI-----CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKET------RSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA------CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQ-------NQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWS-----DYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSI------SGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAAD-------RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKK 2654
            C DINEC  + +       C N +GS+ C C  GF   +S L I     C DI+EC+ + +IC     C N++GSY C  S   GF       T    N C DVDEC     ICGP   C N  GS+ C                   C+ G+     T       +C DI+EC  +       C     C N  GS++C     C  G     + I       C D+DEC +M   C P+ IC NT  SY+C                   CR GY         N ++ CTD++EC      ++CG    C N  GSY  +C+            S+ + C DVDEC      C  N +C N +GSY C C  GY ++       SNNTC DV+EC  F P    P+  + C N  GS+ C C  GF  +           C D++EC+  +N CG    C NT+GSY C C  GY +S       S +TC D+DECL  P  C     C N  G + C C  GF              C+D++EC  S  VC   S+      C N +G + C   SC  G+T  
Sbjct: 8511 CTDINECLFSPSICGPNSNCTNEIGSYNCSCLSGFTTTNSNLTISINNTCGDINECLIIPSICGPYSNCTNDIGSYNC--SCLDGFTATNSNLTISINNTCRDVDECVEMSNICGPNSICNNTIGSYNC------------------SCRSGYNVTDPTLPINRNNTCTDINECLFSPPI----CGPYSNCTNEIGSFNC----SCLSGFTATNSNITISINNTCRDVDECVEMSNVCGPNSICNNTIGSYNC------------------SCRSGYNVSDPNLPINSNNTCTDINECLF--SPSICGPNSNCTNEIGSYNCSCLSGFTTANPNLTISINNTCGDVDECVEMSNVCGPNSNCSNTIGSYNCSCRSGYNVSDPNLPINSNNTCTDVDEC-WFSPSVCGPN--SNCTNAIGSFNCSCLSGFTTTNSSLNISNNNICRDVDECVEMSNVCGPNSNCSNTIGSYNCSCRSGYNVSDPNLPINSNNTCTDVDECLFSPSICGPYSNCTNEIGSFNCSCLSGFTTTNSSLNFSNNNTCRDVNECLFSPSVCGPNSN------CTNEIGSFNC---SCLSGFTTT 9038          

HSP 7 Score: 202.216 bits (513), Expect = 3.862e-52
Identity = 195/604 (32.28%), Postives = 257/604 (42.55%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKH--SKLGI-----CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP----DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKET------RSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI---PKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-------ILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGY-----RLSISGD-TCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAA----DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE----------LKSESICEPN 2711
            C D++EC  + +       C N +GS+ C C  GF    S L I     C D+DEC+ + +IC  +  C N +GSY C  S   G+   E        N C D++EC   P ICGP   C N+ GS+ C                   C  GF             +CED+DEC          C     C N  GSY+C          P   ++ N   C D+DEC +M   C P+ IC NT  SY+C       S    Y+V           N ++ CTD++EC      ++CG    C N  GSY  +C+            S+ + C+DVDEC      C  N  C N +GSY C C  GY        + SNN C D++EC LF P    P   + C N  GSY C C  G+  S+  +       C DI+ECL + + CG    C N VGSY C C  G+      L+IS D TC D++EC+     C  N +C N  G Y C C  G+ A         C+DI EC  SE VC   S       C N  G + C    C  GY   + GN  I +          L + S+C PN
Sbjct: 7439 CTDVDECLFSPSVCGPNSNCTNKIGSYNCSCLSGFTATDSNLTISINNTCRDVDECVEMSDICGPNSICNNTIGSYNC--SCMSGYNVSEPNLPINSNNTCTDINECLFSPPICGPYSNCTNLIGSYNC------------------SCLSGFTVTNSNLTISINNTCEDVDECLFTPSI----CGPYSNCTNEIGSYNCSCLSGFTATNPNLTISINN-TCRDVDECVEMSDVCGPNSICNNTIGSYNC-------SCMSGYNVSD----PNLPINSNNTCTDINECLF--SPSICGPYSNCTNEIGSYNCSCLSGFTTTNSNLTISINNTCRDVDECVEMSDVCGPNSICNNTIGSYNCSCMSGYNETDPNLPINSNNMCKDIDEC-LFSPSICGP--YSNCTNEIGSYNCSCLDGYTASNSNLTISINNTCEDIDECLFSPSICGPYSNCTNEVGSYNCSCLSGFTTTNSSLTISIDNTCRDVNECVEMSDICGPNSMCNNTIGSYNCSCLSGYNATDPISSSNPCRDIYECLDSESVCGPNS------YCYNYNGSFSCF---CWEGYNVTD-GNKDISKSNQCIDIDECLFNSSVCGPN 7991          

HSP 8 Score: 195.667 bits (496), Expect = 5.163e-50
Identity = 190/609 (31.20%), Postives = 250/609 (41.05%), Query Frame = 3
Query: 1071 CGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-------CEDIDECM-NVNICSDDKKCKNNVGSY--KCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFK------KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI------ACNDIDECKQMKFRCEPDEICVNTYSSYHC-----------------------------VASPCAPSQQFDYSVGK--CMCRDGYRQN-------QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN--CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            C D++EC E +N C      C NT+GS+ C C+ G+  S   +       C D+DEC+ + +IC     C N +GS+   C+             + N C DV+EC   P +CGP   C N  GS  C                   C  GF              C D+DEC       +  C     C N  GSY+C     C  G  ++   +       C DI+EC      C P+  C N   SY+C                               S C P+     ++G   C C  G+           ++IC DVDEC E    N+CG    C N  GSY C  R+          + SN  C DVDEC      C  N +C N +GSY C C  GY ++       SNNTC D+NEC LF P    P+  + C N  GSY C C  GF  ++  +       C D++EC+  +N CG    C NT+GSY C C  GY +S       S +TC D+DECLL P  C  N  C N  G Y C C  GF  +      +++EC     VC   S      +C N +G Y C   SC  G T
Sbjct: 8903 CRDVDECVEMSNVCGPNSN-CSNTIGSYNCSCRSGYNVSDPNLPINSNNTCTDVDECLFSPSICGPYSNCTNEIGSFNCSCLSGFTTTNSSLNFSNNNTCRDVNECLFSPSVCGPNSNCTNEIGSFNC------------------SCLSGFTTTNSSLNISNNNICRDVDECVE----MSNVCGPNSNCSNTIGSYNC----SCMSGYNVSDPNLPINSNNTCTDINECLFSPSICGPNSNCTNLIGSYNCSCLSGFTATNSNLTISVSNTCRDVDECWFSPSVCGPNSNCTNAIGSFNCSCLSGFTTTNSSLNISNNNICRDVDECVE--MSNVCGPNSNCSNTIGSYNCSCRSGYNVSDPNLPINSNNTCTDVDECVEMSNVCGPNSNCSNTIGSYNCSCMSGYNVSDPNLPINSNNTCTDINEC-LFSPSICGPN--SNCTNLIGSYNCSCLSGFTATNSNLTISISNTCRDVDECVEMSNVCGPNSNCSNTIGSYNCSCMSGYNVSEPNLPINSSNTCTDVDECLLSPSVCGPNSNCTNAIGSYNCSCLSGFTTN-----SNVNECFEMSDVCGPNS------ICNNTIGSYNC---SCLSGST 9465          

HSP 9 Score: 192.971 bits (489), Expect = 3.391e-49
Identity = 186/585 (31.79%), Postives = 238/585 (40.68%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-------CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRS---CEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI--PKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-------CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN---CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-------ILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFE--WSDYPIK---KCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSI------SGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            +C DI+EC  + +    +  C N +GS+ C C  G+  S   +       CEDIDEC+ + +IC     C N VGSY C  S   GF       T    N C DV+EC    +ICGP   C N  GS+ C                   C  G+       S   C DI EC  +       C     C+N  GS+ C          G         C DIDEC      C P+  C N    Y+C                   C DG+     S+       C DV+EC E    ++CG   +C N  GSY C     C  G   +   S+   C+D+ EC   E  C  N +C N  GS+ C C  GY        +T NN C D+NEC LF P    P+  + C N  G Y C C  GF    S+  I     C D+NEC+  +  CG    C NT+GSY C C  GY ++       S +TC DI+ECL  P  C     C N  G Y C C  GF A            C+D+DEC     VC   S      +C N +G Y C   SC  GY   ++
Sbjct: 7781 MCKDIDECLFSPSICGPYSNCTNEIGSYNCSCLDGYTASNSNLTISINNTCEDIDECLFSPSICGPYSNCTNEVGSYNC--SCLSGFTTTNSSLTISIDNTCRDVNECVEMSDICGPNSMCNNTIGSYNC------------------SCLSGYNATDPISSSNPCRDIYECLDS----ESVCGPNSYCYNYNGSFSCFCWEGYNVTDGNKDISKSNQCIDIDECLFNSSVCGPNSNCTNVIGGYNC------------------SCLDGFTATNLSLTINISNTCKDVNECVE--MSDICGPNSMCNNTIGSYNC----SCLSGYNATDPISSSNPCRDIYECLDSESVCGPNSNCYNYNGSFSCFCWEGYNVTDGNKAVTKNNPCIDINEC-LFSPPVCGPN--SNCTNDIGMYNCSCLDGFTAIISNLTISINNTCRDVNECVEMSEICGPNSICNNTIGSYNCSCRSGYNVTDPNLPINSNNTCTDINECLFSPPICGPYSNCTNEIGSYNCSCLSGFTATNSNFTISINNTCRDVDECVEMSNVCGPNS------ICNNTIGSYNC---SCRSGYNVSDS 8305          

HSP 10 Score: 187.193 bits (474), Expect = 2.033e-47
Identity = 184/628 (29.30%), Postives = 242/628 (38.54%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-------ICEDIDECM-NVNICSDDKKCKNNVGSY--KCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFK------KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA------CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-------CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN--CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRK--------------EICQD----------------------------------IDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            C D++EC  + +    +  C N +GSF C C  GF  +           C D++EC+ + ++C  +  C N +GS+   C+             + N C DVDEC     +CGP   C N  GS+ C                   C  G+             +C DI+EC  +       C     C NL GSY+C     C  G     + +       C D+DEC      C P+  C N   S++C                   C  G+     S+       C DVDEC E    N+CG    C N  GSY C  R+          + SN  C DVDEC      C  N +C N +GSY C C  GY ++       SNNTC D+NECL F P    P+  + C N  GSY C C  GF  ++  +       C D++EC+  +N CG    C NT+GSY C C  GY +S       S +TC D+DECLL P  C  N  C N  G Y C C  GF  +                 IC +                                  IDEC  S  VC   S       C N +G Y C   SC  GY   +
Sbjct: 8952 CTDVDECLFSPSICGPYSNCTNEIGSFNCSCLSGFTTTNSSLNFSNNNTCRDVNECLFSPSVCGPNSNCTNEIGSFNCSCLSGFTTTNSSLNISNNNICRDVDECVEMSNVCGPNSNCSNTIGSYNC------------------SCMSGYNVSDPNLPINSNNTCTDINECLFSPSI----CGPNSNCTNLIGSYNC----SCLSGFTATNSNLTISVSNTCRDVDECWFSPSVCGPNSNCTNAIGSFNC------------------SCLSGFTTTNSSLNISNNNICRDVDECVE--MSNVCGPNSNCSNTIGSYNCSCRSGYNVSDPNLPINSNNTCTDVDECVEMSNVCGPNSNCSNTIGSYNCSCMSGYNVSDPNLPINSNNTCTDINECL-FSPSICGPN--SNCTNLIGSYNCSCLSGFTATNSNLTISISNTCRDVDECVEMSNVCGPNSNCSNTIGSYNCSCMSGYNVSEPNLPINSSNTCTDVDECLLSPSVCGPNSNCTNAIGSYNCSCLSGFTTNSNVNECFEMSDVCGPNSICNNTIGSYNCSCLSGSTDVFNYFVRNLFIQYLNLTLNIDECLFSPSVCGPNS------TCNNTIGSYNC---SCMSGYNVTD 9521          

HSP 11 Score: 181.415 bits (459), Expect = 1.468e-45
Identity = 177/596 (29.70%), Postives = 238/596 (39.93%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDK-----KCKN------------------NVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYD--CIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-------CTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSI------SGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            C D+NEC  ++        C N++GSF C C   F  +     + +      N+CS ++     KC+                     GS  CI  +P         D   C D+DEC   P +CGP   C N  GS+ C                   C DGF  +          +C+D+DEC       +  C    +C N  GS++  C+         +   +   C DIDEC      C P   C N   SY+                  C C DG+     ++       C D+DEC      ++CG    C N  GSY  +C+            S+ + C+DVDEC      C  N  C N +GSY C C  GY +T       S+NTC D++EC LF P    PD  + C N  GSY C C  GF  ++  +       C D+NEC+  ++ CG    C NT+GSY C C  GY +S       S +TC DI+ECL     C  N  C N  G Y C C  GF A    I       C+D+DEC     VC   S      +C N +G Y C   SC  GY   +
Sbjct: 6603 CEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRN--QPVSNSNPCNVCSLNETRYQCKCEGLFAWPNDTCHAYDACDVITNGSCTCINGLP--------ADGQFCQDIDECLDSPPVCGPYSNCTNQLGSYNC------------------SCLDGFTAENLNLTVSINNTCKDVDECVE----MSDVCGPNSICNNTIGSHNCSCLSGYNVSDPNLPIHSNNTCTDIDECLFSPPVCGPYSNCTNEIGSYN------------------CSCLDGFTATNQNLTISINNTCLDIDECLF--SPSVCGPNSNCTNEIGSYNCSCLSGFTTTNPNLTISINNTCRDVDECVEMSDVCGPNSICNNTIGSYNCSCMSGYNVTDPNLPINSSNTCTDIDEC-LFSPSICGPD--SNCTNDIGSYNCSCLSGFTATNSNLTISNDNTCRDVNECVEMSDICGPNSICNNTIGSYNCSCMSGYNVSDPNLPINSSNTCTDINECLFSAPVCGPNSNCTNEIGSYNCSCLSGFTATNPNITISNNNTCRDVDECVEMSDVCGPNS------ICNNTIGSYNC---SCMSGYNVSD 7134          

HSP 12 Score: 170.244 bits (430), Expect = 4.091e-42
Identity = 176/563 (31.26%), Postives = 230/563 (40.85%), Query Frame = 3
Query: 1203 DIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETR---SCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC-----------------------------VASPCAPSQQFDYSVGK--CMCRDGYRQ-------NQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKK---CTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGY-----RLSISGD-TCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAA-------DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKK 2654
            DIDEC+ +  +C     C N +GSY C  S   GF  +    +    N C DV+EC    E+CGP   C N  GS  C          RN    N   C+ C        ETR    CE +        W N  C   D C       D I    C     L  +G  C DIDEC      C P   C N   SY+C                             ++  C P+   + ++G   C C  GY         + ++ CTD+DEC  +    +CG    C N  GSY  +C+            S+ + C D+DEC      C  N +C N +GSY C C  G+  T+       NNTC DV+EC+     + C    + C NT GSY C C  G+  +D   PI     CTDI+ECL + + CG    C N +GSY C C  G+      L+IS D TC D++EC+     C  N IC N  G Y C C  G+         +    C DI+EC  S  VC   S+      C N +G Y C   SC  G+T  
Sbjct: 6556 DIDECLFSPPVCGPYSNCTNKLGSYNC--SCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCS-----LNETRYQCKCEGL------FAWPNDTCHAYDAC-------DVITNGSCTCINGLPADGQFCQDIDECLDSPPVCGPYSNCTNQLGSYNCSCLDGFTAENLNLTVSINNTCKDVDECVEMSDVCGPNSICNNTIGSHNCSCLSGYNVSDPNLPIHSNNTCTDIDECLFSPP--VCGPYSNCTNEIGSYNCSCLDGFTATNQNLTISINNTCLDIDECLFSPSVCGPNSNCTNEIGSYNCSCLSGFTTTNPNLTISINNTCRDVDECV--EMSDVCGP-NSICNNTIGSYNCSCMSGYNVTDPNLPINSSNTCTDIDECLFSPSICGPDSNCTNDIGSYNCSCLSGFTATNSNLTISNDNTCRDVNECVEMSDICGPNSICNNTIGSYNCSCMSGYNVSDPNLPINSSNTCTDINECLFSAPVCGPNSN------CTNEIGSYNC---SCLSGFTAT 7084          

HSP 13 Score: 152.525 bits (384), Expect = 1.242e-36
Identity = 177/635 (27.87%), Postives = 238/635 (37.48%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGS-----------------------YKCQCPKGFEWSDYPIKKCT----------------------------DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSIS------GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            DINECE A +   ++  C N +G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C  S   GF  +    +    N C DV+EC    E+CGP   C N  GS  C          RN    N   C+ C     F +    C+    C     W N  C   D C       D I    C     L  +G  C+DI+EC+     C     C N    Y                   C C +G+   N+DS       C D DEC  +    +CG    C N  GSY  +C+         F  S+ + C+DV+EC      C  N +C+N +GS+ C C   + +T  N   ++ N C                L   P ++C    A  V T GS                       Y+C+C     W   P   C                             DINEC  AA+ CG+   C N +G Y C C+ G+ +S         ++C DIDECL  P  C     C N  G Y C C  GF A    +       C+D++EC  S  VC   S       CIN +G + C   SC   +T  +
Sbjct: 2940 DINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSYKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNKLGSYNC--SCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCFNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCS----FNETRYQCK----CEGLFVWPNDTCHAYDAC-------DVITNGSCTCINGLPADGQFCHDINECEDAASVCGQYSDCTNRIGGY------------------MCSCWNGFNVSNEDSPVSVNNSCHDKDECLFSPP--VCGPYSNCTNELGSYNCSCLDGFTAINSSFSVSINNTCEDVNECLKSSEVCGPNSYCINSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYVACDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVW---PSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSYKDSPVSVNNSCRDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSH------CINSIGSFNC---SCLSAFTVTD 3525          

HSP 14 Score: 147.902 bits (372), Expect = 2.830e-35
Identity = 175/632 (27.69%), Postives = 236/632 (37.34%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCA-DVNEC----------------LLFRPEESCPDLEARCVNTAGS-----------------------YKCQCPKGFEWSDYPIKKCT-------------------------DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAA-------DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            DINECE A +   ++  C N +G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C  S   GF  +    +    N C DV+EC    E+CGP   C N  GS  C          RN    N   C+ C       +    C+    C     W N  C   D C       D I    C     L  +G  C DI+EC+     C     C N+   Y                   C C +G+   N+DS       C D+DEC  +    +CG    C N  GSY  +C+            S+ + C+DV+EC      C  N HC+N +GS+ C C   + +T  N  A + N C                L   P ++C   +A  V T GS                       Y+C+C     WS    K                            DINEC  AA+ CG+   C N++G Y C C+ G+ +S         ++C D DECL  P  C     C N  G Y C C  GF A            C+D++EC  S  VC   S       C N +G + C   SC   +T  +
Sbjct: 5406 DINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNC--SCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCS----LNETQYQCK----CEGLFVWPNDTCHAYDAC-------DVITNGSCTCINGLPADGQFCQDINECEDAASVCGQYSDCTNSIGGY------------------MCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPP--VCGPYSNCTNELGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPASNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPANGQFCQVCGLNGTEYECKCEVDHVWSSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECENAASVCGQYSDCTNSIGGYLCSCWNGFNISNKDSPVSVNNSCHDKDECLFSPPVCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISNNNTCEDVNECLKSSEVCGPNSH------CNNSIGSFNC---SCLSAFTVTD 5991          

HSP 15 Score: 144.821 bits (364), Expect = 2.988e-34
Identity = 171/625 (27.36%), Postives = 236/625 (37.76%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETR---SCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTY--SSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEA---------------------------------------RCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKK 2654
            DINECE A +   ++  C N++G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C  S   GF  +    +    N C DV+EC    E+CGP  +C N  GS  C          RN    N   C+ C        ETR    CE +        W N  C   D C       D I    C     L  +G  C  +     +       ++ +  Y  +    ++ P   S   + +                + TD+DEC  +    +CG    C N  GSY  +C+            S+ + C+DV+EC      C  N HC N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A                                        C N  GSY C C  GF   +  +       C D++EC+  ++ CG    C NT+GS+ C C  GY +S       S +TC DIDECL  P  C     C N  G Y C C  GF A  + +       C DIDEC  S  VC   S+      C N +G Y C   SC  G+T  
Sbjct: 6308 DINECEDAASVCGQYSNCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNEIGSYNC--SCLDGFTARNSSLSISFNNTCEDVNECLKSSEVCGPNSRCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCS-----LNETRYQCKCEGL------FVWPNDTCHAYDAC-------DVITNGSCTCINGLPADGQFCQVLSSKYVIDIDVRFFDMFLVDYLRNVVRNISLPLTLSSSTNIT-------------DIDMNTDIDECLFSPP--VCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFAWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQDIDECLDSPPVCGPYSNCTNQLGSYNCSCLDGFTAENLNLTVSINNTCKDVDECVEMSDVCGPNSICNNTIGSHNCSCLSGYNVSDPNLPIHSNNTCTDIDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTATNQNLTISINNTCLDIDECLFSPSVCGPNSN------CTNEIGSYNC---SCLSGFTTT 6888          

HSP 16 Score: 140.198 bits (352), Expect = 6.323e-33
Identity = 182/678 (26.84%), Postives = 252/678 (37.17%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICS--------RCKDGFYFKKET------------RSCEDID---------------------ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGS-----------------------YKCQCPKGFEWSDYPIKKCT-------------------------DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            DINECE A +   ++  C N +G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C  S   GF  +    +    N C DV+EC    E+CGP   C+N  GS  C         D   P++   N   +CS        +C+  F +  +T             SC  I+                     +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N    Y                   C C +G+   N+DS       C D DEC  +    +CG    C N  GSY  +C+         F  S+ + C+DV+EC      C  N HC N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS                       Y+C+C     WS    K                            DINEC  AA+ CG+   C N +G Y C C+ G+ +S         ++C DIDECL  P  C     C N  G Y C C  GF A+   +       C D++EC  S  VC   S       CIN +G + C   SC   +T  +
Sbjct: 3391 DINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSYKDSPVSVNNSCRDIDECLFSPPVCGPYSNCTNELGSYNC--SCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPVS-NSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWPSNTCKAFQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGY------------------MCSCWNGFNVSNEDSPVSVNNSCHDKDECLFSPP--VCGPYSNCTNELGSYNCSCLNGFTAINSSFSVSINNTCEDVNECLKSLEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWSSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTAENSSLSISINNTCADVNECLKSPEVCGPNSH------CINSIGNFNC---SCLSAFTVTD 4029          

HSP 17 Score: 132.88 bits (333), Expect = 1.076e-30
Identity = 160/578 (27.68%), Postives = 226/578 (39.10%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKG-------ICS--------RCKDGFYFKKET------------RSCEDID---------------------ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGF-AADRKE 2510
            + C DINECE A +   ++  C N++G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C  S   GF  +    +    N C DV+EC    E+CGP   C+N  GS  C          RN          +CS        +C+  F +  +T             SC  I+                     +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N+   Y                   C C +G+   N+DS       C D DEC  +    +CG    C N  GSY  +C+            S  + C+DV+EC      C  N HC N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G        + C DINEC  AA+ CG+   C N++G Y C C+ G+ +S         ++C D++ECL     C  N  C N  G + C C   F   DR +
Sbjct: 5601 QFCQDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNC--SCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPASNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPANGQFCQVCGLNGTEYECKCEVDHVWSSNTCKAYQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECENAASVCGQYSDCTNSIGGY------------------LCSCWNGFNISNKDSPVSVNNSCHDKDECLFSPP--VCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISNNNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQRVSNSNPCNVCSLNETRYQCKCEGLFAWPNDTCHAYDACDVITNGS--CTCINGLPAYG---QFCQDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNEDSPVSVNNSCHDVNECLKSSEVCGPNSRCNNSIGSFNCSCLSAFTVTDRNQ 6144          

HSP 18 Score: 132.88 bits (333), Expect = 1.142e-30
Identity = 164/596 (27.52%), Postives = 236/596 (39.60%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTN----DCVDVDE------CEAF----PEICGPGMKC-VNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            + C DI+EC  + +    +  C N +GS+ C C  GF  ++S L I     CED++EC+ +  +C  + +C N++GS+ C          +  P +N    +   ++E      CE       + C     C V   GS  C      IN    +   C  C            C    +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N    Y                   C C +G+   N+DS       C D+DEC  +    +CG    C N  GSY  +C+            S  + C+DV+EC      C  N HC N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G        + C DINEC  AA+ CG+   C N++G Y C C+ G+ +S         ++C DIDECL  P  C     C N  G Y C C  GF A    +       C+D++EC  S  VC   S       CIN +G + C   SC   +T  +
Sbjct: 5199 QFCQDIDECLFSPSVCGPYSNCTNELGSYSCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSRCYNSIGSFNCSCLSAFTITDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHANDACDVITNGSCTC------INGLPADGQFCQVCG----LNGTEYEC----KCEVDHVWPSNTCKAYQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGY------------------MCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPP--VCGPYSNCTNELGSYNCSCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETQYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADG---QFCQDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSH------CINSIGSFNC---SCLSAFTVTD 5739          

HSP 19 Score: 130.954 bits (328), Expect = 4.751e-30
Identity = 179/729 (24.55%), Postives = 262/729 (35.94%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDECM-NVNICSDDKKCKNNVGSYKC---------------IRSIPCG----------------FGWKED-----------------------PDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRS------CEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDEC-----KQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGD-------------NLCGSLYICINHPGSY-ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIK-----KCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS-------------------------------ISGDTCEDIDECLLEPR---KCLNGI-------------------------CVNVPGRYECKCPPGFAADRKE-------ICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF----ICE-----LKSESICEPNDADCLNE 2732
            C DINEC  +      +  C N +GS+ C C  GF  ++S L I     CED++EC+ +  +C  + +C N++GS+ C                 S PC                 F W  D                        D   C D+DEC   P +CGP   C N  GS+ C                   C DGF  +  + S      CED++EC  +    +  C     C+N  GS++C     C     +       ++ + C      + +++C+ + + V    + H      A       + G C C +G   +          C  NG +             N C +  +C +  GS   CIQ       + +       +D++ECE     C Q   C N +G Y C C  G+ +++       NN+C D++EC LF P    P   + C N  GSY C C  GF   +  +       C D+NECL ++  CG    C N++GS+ C C   + ++                                  DTC   D C +       C+NG+                         C N  G Y C C  GF    K+        C DIDEC  S  VC   S+      C N LG Y C   SC  G+T + +         CE     LKS  +C PN + C+N 
Sbjct: 5051 CHDINECLFSPPVCGPYSNCTNELGSYNCSCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPNSRCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQDIDECLFSPSVCGPYSNCTNELGSYSC------------------SCLDGFTARNSSLSISINNTCEDVNECLKS----SEVCGPNSRCYNSIGSFNC----SCLSAFTITDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCH------ANDACDVITNGSCTCINGLPADGQF----CQVCGLNGTEYECKCEVDHVWPSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQ-------RDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDEC-LFSPPVCGP--YSNCTNELGSYNCSCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETQYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSN------CTNELGSYNC---SCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPN-SHCINS 5723          

HSP 20 Score: 130.954 bits (328), Expect = 4.957e-30
Identity = 133/445 (29.89%), Postives = 177/445 (39.78%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-------CEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWK-EDPD-----TNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFK------KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA------CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-----------NTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAA 2294
            C D++EC  + +       C N +GSF C C  GF  +   +       C D+DEC+ + N+C  +  C N +GSY C     C  G+   DP+      N C DVDEC     +CGP   C N  GS+ C                   C  G+             +C DI+EC  +       C     C NL GSY+C     C  G     + +       C D+DEC +M   C P+  C NT  SY+C       S    Y+V +         N  + CTDVDEC      ++CG    C N  GSY C     C  G   +S      +V+EC      C  N  C N +GSY C C  G     N           N   +++ECL F P    P+  + C NT GSY C C  G+  +D P       N C A 
Sbjct: 9148 CRDVDECWFSPSVCGPNSNCTNAIGSFNCSCLSGFTTTNSSLNISNNNICRDVDECVEMSNVCGPNSNCSNTIGSYNC----SCRSGYNVSDPNLPINSNNTCTDVDECVEMSNVCGPNSNCSNTIGSYNC------------------SCMSGYNVSDPNLPINSNNTCTDINECLFSPSI----CGPNSNCTNLIGSYNC----SCLSGFTATNSNLTISISNTCRDVDECVEMSNVCGPNSNCSNTIGSYNC-------SCMSGYNVSE----PNLPINSSNTCTDVDECLL--SPSVCGPNSNCTNAIGSYNC----SCLSGFTTNS------NVNECFEMSDVCGPNSICNNTIGSYNCSCLSGSTDVFNYFVRNLFIQYLNLTLNIDECL-FSPSVCGPN--STCNNTIGSYNCSCMSGYNVTD-PTLPINSNNTCTAV 9535          

HSP 21 Score: 125.561 bits (314), Expect = 2.269e-28
Identity = 154/533 (28.89%), Postives = 213/533 (39.96%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKC-----IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETR---SCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDID-ECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGK-CMCRDGYRQNQDSICT-DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS------SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINEC---------------LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGF-AADRKE 2510
            DINECE A +   ++  C N +G + C C  GF    + S + +   C D DEC+ +  +C     C N +GSY C       +I   F    +   N C DV+EC    E+CGP   C N  GS  C          RN    N   C+ C        ETR    CE +        W N  C   D C       D I    C     L  +G  C        + + +CE D +    +SS  C A      Q  D  VG  C C       + S+C  D++EC +    ++CG    C N  G Y C     C  G   S      S+ ++C D+DEC      C    +C N +GSY C C  G+        ++ NNTCADVNECL   PE   P+  + C+N+ G++ C C   F  +D   P       N C               +  N     ++  + + +  C C  G  L   G  C+D++ECL  P  C  N  C+N  G + C C   F   DR +
Sbjct: 3643 DINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNEDSPVSVNNSCHDKDECLFSPPVCGPYSNCTNELGSYNCSCLNGFTAINSSFSVSIN---NTCEDVNECLKSLEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCS-----LNETRYQCKCEGL------FVWPNDTCHAYDAC-------DVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHV----WSSNTCKA-----YQVCDSIVGSTCGCIQALPS-EGSLCQRDINECED--AASVCGQYSDCTNRIGGYMC----SCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTAENSSLSISINNTCADVNECLK-SPEVCGPN--SHCINSIGNFNCSCLSAFTVTDRNQPASNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYEACDVITNGSCTCING--LPADGQFCQDVNECLKSPGVCGPNSHCINSNGNFNCSCLSAFTVTDRNQ 4133          

HSP 22 Score: 120.168 bits (300), Expect = 8.967e-27
Identity = 177/637 (27.79%), Postives = 249/637 (39.09%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT------NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDID-ECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGK-CMCRDGYRQNQDSICT-DVDECAENGGDNLCGSLYICINHPGSYAC-------IQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNG---------ICVNVPGRYECKCP-----PGFAADRKEIC----------------------QDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY--TKKETGNGF--ICE-----LKSESICEPNDADCLNE 2732
            DINECE A +   ++  C N +G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C     C  G+  +  +      N C DV+EC   P +CGP   C+N  G+  C          RN    N   C+ C       K    C    +C     W N  C   D C       D I    C     L  +G  C        + + +CE D +    + S  C+A      Q  D  VG  C C       + S+C  D++EC +    ++CG    C N  G Y C       +   + P  +  S     C D+DEC      C    +C N +GSY C C  G+        ++ NNTC DVNECL   PE   P+  + C+N+ GS+ C C   F  +D   P            +NPC   + C      Y+CKC +G  +    DTC   + C +       C+NG         +C      YECKC      P       ++C                      +DI+EC  +  VC + SD      C N +G Y C   SC  G+  + K++   F   C      LKS  +C PN + C+N 
Sbjct: 4248 DINECEDAASVCGQYSNCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGSYSNCTNELGSYNC----SCLDGFTAENSSLSISINNTCADVNECLKSPVVCGPNSHCINSIGNFNCSCLSAFTVTDRNQPASNSNPCNVCS----LNKTRYQC----KCEGLFVWPNDTCHAYDAC-------DVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHV----WPSNICMA-----YQVCDSIVGSTCGCIQALPS-EGSLCQRDINECED--AASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVNVNNS-----CHDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTAENSSLSISINNTCEDVNECLK-SPEVCGPN--SHCINSIGSFNCSCLSAFTVTDRNQPASN---------SNPC---NVCSLNETRYQCKC-EGLFV-WPNDTCHAYEACDVISNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWPSNTCKAFQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSD------CTNRIGGYMC---SCWNGFNVSNKDSPVSFNNSCHDVNECLKSSEVCGPN-SHCINS 4821          

HSP 23 Score: 119.783 bits (299), Expect = 1.146e-26
Identity = 157/610 (25.74%), Postives = 231/610 (37.87%), Query Frame = 3
Query: 1119 WEICVNTVGSFRCDCQKGFKHSKLGICE-DIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT--NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRS------CEDIDEC--TMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYAC--IQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGS-----------------------YKCQCPKGFEWSDYPIKKCT----------------------------DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            +++C + VGS  C C +    S+  +C+ DI+EC +  ++C     C N +G Y C          K+ P +  N C D++EC   P +CGP   C N  GS+ C                   C DGF  +  + S      CED++EC  +  V   N RC  +   FN      C+             N   CN +    + +++C+ + + V    + H      A       + G C C +G   +    C D+DEC      ++CG    C N  GSY+C  +            S+ + C+DV+EC      C  N  C N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS                       Y+C+C     W   P   C                             DINEC  AA+ CG+   C N +G Y C C+ G+ +S         ++C DIDECL  P  C     C N  G Y C C  GF A    +       C+D++EC  S  VC   S       C N +G + C   SC   +T  +
Sbjct: 4977 YQVCDSIVGS-TCGCIQALP-SEGSLCQRDINECEDAASVCGQYSDCTNRIGGYLCSCWNGFNVSNKDSPVSVNNSCHDINECLFSPPVCGPYSNCTNELGSYNC------------------SCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPNSRCNNSIGSFNC----SCLSAFTVTDRNQPVSNSNPCN-VCSLNETRYQCKCEGLFVWPNDTCH------AYDACDVITNGSCTCINGLPADGQ-FCQDIDECLF--SPSVCGPYSNCTNELGSYSCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSRCYNSIGSFNCSCLSAFTITDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHANDACDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVW---PSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPNSH------CNNSIGSFNC---SCLSAFTVTD 5540          

HSP 24 Score: 117.857 bits (294), Expect = 4.876e-26
Identity = 177/662 (26.74%), Postives = 249/662 (37.61%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKC-----IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICS--------RCKDGFYFKKET------------RSCEDID---------------------ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI---CTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT----------DINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCE-DIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKE-------ICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF----ICE-----LKSESICEPN 2711
            + C DINECE A +   ++  C N +G + C C  GF    + S + +   C D DEC+ +  +C     C N +GSY C       +I   F    +   N C DV+EC    E+CGP   C+N  GS  C         D   P++   N   +CS        +C+  F +  +T             SC  I+                     +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N    Y      C+    F+ S         Y+ +  S+   C D+DEC  +    +CG    C N  GSY  +C+            S+ + C+DV+EC      C  N HC+N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G        + C           +++    +N C     C + VGS  C C Q   L   G  C+ DI+EC      C     C N  G Y C C  GF    ++        C D DEC  S  VC   S+      C N LG Y C   SC  G+T   +         CE     LKS  +C PN
Sbjct: 3135 QFCHDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNEDSPVSVNNSCHDKDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTAINSSFSVSIN---NTCEDVNECLKSSEVCGPNSYCINSIGSFNCSCLSAFTVTDRNQPVS-NSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYVACDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWPSNTCKAYQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYM-----CSCWNGFNVS---------YKDSPVSVNNSCRDIDECLFSPP--VCGPYSNCTNELGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWPSNTCKAFQVCDSIVGS-TCGCIQA--LPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNEDSPVSVNNSCHDKDECLFSPPVCGPYSN------CTNELGSYNC---SCLNGFTAINSSFSVSINNTCEDVNECLKSLEVCGPN 3755          

HSP 25 Score: 112.464 bits (280), Expect = 1.969e-24
Identity = 175/645 (27.13%), Postives = 240/645 (37.21%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICS------RCKDGFYFKKETRSCEDIDECTM----NVGWYNGRCKETDVCFNLPGSY---------DCIPKKKCR--------PGTVLAQNGIACNDID-------ECKQMKFRCEPDEIC-VNTYSSYHC----VASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINEC---------------LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKE-------ICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF----ICE-----LKSESICEPN 2711
            DINECE A +   ++  C N++G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C  S   GF       T    N C DV+EC +  E+CGP   C N  GS  C         D   P++   N   +CS      +CK    F     +C     C +    +    NG   +   C  L   Y         D +     R        P T+ +   I   DID          + + +CE D +   NT  +Y      V S C   Q        C       ++  S+C    +C    G  +C     C N       +   + P      S+ ++C D+DEC      C    +C N +GSY C C  G+        ++ NNTC DVNECL  +  E C    + C N+ GS+ C C   F  +D   P+      N C               +  N     +   + + +  C C  G  L   G  C DI+EC      C     C N  G Y C C  GF    ++        C D DEC  S  VC   S+      C N LG Y C   SC  G+T   +         CE     LKS  +C PN
Sbjct: 2639 DINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNEIGSYNC--SCLDGFTAANSSFTISINNTCEDVNECLSTSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVS-NSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYVACDVISNGSCTCINGLPADGQFCQVLTSDYVIDIDVRFFDLVLVDNLRNIVRNISLPLTLSSSTNIT--DIDMNTVCGLNGTEYECKCEVDHVWPSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYMCS----CWNGFN----VSYKDSP-----VSVNNSCHDIDECLFSPPVCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISINNTCEDVNECL--KSSEVCGP-NSHCFNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSFNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCING--LPADGQFCHDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNEDSPVSVNNSCHDKDECLFSPPVCGPYSN------CTNELGSYNC---SCLDGFTAINSSFSVSINNTCEDVNECLKSSEVCGPN 3251          

HSP 26 Score: 110.923 bits (276), Expect = 5.669e-24
Identity = 154/533 (28.89%), Postives = 217/533 (40.71%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICS------RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCK---------------------ETDVCFN---LPGSYDCIPKKKCRPGTVLAQNGIACNDID-------ECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGK-CMCRDGYRQNQDSICT-DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS------SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-------ILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNGI 2444
            DINECE A +   ++  C N++G + C C  GF    K S + +   C D+DEC+ ++ +C     C N +GSY C  S   GF       T    N C DV+EC    E+CGP  +C N  GS  C         D   P++   N   +CS      +CK    F     +C   D C +     NG C                      + DV F    L  +   I +    P T+ +   I   DID          + + +CE D +    + S  C+A      Q  D  VG  C C       + S+C  D++EC +    ++CG    C N  G Y C     C  G   S      S+ ++C DVDEC      C    +C N +GSY C C  G+        ++ NNTC DVNECL  +  E C    +RC N+ GS+ C C   F  +D   P+           +NPC   + C      Y+CKC +G  +    DTC   D C +       C+NG+
Sbjct: 1130 DINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDVDECLFSLPVCGPYSNCTNEIGSYNC--SCLDGFTTANSNFTISINNTCEDVNECLKSSEVCGPNSRCFNSIGSFNCSCLSAFTVTDRNQPVS-NSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDV---ITNGSCTCINGLPADGQFCQVLLSDYLIDIDVTFFDLFLVDNLRNIVRNISLPLTLSSSTNIT--DIDMNTVCGLNGTEYECKCEVDHV----WPSNICMAY-----QVCDSIVGNTCGCIQALPS-EGSLCQRDINECED--AASVCGQYSDCTNSIGGYMC----SCWNGFNVSNKDSPVSVNNSCHDVDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTTANSNLTISINNTCEDVNECL--KSSEVCGP-NSRCFNSIGSFNCSCLSAFTVTDRNQPVSN---------SNPC---NVCSLNETRYQCKC-EGLFV-WPNDTCHAYDACDVITNGSCTCINGL 1621          

HSP 27 Score: 109.383 bits (272), Expect = 1.717e-23
Identity = 119/413 (28.81%), Postives = 166/413 (40.19%), Query Frame = 3
Query: 1533 ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI---CTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N    Y      C+    F+ S         Y+ +  S+   C D+DEC  +    +CG    C N  GSY  +C+            S+ + C+DV+EC      C  N HC N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G        + C DINEC  AA+ CG+   C N +G Y C C+ G+ +S         ++C D DECL  P  C     C N  G Y C C  GF A            C+D++EC  S  VC   S       CIN +G + C   SC   +T  +
Sbjct: 2898 KCEVDHVWPSNTCKAYQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYM-----CSCWNGFNVS---------YKDSPVSVNNSCHDIDECLFSPP--VCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCFNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSFNETRYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADG---QFCHDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNEDSPVSVNNSCHDKDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTAINSSFSVSINNTCEDVNECLKSSEVCGPNS------YCINSIGSFNC---SCLSAFTVTD 3273          

HSP 28 Score: 103.605 bits (257), Expect = 1.157e-21
Identity = 183/667 (27.44%), Postives = 242/667 (36.28%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT------NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETR---SCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDID-ECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGK-CMCRDGYRQNQDSICT-DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS------SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFEW---------SDYPI-------------------------------KKCTDINECLAANPCGKKHQCVNTVG----SYKCKCFQGYRLSISGDTC--------------EDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKE-------ICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF----ICE-----LKSESICEPN 2711
            DINECE A +   ++  C N +G + C C  GF    K S + +   C DIDEC+ +  +C     C N +GSY C     C  G+  +  +      N C DV+EC   PE+CGP   C+N  GS  C          RN    N   C+ C        ETR    CE +        W N  C   + C       D I    C     L  +G  C        + + +CE D +    + S  C A      Q  D  VG  C C       + S+C  D++EC +    ++CG    C N  G Y C     C  G   S      S  ++C DV+EC      C  N HC+N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G            S Y I                                  TDI+        G +++C   V     S  CK +Q    SI G TC               DI+EC      C     C N  G Y C C  GF    K+        C DI+EC  S  VC   S+      C N LG Y C   SC  G+T + +         CE     LKS  +C PN
Sbjct: 4500 DINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVNVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNC----SCLDGFTAENSSLSISINNTCEDVNECLKSPEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPASNSNPCNVCS-----LNETRYQCKCEGL------FVWPNDTCHAYEAC-------DVISNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHV----WPSNTCKAF-----QVCDSIVGSTCGCIQALPS-EGSLCQRDINECED--AASVCGQYSDCTNRIGGYMC----SCWNGFNVSNKDSPVSFNNSCHDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETWYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADGQFCQVLSSKYVIDIDVRFFDLFLVDYLRNVVRNISLPLTLSSSTNITDIDMNTVCGLNGTEYECKCEVDHVWPSNTCKVYQVCD-SIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGYLCSCWNGFNVSNKDSPVSVNNSCHDINECLFSPPVCGPYSN------CTNELGSYNC---SCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPN 5116          

HSP 29 Score: 102.449 bits (254), Expect = 2.313e-21
Identity = 134/462 (29.00%), Postives = 188/462 (40.69%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT------NDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICS------RCKDGFYFKKETRSCEDIDECTM----NVGWYNGRCKETDVCFNLPGSY---------DCIPKKKCR--------PGTVLAQNGIACNDIDECKQMKF-------RCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGK-CMCRDGYRQNQDSICT-DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS------SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRG-------YILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD 2249
            DINECE A +   ++  C N++G + C C  GF    K S + +   C DIDEC+ + ++C     C N +GSY C     C  G+     +      N C DV+EC    E+CGP   C N  GS  C         D   P++   N   +CS      +CK    F     +C   D C +    +    NG   +   C  L   Y         D +     R        P T+ +   I   DID      F       +CE D +    + S  C+A      Q  D  VG  C C       + S+C  D++EC +    ++CG    C N  G Y C     C  G   S      S+ ++C+DVDEC      C    +C N +GSY C C  G       + ++ NNTC DVNECL  +  E C    + C+N+ GS+ C C   F  +D
Sbjct:  477 DINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCRDIDECLFSPSVCGSYSNCTNEIGSYNC----SCLDGFTAINSSLYISINNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVS-NSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGIPADGQFCQVLLSDYLIDIDVRFFDFVMVDYLRNFVRNISLPLTLSSSTNIT--DIDMNTVCGFNGTEYECKCEVDHV----WPSNTCMA-----YQVCDSIVGNTCGCIQALPS-EGSLCQKDINECED--AASVCGQYSDCTNRIGGYMC----SCWNGFNVSNKDSPVSVNNSCRDVDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTAENSNFTISINNTCEDVNECL--KSSEVCGP-NSHCINSIGSFNCSCLSAFTVTD 912          

HSP 30 Score: 100.908 bits (250), Expect = 6.880e-21
Identity = 168/642 (26.17%), Postives = 235/642 (36.60%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDECM-NVNICSDDKKCKNNVGSYKC---------------IRSIPCG----------------FGWKED-----------------------PDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETR---SCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDID-ECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGK-CMCRDGYRQNQDSICT-DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS------SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNG---------ICVNVPGRYECKCP-----PGFAADRKEIC----------------------QDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            C DI+EC  +      +  C N +GS+ C C  GF  ++S L I     C D++EC+ +  +C  +  C N++G++ C                 S PC                 F W  D                        D   C DV+EC   P +CGP   C+N  G+  C          RN    N   C+ C        ETR    CE +        W N  C   D C       D I    C     L  +G  C        + + +CE D +    + S  CVA      Q  D  VG  C C       + S+C  D++EC +    ++CG    C N  G Y C     C  G   S      S+ ++C D+DEC      C    +C N +GSY C C  G+        ++ NNTCADVNECL   P    P+  + C+N+ G++ C C   F  +D   P            +NPC   + C      Y+CKC +G  +    DTC   D C +       C+NG         +C      YECKC      P       ++C                      +DI+EC  +  VC + SD      C N +G Y C
Sbjct: 3942 CHDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTAENSSLSISINNTCADVNECLKSPEVCGPNSHCINSIGNFNCSCLSAFTVTDRNQPASNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYEACDVITNGSCTCINGLPADGQFCQDVNECLKSPGVCGPNSHCINSNGNFNCSCLSAFTVTDRNQPVSNSNPCNVCS-----LNETRYQCKCEGL------FVWPNDTCHAYDTC-------DVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHV----WPSNTCVA-----YQVCDSIVGSTCGCIQALPS-EGSLCQRDINECED--AASVCGQYSNCTNRIGGYMC----SCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGSYSNCTNELGSYNCSCLDGFTAENSSLSISINNTCADVNECLK-SPVVCGPN--SHCINSIGNFNCSCLSAFTVTDRNQPASN---------SNPC---NVCSLNKTRYQCKC-EGLFV-WPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWPSNICMAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSD------CTNRIGGYMC 4526          

HSP 31 Score: 98.9821 bits (245), Expect = 2.614e-20
Identity = 144/597 (24.12%), Postives = 212/597 (35.51%), Query Frame = 3
Query: 1203 DIDECMNVNICSDDKKCKNNVGSY-KCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA------CNDIDECKQMKFRCEPDEICVNTYSSYHCV----------------ASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGS-----------------------YKCQCPKGFEWSDYPIKKCT----------------------------DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            ++D   + N C   + C + VGS   CI+++P      +        D++ECE    +CG    C N  G + C                   C +GF    +        SC DIDEC  +       C     C N  GSY+C     C  G     + ++      C D++EC +    C P+  C+N+  +++C                 ++PC      + +  +C C   +    D+ C   + C               +   GS  CI       G F       CQDV+EC    G C  N HC+N  G++ C C   + +T  N   ++ N C                L   P ++C   +   V T GS                       Y+C+C     W   P   C                             DINEC  AA+ CG+   C N +G Y C C+ G+ +S         ++C DIDECL  P  C +   C N  G Y C C  GF A+   +       C D++EC  S  VC   S       CIN +G + C   SC   +T  +
Sbjct: 3855 EVDHVWSSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQR-------DINECEDAASVCGQYSDCTNRIGGYMC------------------SCWNGFNVSNKDSPVSVNNSCHDIDECLFSPP----VCGPYSNCTNELGSYNC----SCLDGFTAENSSLSISINNTCADVNECLKSPEVCGPNSHCINSIGNFNCSCLSAFTVTDRNQPASNSNPCNVCS-LNETRYQCKCEGLFVWPNDT-CHAYEACD--------------VITNGSCTCINGLP-ADGQF-------CQDVNECLKSPGVCGPNSHCINSNGNFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDTCDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVW---PSNTCVAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSNCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGSYSNCTNELGSYNCSCLDGFTAENSSLSISINNTCADVNECLKSPVVCGPNSH------CINSIGNFNC---SCLSAFTVTD 4382          

HSP 32 Score: 92.8189 bits (229), Expect = 1.990e-18
Identity = 116/467 (24.84%), Postives = 179/467 (38.33%), Query Frame = 3
Query: 1203 DIDECMNVNICSDDKKCKNNVGSY-KCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRS------CEDIDECTMNVGWYNGRCKETDVCFNLPGSYDC--IPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGD-------------NLCGSLYICINHPGSY-ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFA 2495
            ++D     N C   + C + VGS   CI+S+P      +        D+DEC   P +CGP   C N  GS+ C                   C DGF     + S      CED++EC  +    +  C     C N  GS++C  +             N   CN +    + +++C+ + + V    + H      A       + G C C +G   +          C  NG +             N C +  +C +  GS   CIQ       + +       +D++ECE     C Q   C N +G Y C C  G+ +++       NN+C D++ECL F P    P   + C N  GSY C C  GF  ++          C D+NECL+ +  CG    C N++GS+ C C   + ++       + + C          +C     RY+CKC   F 
Sbjct: 2396 EVDHVWPSNTCKAYQVCDSIVGSTCGCIQSLPSEGSLCQK-------DIDECLFSPPVCGPYSNCTNEIGSYNC------------------SCLDGFTAANSSFSVSINNTCEDVNECLKS----SEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPVSNSNPCN-VCSLNETRYQCKCEGLFVWPNDTCH------AYDACDVITNGSCTCINGLPADGQF----CQVCDLNGTEYECKCEVDHVWPSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQ-------RDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECL-FSPPVCGP--YSNCTNEIGSYNCSCLDGFTAANSSFTISINNTCEDVNECLSTSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPC---------NVCSLNETRYQCKCEGLFV 2803          

HSP 33 Score: 92.0485 bits (227), Expect = 3.140e-18
Identity = 95/352 (26.99%), Postives = 134/352 (38.07%), Query Frame = 3
Query: 1857 DVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGS-----------------------YKCQCPKGFEWSDYPIKKCT----------------------------DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            D+DEC  +    +CG    C N  GSY  +C+         F  S+ + C+DV+EC      C  N HC+N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS                       Y+C+C     W   P   C                             DINEC  AA+ CG+   C N++G Y C C+ G+ +S         ++C DIDECL  P  C     C N  G Y C C  GF A            C+D++EC ++  VC   S       C N +G + C   SC   +T  +
Sbjct: 2436 DIDECLFSPP--VCGPYSNCTNEIGSYNCSCLDGFTAANSSFSVSINNTCEDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVCDLNGTEYECKCEVDHVW---PSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTAANSSFTISINNTCEDVNECLSTSEVCGPNSH------CNNSIGSFNC---SCLSAFTVTD 2773          

HSP 34 Score: 90.8929 bits (224), Expect = 8.795e-18
Identity = 139/477 (29.14%), Postives = 192/477 (40.25%), Query Frame = 3
Query: 1116 KWEICVNTVGSFRCDCQKGFKHSKLGICE-DIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRN----NKGICSRCKDGFYFKKETR---SCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDID-ECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGK-CMCRDGYRQNQDSICT-DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS------SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRG-------YILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNGI 2444
             +++C + VGS  C C +    S+  +C+ DIDEC+ +  +C     C N +GSY C  S   GF       +    N C DV+EC    E+CGP   C+N  GS  C          RN    N   C+ C        ETR    CE +        W N  C   D C       D I    C     L  +G  C   D    + + +CE D +    + S  C A      Q  D  VG  C C       + S+C  D++EC +    ++CG    C N  G Y C     C  G   S      S+ ++C D+DEC      C    +C N +GSY C C  G       + ++ NNTC DVNECL     E C    + C N+ GS+ C C   F  +D   P+           +NPC   + C      Y+CKC +G  +    DTC     C +       C+NG+
Sbjct: 2408 AYQVCDSIVGS-TCGCIQSLP-SEGSLCQKDIDECLFSPPVCGPYSNCTNEIGSYNC--SCLDGFTAANSSFSVSINNTCEDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCS-----LNETRYQCKCEGL------FVWPNDTCHAYDAC-------DVITNGSCTCINGLPADGQFCQVCDLNGTEYECKCEVDHV----WPSNTCKA-----YQVCDSIVGSTCGCIQALPS-EGSLCQRDINECED--AASVCGQYSDCTNSIGGYMC----SCWNGFNVSNKDSPVSVNNSCHDIDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTAANSSFTISINNTCEDVNECL--STSEVCGP-NSHCNNSIGSFNCSCLSAFTVTDRNQPVSN---------SNPC---NVCSLNETRYQCKC-EGLFV-WPNDTCHAYVACDVISNGSCTCINGL 2829          

HSP 35 Score: 89.7373 bits (221), Expect = 1.945e-17
Identity = 104/362 (28.73%), Postives = 144/362 (39.78%), Query Frame = 3
Query: 1533 ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGY-----RLSIS-GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFA-ADRKE 2510
            +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N    Y                   C C +G+   N+DS       C D++EC  +    +CG    C N  GSY  +C+            S  + C+DV+EC      C  N  C N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G        + C DI+ECL + + CG    C N +GSY C C  G+      LSIS  +TCED++ECL     C  N  C N  G + C C   F   DR +
Sbjct: 4962 KCEVDHVWPSNTCKVYQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNRIGGY------------------LCSCWNGFNVSNKDSPVSVNNSCHDINECLFSPP--VCGPYSNCTNELGSYNCSCLDGFTARNSSLSISYNNTCEDVNECLKSSEVCGPNSRCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADG---QFCQDIDECLFSPSVCGPYSNCTNELGSYSCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSRCYNSIGSFNCSCLSAFTITDRNQ 5291          

HSP 36 Score: 83.5741 bits (205), Expect = 1.463e-15
Identity = 189/799 (23.65%), Postives = 271/799 (33.92%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDECM-NVNICSDDKKCKNNVGSYKC---------------IRSIPCG----------------FGWKEDP----DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPIN--MKRNNKGICSRCKDGFYFKKETRSCEDIDE---CTMNVGWYNGRCKETDVC-FNLPGSY---DCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFE---------WSDYPI-------------------------------KKCTDINECLAANPCGKKHQC---------VNTVGSYK---------CKCFQGYRLSISGDTCE-DIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKE-------ICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF----ICE-----LKSESICEPN----------DADCL-------------NEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQS-VYVKNVFHLDKDRY 2930
            C D++EC  +      +  C N +GS+ C C  GF   +S   I     CED++EC+ +  +C  + +C N++GS+ C                 S PC                 F W  D     D  D +    C     +   G  C  +   +  + D    +  +  N + I             T    DID    C +N   Y  +C+   V   N+  +Y   D I    C     L   G  C  DI+EC+     C     C N+   Y                   C C +G+   N+DS       C DVDEC  +    +CG    C N  GSY  +C+            S+ + C+DV+EC      C  N  C N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G            SDY I                                  TDI+        G +++C          NT  +Y+         C C Q   L   G  C+ DI+EC      C     C N  G Y C C  GF    K+        C DIDEC  S  VC   S+      C N +G Y C   SC  G+T   +         CE     LKS  +C PN          +  CL             N  P  +S    E   +I+     SR       +    +N  + Y ++ +TN + + +  V  L++ RY
Sbjct: 1177 CHDVDECLFSLPVCGPYSNCTNEIGSYNCSCLDGFTTANSNFTISINNTCEDVNECLKSSEVCGPNSRCFNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVLLSDYLIDIDVTFFDLFLVDNLRNIVRNISLPLTLSSSTNI-TDIDMNTVCGLNGTEYECKCEVDHVWPSNICMAYQVCDSIVGNTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNSIGGY------------------MCSCWNGFNVSNKDSPVSVNNSCHDVDECLFSPP--VCGPYSNCTNEIGSYNCSCLDGFTTANSNLTISINNTCEDVNECLKSSEVCGPNSRCFNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADGQFCQVLLSDYLIDIDVRFFDLFLVDNLRNIVRNISLPLTLNSSTNITDIDMNTVCGLNGTEYECKCEVDHVWPSNTCMAYQVCDSIVGSTCGCIQA--LPSEGSLCQRDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSSSVCGPYSN------CTNEIGSYNC---SCLDGFTSANSSFTISINNTCEDVNECLKSSEVCGPNSHCINSFGSFNCSCLSAFTVTDRNQPVSNSNPCNVSLPLTEYLIEIEINSIDSRITDQLRTL---LMNFSLPYTISDSTNITEINITTVCSLNETRY 1938          

HSP 37 Score: 81.6481 bits (200), Expect = 4.890e-15
Identity = 57/191 (29.84%), Postives = 87/191 (45.55%), Query Frame = 3
Query: 2001 QDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIK-----KCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDEC 2534
            +D++ECE     C Q  +C N +G Y C C  G+ +++       NN+C D++EC LF P    P   + C N  GSY C C  GF   +  +       C D+NECL ++  CG   +C N++GS+ C C   + ++       + + C          +C     RY+CKC  G      + C   D C
Sbjct: 6307 RDINECEDAASVCGQYSNCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDEC-LFSPPVCGP--YSNCTNEIGSYNCSCLDGFTARNSSLSISFNNTCEDVNECLKSSEVCGPNSRCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPC---------NVCSLNETRYQCKC-EGLFVWPNDTCHAYDAC 6484          

HSP 38 Score: 80.8777 bits (198), Expect = 9.765e-15
Identity = 116/451 (25.72%), Postives = 174/451 (38.58%), Query Frame = 3
Query: 1203 DIDECMNVNICSDDKKCKNNVGSY-KCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDC--IPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------------ASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNGI 2444
            ++D   + N C   + C + VGS   CI+++P      +        D++ECE    +CG    C N  G + C                   C +GF    +        SC D DEC  +       C     C N  GSY+C  +     R  ++   N   C D++EC +    C P+  C N+  S++C                 ++PC      + +  +C C   +    D+ C   D C     D +      CIN   +Y          G F       CQD++ECE     C Q   C N +G Y C C  G+ +++       NN+C DVNECL  +  E C    +RC N+ GS+ C C   F  +D   P+           +NPC   + C      Y+CKC +G  +    DTC   D C +       C+NG+
Sbjct: 5817 EVDHVWSSNTCKAYQVCDSIVGSTCGCIQALPSEGSLCQR-------DINECENAASVCGQYSDCTNSIGGYLC------------------SCWNGFNISNKDSPVSVNNSCHDKDECLFSPP----VCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISNNNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQRVSNSNPCNVCS-LNETRYQCKCEGLFAWPNDT-CHAYDAC-----DVITNGSCTCINGLPAY----------GQF-------CQDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNEDSPVSVNNSCHDVNECL--KSSEVCGP-NSRCNNSIGSFNCSCLSAFTVTDRNQPVSN---------SNPC---NVCSLNETRYQCKC-EGLFV-WPNDTCHAYDACDVITNGSCTCINGL 6197          

HSP 39 Score: 80.4925 bits (197), Expect = 1.186e-14
Identity = 64/219 (29.22%), Postives = 97/219 (44.29%), Query Frame = 3
Query: 2001 QDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECST-SEGVCSRESDF-QNGRLCINLLGYY 2612
            +D++ECE     C Q   C N +G Y C C  G+ +++       NN+C D++ECL F P  S     + C N  GSY C C  GF   +  +       C D+NECL ++  CG    C N++GS+ C C   + ++       + + C          +C     RY+CKC  G      + C   D C   + G C+  +    +G+ C  LL  Y
Sbjct:  476 RDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCRDIDECL-FSP--SVCGSYSNCTNEIGSYNCSCLDGFTAINSSLYISINNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPC---------NVCSLNETRYQCKC-EGLFVWPNDTCHAYDACDVITNGSCTCINGIPADGQFCQVLLSDY 681          

HSP 40 Score: 78.9518 bits (193), Expect = 3.797e-14
Identity = 109/408 (26.72%), Postives = 147/408 (36.03%), Query Frame = 3
Query: 1533 ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFE-------------------------WSDY---------------------PIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGY-----RLSIS-GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGF-AADRKE 2510
            +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N+   Y                   C C +G+   N+DS       C D+DEC  +    +CG    C N  GSY  +C+            S  + C+DV+EC      C  N  C N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G                             DY                      I   TDI+ECL + P CG    C N +GSY C C  G+      LSIS  +TCED++ECL     C  N  C N  G + C C   F   DR +
Sbjct: 6266 KCEVDHVWPSNTCKAFQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSNCTNSIGGY------------------MCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSPP--VCGPYSNCTNEIGSYNCSCLDGFTARNSSLSISFNNTCEDVNECLKSSEVCGPNSRCNNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADGQFCQVLSSKYVIDIDVRFFDMFLVDYLRNVVRNISLPLTLSSSTNITDIDMNTDIDECLFSPPVCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCNNSIGSFNCSCLSAFTVTDRNQ 6644          

HSP 41 Score: 75.485 bits (184), Expect = 3.764e-13
Identity = 122/521 (23.42%), Postives = 190/521 (36.47%), Query Frame = 3
Query: 1056 QFLEICG----------DINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICE-DIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT--NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRS------CEDIDECTMNVGWYNGRCKETDVCFNLPGSYD--CIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWS--DYPIK---KCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDEC 2534
            QF ++CG          +++    +N C   +++C + VGS  C C +    S+  +C+ DI+EC +  ++C     C N +G Y C          K+ P    N C D+DEC   P +CGP   C N  GS+ C                   C DGF  +  + S      CED++EC  +       C     C N  GS++  C+           A N   CN +    + +++C+ + + V    + H      A       S G C C +G   +          C  NG                        EC   +      + C+    C++  G       C+  + S   +C R           D+NEC       S     + C N  G Y C C  GF  S  D P+     C D+NECL ++  CG    C+N++GS+ C C   + ++       + + C          +C      Y+CKC  G      + C   D C
Sbjct: 4443 QFCQVCGLNGTEYECKCEVDHVWPSNICM-AYQVCDSIVGS-TCGCIQALP-SEGSLCQRDINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVNVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNC------------------SCLDGFTAENSSLSISINNTCEDVNECLKSPE----VCGPNSHCINSIGSFNCSCLSAFTVTDRNQPASNSNPCN-VCSLNETRYQCKCEGLFVWPNDTCH------AYEACDVISNGSCTCINGLPADGQF----CQVCGLNG---------------------TEYECKCEVDHVWPSNTCKAFQVCDSIVGS---TCGCIQALPSEGSLCQR-----------DINEC---EDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVSFNNSCHDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRNQPVSNSNPC---------NVCSLNETWYQCKC-EGLFVWPNDTCHAYDAC 4879          

HSP 42 Score: 74.3294 bits (181), Expect = 7.773e-13
Identity = 65/236 (27.54%), Postives = 99/236 (41.95%), Query Frame = 3
Query: 2271 DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQS-VYVKNVFHLDKDRY 2930
            DINEC  AA+ CG+   C N +G Y C C+ G+ +S         ++C D+DECL  P  C     C N  G Y C C  GF A+           C+D++EC  S  VC   S       CIN +G + C   SC   +T  +         +++ +         N  P  +S    E   +I+     SR       +    +N  + Y ++ +TN + + +  V  L + RY
Sbjct:  778 DINECEDAASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCRDVDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTAENSNFTISINNTCEDVNECLKSSEVCGPNSH------CINSIGSFNC---SCLSAFTVTD---------RNQPV--------SNSNPCNVSLPLTEYLIEIEINSIDSRITDQLRTL---LMNFSLPYTISDSTNITEINITTVCSLYETRY 984          

HSP 43 Score: 74.3294 bits (181), Expect = 9.760e-13
Identity = 148/620 (23.87%), Postives = 223/620 (35.97%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDK-----KCKN------------------NVGSYKCIRSIP--------CGFGWKEDP---------DTNDCVDVDECEAF-PEICG-----PGMKCVNIRGSHRCEDDECPINMKRN--NK--GICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA------CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN--CQDVDECET-GEGKC------PQNMHCVNVVG----SYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSIS------GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            + C D+NEC  +         C+N+ G+F C C   F  +     + +      N+CS ++     KC+                     GS  CI  +P        CG    E            +N CV    C++     CG     P    +  R  + CED         N  N+  G    C +GF    +        SC DIDEC  +       C     C N  GSY+C     C  G     + ++      C D++EC +    C P+  C+N+  +++                  C C   +        TD ++ A N   N C    +C  +   Y C  + E   G+F   ++ N  C   D C+    G C      P +     V G     Y+C C+  ++  S       N C+ ++  +S       C+    S    C +        I +C D     AA+ CG+   C N +G Y C C+ G+ +S         ++C DIDECL  P  C     C N  G Y C C  GF A+   +       C+D++EC  S  VC   S       CIN +G + C   SC   +T  +
Sbjct: 4090 QFCQDVNECLKSPGVCGPNSHCINSNGNFNCSCLSAFTVTDRN--QPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDTCDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWPSNTCVAYQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSNCTNRIGGYMCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSP----PVCGSYSNCTNELGSYNC----SCLDGFTAENSSLSISINNTCADVNECLKSPVVCGPNSHCINSIGNFN------------------CSCLSAFTV------TDRNQPASNS--NPCN---VCSLNKTRYQC--KCE---GLF---VWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVCGLNGTEYECKCEVDHVWPS-------NICMAYQVCDSIVGSTCGCIQALPSEGSLCQRD-------INECED-----AASVCGQYSDCTNRIGGYMCSCWNGFNVSNKDSPVNVNNSCHDIDECLFSPPVCGPYSNCTNELGSYNCSCLDGFTAENSSLSISINNTCEDVNECLKSPEVCGPNSH------CINSIGSFNC---SCLSAFTVTD 4634          

HSP 44 Score: 73.559 bits (179), Expect = 1.391e-12
Identity = 153/611 (25.04%), Postives = 223/611 (36.50%), Query Frame = 3
Query: 1194 ICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPD----TNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNKGICS------RCKDGFYFKKETRSCEDIDECTM----NVGWYNGRCKETDVCFNLPGSYDC-----------------IPKKKCRPGTVLAQNGIACNDID-------ECKQMKFRCEPDEIC-VNTYSSYHC----VASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNGI------CVNVPGRY----------------------ECKCPPGFAADRK----EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF----ICE-----LKSESICEPN 2711
             C+DI+EC +  ++C     C N++G Y C  S   GF    +       N C DV+EC    E+CGP  +C N  GS  C         D   P++   N   +CS      +CK    F     +C   D C +    +    NG   +   C  L   Y                   + +    P T+ +   I   DID          + + +CE D +   NT  ++      V S C   Q        C       ++  S+C     C  + G  +C     C N       +   + P      S+ ++C D+DEC      C    +C N +GSY C C  G+        ++ NNTC DVNECL  +  E C    +RC N+ GS+ C C   F  +D   P+           +NPC   + C      Y+CKC +G  +    DTC   D C +       C+NG+      C  +  +Y                          P   ++       ++  DIDEC  S  VC   S+      C N LG Y C   SC  G+T + +         CE     LKS  +C PN
Sbjct: 6053 FCQDINECEDAASVCGQYSDCTNSIGGYMC--SCWNGFNVSNEDSPVSVNNSCHDVNECLKSSEVCGPNSRCNNSIGSFNCSCLSAFTVTDRNQPVS-NSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVLSSKYVIDIDVRFFDLFLVDYLRNVVRNISLPLTLSSSTNIT--DIDMNTVCGLNGTEYECKCEVDHVWPSNTCKAFQVCDSIVGSTCGCIQALPSEGSLCQRDINECEDAASVCGQYSNCTNSIGGYMCS----CWNGFN----VSNKDSP-----VSVNNSCHDIDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTARNSSLSISFNNTCEDVNECL--KSSEVCGP-NSRCNNSIGSFNCSCLSAFTVTDRNQPVSN---------SNPC---NVCSLNETRYQCKC-EGLFV-WPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVLSSKYVIDIDVRFFDMFLVDYLRNVVRNISLPLTLSSSTNITDIDMNTDIDECLFSPPVCGPYSN------CTNKLGSYNC---SCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPN 6619          

HSP 45 Score: 70.8626 bits (172), Expect = 1.125e-11
Identity = 63/236 (26.69%), Postives = 99/236 (41.95%), Query Frame = 3
Query: 2271 DINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLS------ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQS-VYVKNVFHLDKDRY 2930
            DINEC  AA+ CG+   C N++G Y C C+ G+ +S         ++C D+DECL  P  C     C N  G Y C C  GF      +       C+D++EC  S  VC   S       C N +G + C   SC   +T  +         +++ +         N  P  +S    E   +I+     SR       +    +N  + Y ++ +TN + + +  V  L++ RY
Sbjct: 2084 DINECEDAASVCGQYSDCTNSIGDYMCSCWNGFNVSNKDSPVSVNNSCHDVDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTTANSNLTISINNTCEDVNECLKSPEVCGPNS------RCNNSIGSFNC---SCLSAFTVTD---------RNQPV--------SNSNPCIVSLPLTEYLIEIEINSIDSRITDQLRTL---LMNFSLPYTISDSTNITEINITTVCSLNETRY 2290          

HSP 46 Score: 70.0922 bits (170), Expect = 1.850e-11
Identity = 50/141 (35.46%), Postives = 65/141 (46.10%), Query Frame = 3
Query: 2130 DVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWS--DYPIK---KCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSIS------GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGF-AADRKE 2510
            D+NEC       S     + C N+ G Y C C  GF  S  D P+     C D++ECL + P CG    C N +GSY C C  G+  + S       +TCED++ECL     C  N  C N  G + C C   F   DR +
Sbjct: 1130 DINEC---EDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDVDECLFSLPVCGPYSNCTNEIGSYNCSCLDGFTTANSNFTISINNTCEDVNECLKSSEVCGPNSRCFNSIGSFNCSCLSAFTVTDRNQ 1267          

HSP 47 Score: 69.707 bits (169), Expect = 2.362e-11
Identity = 48/128 (37.50%), Postives = 64/128 (50.00%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF----KHSKLGI---CEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT----NDCVDVDECEAFPEICGPGMKCVNIRGSHRCE 1424
            DINECE A +   ++  C N++G + C C  GF    K S + +   C D+DEC+ +  +C     C N +GSY C  S   GF       T    N C DV+EC   PE+CGP  +C N  GS  C 
Sbjct: 2084 DINECEDAASVCGQYSDCTNSIGDYMCSCWNGFNVSNKDSPVSVNNSCHDVDECLFSPPVCGPYSNCTNEIGSYNC--SCLDGFTTANSNLTISINNTCEDVNECLKSPEVCGPNSRCNNSIGSFNCS 2209          

HSP 48 Score: 65.855 bits (159), Expect = 3.625e-10
Identity = 128/500 (25.60%), Postives = 171/500 (34.20%), Query Frame = 3
Query: 1533 ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNEC----------------LLFRPEESCPDLEARCVNTAGSYKCQCPKGFE---------WSDYPI----------------------------KKCTDINECLAANPCGKKHQCVNTVGSYKCKC----------FQGYRL--SISGDTC--------------EDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKE-------ICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF----ICE-----LKSESICEPN 2711
            +C ++  W +  CK   VC ++ GS        C     L   G  C  DI+EC+     C     C N+   Y                   C C +G+   N+DS       C DVDEC  +    +CG    C N  GSY  +C+         F  S+ + C+DV+EC      C  N  C N +GS+ C C   + +T  N   ++ N C                L   P ++C   +A  V T GS  C C  G            SDY I                               T+I +      CG           Y+CKC             Y++  SI G+TC               DI+EC      C     C N  G Y C C  GF    K+        C D+DEC  S  VC   S+      C N +G Y C   SC  G+T   +         CE     LKS  +C PN
Sbjct: 1088 KCEVDHVWPSNTCKAYQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNSIGGY------------------MCSCWNGFNVSNKDSPVSVNNSCHDVDECLFSLP--VCGPYSNCTNEIGSYNCSCLDGFTTANSNFTISINNTCEDVNECLKSSEVCGPNSRCFNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSLNETRYQCKCEGLFVWPNDTCHAYDACDVITNGS--CTCINGLPADGQFCQVLLSDYLIDIDVTFFDLFLVDNLRNIVRNISLPLTLSSSTNITDIDMNTVCGLNGT------EYECKCEVDHVWPSNICMAYQVCDSIVGNTCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNSIGGYMCSCWNGFNVSNKDSPVSVNNSCHDVDECLFSPPVCGPYSN------CTNEIGSYNC---SCLDGFTTANSNLTISINNTCEDVNECLKSSEVCGPN 1543          

HSP 49 Score: 63.929 bits (154), Expect = 1.283e-9
Identity = 54/161 (33.54%), Postives = 77/161 (47.83%), Query Frame = 3
Query: 1857 DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS------SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-------ILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP 2300
            D++EC +    ++CG    C N  G Y C     C  G   S      S+ ++C DVDEC      C    +C N +GSY C C  G+        ++ NNTC DVNECL   PE   P+  +RC N+ GS+ C C   F  +D   +  ++ N C+ + P
Sbjct: 2084 DINECED--AASVCGQYSDCTNSIGDYMC----SCWNGFNVSNKDSPVSVNNSCHDVDECLFSPPVCGPYSNCTNEIGSYNCSCLDGFTTANSNLTISINNTCEDVNECLK-SPEVCGPN--SRCNNSIGSFNCSCLSAFTVTDRN-QPVSNSNPCIVSLP 2234          

HSP 50 Score: 62.7734 bits (151), Expect = 2.693e-9
Identity = 74/303 (24.42%), Postives = 107/303 (35.31%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDECM-NVNICSDDKKCKNNVGSYKC---------------IRSIPCG----------------FGWKED-----------------------PDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA------CNDIDECKQMKFRCEPDEICVNTYSSYHC 1757
            C DI+EC  +      +  C N +GS+ C C  GF  ++S L I     CED++EC+ +  +C  +  C N++GS+ C                 S PC                 F W  D                        D   C D++ECE    +CG    C N  G + C                   C +GF    E        SC D DEC  +       C     C N  GSY+C     C  G     +  +      C D++EC +    C P+  C+N+  S++C
Sbjct: 2987 CHDIDECLFSPPVCGPYSNCTNKLGSYNCSCLDGFTARNSSLSISINNTCEDVNECLKSSEVCGPNSHCFNSIGSFNCSCLSAFTVTDRNQPVSNSNPCNVCSFNETRYQCKCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCHDINECEDAASVCGQYSDCTNRIGGYMC------------------SCWNGFNVSNEDSPVSVNNSCHDKDECLFSP----PVCGPYSNCTNELGSYNC----SCLDGFTAINSSFSVSINNTCEDVNECLKSSEVCGPNSYCINSIGSFNC 3263          

HSP 51 Score: 57.7658 bits (138), Expect = 8.959e-8
Identity = 113/493 (22.92%), Postives = 176/493 (35.70%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP----DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDE--CPINMKRNNKGICSRCKDGFYFKKETRSCEDID--------------ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRP-EESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNGI 2444
            C D+NEC  ++        C N++GSF C C   F  +     + +      N+CS ++        Y+C       F W  D     D  D +    C     +   G  C  +   +  + D     + +  N + I             T    DID              +C ++  W +  C    VC ++ GS        C     L   G  C  DI+EC+     C     C N+   Y                   C C +G+   N+DS       C D+DEC  +    +CG    C N  GSY  +C+         F  S+ + C+DV+EC      C  N HC+N  GS+ C C   + +T  N   ++ N C +  P  E   ++E   +++  + + +         Y I   T+I E      C            Y+CKC +G  +    DTC   D C +       C+NG+
Sbjct: 1527 CEDVNECLKSSEVCGPNSRCFNSIGSFNCSCLSAFTVTDRN--QPVSNSNPCNVCSLNET------RYQC--KCEGLFVWPNDTCHAYDACDVITNGSCTCINGLPADGQFCQVLLSDYLIDIDVRFFDLFLVDNLRNIVRNISLPLTLNSSTNI-TDIDMNTVCGLNGTEYECKCEVDHVWPSNTCMAYQVCDSIVGS-------TCGCIQALPSEGSLCQRDINECEDAASVCGQYSDCTNSIGGY------------------MCSCWNGFNVSNKDSPVSVNNSCHDIDECLFSSS--VCGPYSNCTNEIGSYNCSCLDGFTSANSSFTISINNTCEDVNECLKSSEVCGPNSHCINSFGSFNCSCLSAFTVTDRNQPVSNSNPCNVSLPLTEYLIEIEINSIDSRITDQLRTLLMNFSLPYTISDSTNITEINITTVCSLNET------RYQCKC-EGLFV-WPNDTCHAYDACDVITNGSCTCINGL 1973          

HSP 52 Score: 56.225 bits (134), Expect = 2.747e-7
Identity = 62/216 (28.70%), Postives = 93/216 (43.06%), Query Frame = 3
Query: 1833 QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD--YPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPR---KCLNGI 2444
            ++  S+C    +C  + G  +C     C N       +   + P      S+ ++C+D+DEC      C    +C N +GSY C C  G+        ++ NNTC DVNECL  +  E C    + C N+ GS+ C C   F  +D   P+           +NPC   + C      Y+CKC +G  +    DTC   D C +       C+NGI
Sbjct:  482 EDAASVCGQYSDCTNSIGGYMCS----CWNGFN----VSNKDSP-----VSVNNSCRDIDECLFSPSVCGSYSNCTNEIGSYNCSCLDGFTAINSSLYISINNTCEDVNECL--KSSEVCGP-NSHCNNSIGSFNCSCLSAFTVTDRNQPVSN---------SNPC---NVCSLNETRYQCKC-EGLFV-WPNDTCHAYDACDVITNGSCTCINGI 667          

HSP 53 Score: 55.4546 bits (132), Expect = 4.591e-7
Identity = 57/206 (27.67%), Postives = 79/206 (38.35%), Query Frame = 3
Query: 1533 ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDS------ICTDVDECAENGGDNLCGSLYICINHPGSY--ACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN 2120
            +C ++  W +  C    VC       D I    C     L   G  C  DI+EC+     C     C N    Y                   C C +G+   N+DS       C DVDEC  +    +CG    C N  GSY  +C+         F  S+ + C+DV+EC      C  N HC+N +GS+ C C   + +T  N
Sbjct:  736 KCEVDHVWPSNTCMAYQVC-------DSIVGNTCGCIQALPSEGSLCQKDINECEDAASVCGQYSDCTNRIGGY------------------MCSCWNGFNVSNKDSPVSVNNSCRDVDECLFSPP--VCGPYSNCTNEIGSYNCSCLDGFTAENSNFTISINNTCEDVNECLKSSEVCGPNSHCINSIGSFNCSCLSAFTVTDRN 914          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 214.157 bits (544), Expect = 6.736e-56
Identity = 145/472 (30.72%), Postives = 208/472 (44.07%), Query Frame = 3
Query: 1161 CQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLF-------------------RPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYEC---KCPPGFAADR 2504
            C KGF       C D DEC   + CS    C NN+G + C     C  G+    ++N C D+DEC     +C P  +CVN  G++RC+                ++C  GF       SCED+DEC  +       C++   CFN  GS+ C     C PG  L   G  C DI+EC  ++  C   + C NT   Y C  S                C  G    ++ +C D+DEC +  G ++C    IC N  G Y C+    CP G     +   C D+DEC      C     C NV GS++C+C  G +L  +  +CA +    +F                   RP  +   +    + ++   + +CP G+   D     C DI+EC    PC  +H+C NT+GSY+C C  GY+L  +G TC+DIDEC ++  +C  N +C N  G Y+C    CP  +   R
Sbjct: 3677 CPKGFILDTASYCADEDECAVDSPCS--HSCNNNMGGFSC----ACPSGFTISTESNSCQDIDECSQGSHLCHPNQQCVNTVGTYRCQ----------------AKCGLGFKPSLVGTSCEDVDECQESA---VSPCQQQ--CFNTLGSFRC----TCHPGYQLV--GHRCLDINEC--LRNVCPAHQQCRNTDGGYQCFDS----------------CPAGMTAAENGVCVDIDECQD--GSHMCRYSQICQNTIGGYGCV----CPRGYRSQGVGRPCLDIDECAQVPSPCA--FQCRNVPGSFRCVCPPGTVLLGDGRSCAGLERGHIFTNSTRVQARLRPQLVSALERPYLTRLSVLPEHLGSSRRPRHECPVGYTSKD---GTCIDIDECAFRKPC--QHECRNTIGSYQCTCPPGYQLLSNGRTCKDIDECTVQGVQCGPNQMCFNTRGGYQCLDTPCPNSYQRGR 4084          

HSP 2 Score: 167.162 bits (422), Expect = 3.374e-41
Identity = 142/491 (28.92%), Postives = 194/491 (39.51%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHS-KLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPP------------GMFRSSMYSNCQDVD----------------------------------ECETG----EGKC----------PQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKC---QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSY 2342
            C D +EC   + C++    C N +G F C C  GF  S +   C+DIDEC    ++C  +++C N VG+Y+C     CG G+K       C DVDEC+    +     +C N  GS RC                   C  G+        C DI+EC  NV   + +C+ TD      G Y C     C  G   A+NG+ C DIDEC+     C   +IC NT   Y CV                  C  GYR Q     C D+DECA+    + C   + C N PGS+ C+    CPP            G+ R  +++N   V                                   EC  G    +G C          P    C N +GSY+C C  GY L SN  TC D++EC + +  +  P+    C NT G Y+C    CP  ++    P         C    PC  +  C  +VGS+
Sbjct: 3689 CADEDECAVDSPCSHS---CNNNMGGFSCACPSGFTISTESNSCQDIDECSQGSHLCHPNQQCVNTVGTYRC--QAKCGLGFKPSLVGTSCEDVDECQE-SAVSPCQQQCFNTLGSFRCT------------------CHPGYQLVGH--RCLDINECLRNVCPAHQQCRNTD------GGYQCF--DSCPAGMTAAENGV-CVDIDECQDGSHMCRYSQICQNTIGGYGCV------------------CPRGYRSQGVGRPCLDIDECAQV--PSPCA--FQCRNVPGSFRCV----CPPGTVLLGDGRSCAGLERGHIFTNSTRVQARLRPQLVSALERPYLTRLSVLPEHLGSSRRPRHECPVGYTSKDGTCIDIDECAFRKPCQHECRNTIGSYQCTCPPGYQLLSNGRTCKDIDECTV-QGVQCGPN--QMCFNTRGGYQCLDTPCPNSYQRGRNP-------GTCF--RPCSSRLDC-GSVGSF 4105          

HSP 3 Score: 162.925 bits (411), Expect = 7.302e-40
Identity = 130/448 (29.02%), Postives = 184/448 (41.07%), Query Frame = 3
Query: 1407 GSHRCEDDECPIN------MKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFR-CEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDLEA-RCVNTAGSYKCQCP------------KGFEWSDYPIKKCTDINECLAANPCGKKHQCVNT--------VGSYK---CKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA-DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTK 2651
             S+  ++DEC ++         N  G    C  GF    E+ SC+DIDEC+      +  C     C N  G+Y C  + KC  G   +  G +C D+DEC++     C+  + C NT  S+ C    C P  Q            G+R      C D++EC  N    +C +   C N  G Y C     CP GM  ++    C D+DEC+ G   C  +  C N +G Y C+C RGY        C D++EC         P   A +C N  GS++C CP             G E   +     T +   L         +   T        +GS +    +C  GY  +    TC DIDEC    RK     C N  G Y+C CPPG+        C+DIDEC+     C         ++C N  G Y+C+++ CP  Y +
Sbjct: 3686 ASYCADEDECAVDSPCSHSCNNNMGGFSCACPSGFTISTESNSCQDIDECSQG----SHLCHPNQQCVNTVGTYRC--QAKCGLGFKPSLVGTSCEDVDECQESAVSPCQ--QQCFNTLGSFRCT---CHPGYQLV----------GHR------CLDINECLRN----VCPAHQQCRNTDGGYQCFD--SCPAGM-TAAENGVCVDIDECQDGSHMCRYSQICQNTIGGYGCVCPRGYRSQGVGRPCLDIDEC------AQVPSPCAFQCRNVPGSFRCVCPPGTVLLGDGRSCAGLE-RGHIFTNSTRVQARLRPQLVSALERPYLTRLSVLPEHLGSSRRPRHECPVGY--TSKDGTCIDIDECAF--RKPCQHECRNTIGSYQCTCPPGYQLLSNGRTCKDIDECTVQGVQCGPN------QMCFNTRGGYQCLDTPCPNSYQR 4082          

HSP 4 Score: 155.992 bits (393), Expect = 9.064e-38
Identity = 103/283 (36.40%), Postives = 140/283 (49.47%), Query Frame = 3
Query: 1815 CRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM--CDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC--KCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVG 2642
            C  G+  +  S C D DECA    D+ C   + C N+ G ++C     CP G   S+  ++CQD+DEC  G   C  N  CVN VG+Y+C   C  G+  +    +C DV+EC     E +    + +C NT GS++C C  G++   +   +C DINECL  N C    QC NT G Y+C   C  G   + +G  C DIDEC      C  + IC N  G Y C CP G+ +      C DIDEC+     C+    FQ    C N+ G ++CV   CP G
Sbjct: 3677 CPKGFILDTASYCADEDECAV---DSPCS--HSCNNNMGGFSC----ACPSGFTISTESNSCQDIDECSQGSHLCHPNQQCVNTVGTYRCQAKCGLGFKPSLVGTSCEDVDEC----QESAVSPCQQQCFNTLGSFRCTCHPGYQLVGH---RCLDINECLR-NVCPAHQQCRNTDGGYQCFDSCPAGMTAAENG-VCVDIDECQDGSHMCRYSQICQNTIGGYGCVCPRGYRSQGVGRPCLDIDECAQVPSPCA----FQ----CRNVPGSFRCV---CPPG 3930          

HSP 5 Score: 145.206 bits (365), Expect = 1.791e-34
Identity = 119/416 (28.61%), Postives = 173/416 (41.59%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD--CQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGIC---SRCKDGFYFKKET------------------------RSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDE------CKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTSN-NTCADVNECLLFRPEES 2168
            GF  +     C DI+EC   +   +  + CVNTVG++RC   C  GFK S +G  CED+DEC    +    ++C N +GS++C     C  G++     + C+D++EC     +C    +C N  G ++C  D CP  M     G+C     C+DG +  + +                        R C DIDEC         +C+      N+PGS+ C+    C PGTVL  +G +C  ++         +++ R  P    V+     +       P         +  C  GY  ++D  C D+DECA           + C N  GSY C     CPPG    S    C+D+DEC     +C  N  C N  G Y+C+   C   Y    N  TC        FRP  S
Sbjct: 3719 GFTISTESNSCQDIDECSQGSHLCHPNQQCVNTVGTYRCQAKCGLGFKPSLVGTSCEDVDECQESAVSPCQQQCFNTLGSFRCT----CHPGYQ--LVGHRCLDINEC--LRNVCPAHQQCRNTDGGYQCF-DSCPAGMTAAENGVCVDIDECQDGSHMCRYSQICQNTIGGYGCVCPRGYRSQGVGRPCLDIDECAQVPSPCAFQCR------NVPGSFRCV----CPPGTVLLGDGRSCAGLERGHIFTNSTRVQARLRPQ--LVSALERPYLTRLSVLPEHLGSSRRPRHECPVGY-TSKDGTCIDIDECAFRK-----PCQHECRNTIGSYQCT----CPPGYQLLSNGRTCKDIDECTVQGVQCGPNQMCFNTRGGYQCLDTPCPNSYQRGRNPGTC--------FRPCSS 4095          

HSP 6 Score: 134.42 bits (337), Expect = 3.979e-31
Identity = 90/246 (36.59%), Postives = 121/246 (49.19%), Query Frame = 3
Query: 1959 CPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-ILTSNNTCADVNECL----LFRPEESCPDLEARCVNTAGSYKCQ--CPKGFEWSDYPIKKCTDINECL--AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYEC--KCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            CP G F     S C D DEC       P +  C N +G + C C  G+ I T +N+C D++EC     L  P +       +CVNT G+Y+CQ  C  GF+ S      C D++EC   A +PC  + QC NT+GS++C C  GY+L   G  C DI+ECL       +  C N  G Y+C   CP G  A    +C DIDEC     +C      +  ++C N +G Y CV   CP GY  +  G
Sbjct: 3677 CPKG-FILDTASYCADEDECAVDS---PCSHSCNNNMGGFSCACPSGFTISTESNSCQDIDECSQGSHLCHPNQ-------QCVNTVGTYRCQAKCGLGFKPSLVG-TSCEDVDECQESAVSPC--QQQCFNTLGSFRCTCHPGYQLV--GHRCLDINECLRNVCPA-HQQCRNTDGGYQCFDSCPAGMTAAENGVCVDIDECQDGSHMC------RYSQICQNTIGGYGCV---CPRGYRSQGVG 3896          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: BX663503.3 (latent-transforming growth factor beta-binding protein 4 [Source:NCBI gene;Acc:100333499])

HSP 1 Score: 211.46 bits (537), Expect = 2.129e-55
Identity = 215/597 (36.01%), Postives = 293/597 (49.08%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFK-HSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC---------------EDDECPINMKRNNKGICSRCKDGFY------FKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV--------------------ASPCAPSQQFDYSVG--KCM-CRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN-CQDVDECETGEGKCPQNMHCVNVVGSYKCM-CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC-KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGR-LCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
            GF+ N     C D NEC       +  E CVNT GSFRC C  G++ +S+  +C D+DEC  V     + +C+N +GS++C+    C  G+K     N C+D+DEC   P  C PG +CVN +GS+RC               + DEC         G C      F       ++ +  +C D++EC         +C   + C N  GSY C+    CRPG  L +NG AC+DIDEC+Q    C+ + +C NT  S+ CV                     S C P Q+   S G  +C+ CR G+   ++  C+D+DEC +    +LC +   C N  GSY+C     C PG FR  +  N C+DV+ECE  E +CP  M CVN VGS+KC+ C  G+ L  +  C DV+EC   R    C +   +C NT GS++C C  GF   D     CTD++EC+    C    QC+N+ GSYKC  C  G+  S+    C DIDEC+ +       +CVN  G Y C C PG+ AA     C+DI+EC         E DF   R  C+N  G YKCV   C  GY  K   NG  C+
Sbjct:  820 GFILNPQQGHCQDKNECVLTPRPCSVGE-CVNTPGSFRCVCPAGYQTNSQQTLCVDLDECRQVPNPCINGRCENTLGSFRCV----CRTGYKLQ--DNSCIDIDEC-VDPLRC-PGKECVNSQGSYRCVSCRPGFDLLNGQCSDIDECRRTPSPCPDGRCENTAGSFRCSCRTGYRLQANTCVDVNECE-----DPSQCPGQE-CLNSQGSYRCV---SCRPGFGL-RNG-ACSDIDECRQTPSPCQ-NGLCENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQC-PGQECLNSQGSYRCVSCRPGFGL-RNGACSDIDECRQT--PDLCVNGR-CENTMGSYSC----SCRPG-FR--LEENICKDVNECEN-ELQCP-GMECVNSVGSFKCVSCKPGFQLL-DGQCQDVDEC--SRTPRRCTN--GQCKNTPGSFRCVCDVGFHLQD---GVCTDMDECVDPLQC-PGQQCINSPGSYKCVPCRDGH--SMQSGRCTDIDECVSDQVCGAQSVCVNTDGSYRCDCAPGYRAAGAGRQCRDINEC--------LEGDFCFPRGECVNTDGSYKCV---CSQGY--KSVANGTSCQ 1357          

HSP 2 Score: 200.29 bits (508), Expect = 9.006e-52
Identity = 189/571 (33.10%), Postives = 260/571 (45.53%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------------EDDECPINMKRNNKGI--CSRCKDGFYFKKETRSCEDIDECTMN------------VGWYNGRCKE---------TDV-------------CFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECL--LFRPEESCPD----------------------------------LEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYEC 2474
            G+  N    +C D++EC +  N C N    C NT+GSFRC C+ G+K      C DIDEC++   C   K+C N+ GSY+C+   P GF    D     C D+DEC   P  C P  +C N  GS RC                    +  +CP     N++G   C  C+ GF  +    +C DIDEC               +G +   C+          TDV             C N  GSY C+    CRPG  L +NG AC+DIDEC+Q    C  +  C NT  SY                   C CR G+R  +++IC DV+EC EN  +  C  +  C+N  GS+ C+    C PG     +   CQDVDEC     +C  N  C N  GS++C+CD G+ L  +  C D++EC+  L  P + C +                                   ++ CVNT GSY+C C  G+  +    ++C DINECL  + C  + +CVNT GSYKC C QGY+   +G +C+D+DEC L+   C +G C N  G + C
Sbjct:  862 GYQTNSQQTLCVDLDECRQVPNPCINGR--CENTLGSFRCVCRTGYKLQD-NSCIDIDECVDPLRCPG-KECVNSQGSYRCVSCRP-GF----DLLNGQCSDIDECRRTPSPC-PDGRCENTAGSFRCSCRTGYRLQANTCVDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGLRNG--ACSDIDECRQTPSPCQNGLCENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQCPGQECLNSQGSYRCV---SCRPGFGL-RNG-ACSDIDECRQTPDLCV-NGRCENTMGSY------------------SCSCRPGFRL-EENICKDVNEC-EN--ELQCPGME-CVNSVGSFKCV---SCKPGF--QLLDGQCQDVDECSRTPRRC-TNGQCKNTPGSFRCVCDVGFHL-QDGVCTDMDECVDPLQCPGQQCINSPGSYKCVPCRDGHSMQSGRCTDIDECVSDQVCGAQSVCVNTDGSYRCDCAPGYRAAGAG-RQCRDINECLEGDFCFPRGECVNTDGSYKCVCSQGYKSVANGTSCQDVDECALD-GVCQDGRCSNTEGSFLC 1382          

HSP 3 Score: 190.274 bits (482), Expect = 1.113e-48
Identity = 184/533 (34.52%), Postives = 238/533 (44.65%), Query Frame = 3
Query: 1143 GSFRCDCQKGF-KHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGM-FRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNEC--------------------LLFRPE--------------ESCPDL--EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKC-KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQ-NGRLCINLLGYYKCV 2621
            G   C C  GF  + + G C+D +EC+         +C N  GS++C+    C  G++ +     CVD+DEC   P  C  G +C N  GS RC                   C+ G+  K +  SC DIDEC   +     RC   + C N  GSY C+    CRPG  L  NG  C+DIDEC++    C PD  C NT  S+                  +C CR GYR  Q + C DV+EC +    + C     C+N  GSY C+    C PG   R+     C D+DEC      C QN  C N +GS++C+C  GY L    TC DVNEC                    +  RP                  PDL    RC NT GSY C C  GF   +     C D+NEC     C    +CVN+VGS+KC  C  G++L + G  C+D+DEC   PR+C NG C N PG + C C  GF   +  +C D+DEC             Q  G+ CIN  G YKCV
Sbjct:  811 GRHTCVCNTGFILNPQQGHCQDKNECVLTPRPCSVGECVNTPGSFRCV----CPAGYQTNSQQTLCVDLDECRQVPNPCING-RCENTLGSFRCV------------------CRTGY--KLQDNSCIDIDECVDPL-----RCPGKE-CVNSQGSYRCV---SCRPGFDLL-NG-QCSDIDECRRTPSPC-PDGRCENTAGSF------------------RCSCRTGYRL-QANTCVDVNECED---PSQCPGQE-CLNSQGSYRCV---SCRPGFGLRNGA---CSDIDECRQTPSPC-QNGLCENTLGSFRCVCRTGYRL-QGGTCTDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGLRNGACSDIDECRQTPDLCVNGRCENTMGSYSCSCRPGFRLEE---NICKDVNECENELQC-PGMECVNSVGSFKCVSCKPGFQL-LDGQ-CQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGFHL-QDGVCTDMDECV---------DPLQCPGQQCINSPGSYKCV 1259          

HSP 4 Score: 73.559 bits (179), Expect = 1.158e-12
Identity = 56/156 (35.90%), Postives = 75/156 (48.08%), Query Frame = 3
Query: 2184 ARCVNT-AGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
             RC++   G + C C  GF  +      C D NEC L   PC    +CVNT GS++C C  GY+ +     C D+DEC   P  C+NG C N  G + C C  G+   +   C DIDEC         +     G+ C+N  G Y+CV  SC  G+
Sbjct:  803 GRCIDLPGGRHTCVCNTGFILNPQQ-GHCQDKNECVLTPRPCSVG-ECVNTPGSFRCVCPAGYQTNSQQTLCVDLDECRQVPNPCINGRCENTLGSFRCVCRTGYKL-QDNSCIDIDECV--------DPLRCPGKECVNSQGSYRCV--SCRPGF 945          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: si:ch73-105b23.1 (si:ch73-105b23.1 [Source:ZFIN;Acc:ZDB-GENE-081107-41])

HSP 1 Score: 211.075 bits (536), Expect = 2.440e-55
Identity = 190/546 (34.80%), Postives = 262/546 (47.99%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGP--GMK-CVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAAN-PCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSE 2693
            C DINEC+T N   +   +C N  G   C C+ GF  +    C D +EC    IC  +  C NN GSY C     C  G+K + +   C+DVDEC   P +C    G K C N++G++ C                   C  G  ++   ++C DI+EC +N       C     C NLPGSY C     C  G     NG+AC DI+EC + K  C+P+ +C N   SY                  KC CR G+     + CTD++ECA    DN+C ++  C+N  GS+ C    +C  G   +   + C D+DEC    G C     C N+ GSYKC C  G+       C DV+EC+    E+ C  + A C+N+ G Y C C  G+  +   + +CTDINECL  N  C  +  C N+ GSY C C  G+RL ++  TC+DIDEC L  + C  N  C N+ G Y C+C  GF+    + C DI+EC        ++   QN   C+NL+G Y C   +C  G+     GNG  CE  +E
Sbjct:   26 CQDINECQTNNGDCHANALCTNKDGGRDCSCRSGFSGNGF-QCTDDNECARPGICHWNATCTNNPGSYVCT----CNSGYKGNGNY-LCLDVDECSETPGVCSALLGYKGCKNLQGTYTC------------------LCNSG--YQSNGQTCVDINECQINF------CSPFADCTNLPGSYRCT----CPEG--FNGNGLACVDINECDR-KNSCDPNALCTNLLGSY------------------KCSCRSGFL-GIGTKCTDINECAT---DNICPAVAACVNTAGSFFC----DCGQGY--NFTQNQCVDLDECAI--GLCSPYASCENMPGSYKCSCIAGF-KGDGLVCEDVDECVT---EKRC-HVNALCINSPGKYNCSCMVGYTGNG--VSQCTDINECLVDNGGCKNRATCSNSKGSYSCICPSGFRL-VNHTTCQDIDECQLPEKVCGTNEQCTNLEGSYSCQCKAGFSRIIDDFCSDINECDI------QKPCHQNAT-CLNLVGSYSC---TCKSGF----KGNGVTCEDINE 480          

HSP 2 Score: 208.764 bits (530), Expect = 1.469e-54
Identity = 173/481 (35.97%), Postives = 225/481 (46.78%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKC-IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDEC-AENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAA 2498
            + C DINEC+  N C+  +  C N  GS+RC C +GF  + L  C DI+EC   N C  +  C N +GSYKC  RS   G G K       C D++EC A   IC     CVN  GS  C+                  C  G+ F +    C D+DEC +      G C     C N+PGSY C     C  G     +G+ C D+DEC   K RC  + +C+N+   Y+C                   C  GY  N  S CTD++EC  +NGG   C +   C N  GSY+CI    CP G FR   ++ CQD+DEC+  E  C  N  C N+ GSY C C  G+    ++ C+D+NEC + +P        A C+N  GSY C C  GF+ +      C DINEC     C     C N +G Y C C QG+  +  G TC D+DEC +    C    +CVN  G Y C C  G  A
Sbjct:  150 QTCVDINECQI-NFCS-PFADCTNLPGSYRCTCPEGFNGNGLA-CVDINECDRKNSCDPNALCTNLLGSYKCSCRSGFLGIGTK-------CTDINEC-ATDNICPAVAACVNTAGSFFCD------------------CGQGYNFTQ--NQCVDLDECAI------GLCSPYASCENMPGSYKC----SCIAG--FKGDGLVCEDVDECVTEK-RCHVNALCINSPGKYNC------------------SCMVGYTGNGVSQCTDINECLVDNGG---CKNRATCSNSKGSYSCI----CPSG-FRLVNHTTCQDIDECQLPEKVCGTNEQCTNLEGSYSCQCKAGFSRIIDDFCSDINECDIQKPCHQ----NATCLNLVGSYSCTCKSGFKGNGV---TCEDINECALGGICHLHANCYNYIGEYLCVCHQGF--TGDGVTCTDVDECYVSNATCPGISVCVNSLGAYVCSCLNGTVA 551          

HSP 3 Score: 200.29 bits (508), Expect = 7.516e-52
Identity = 187/550 (34.00%), Postives = 249/550 (45.27%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVAS-PCAPSQQFDYSVGKCM----------------------------CRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDT-CEDIDECLLEPRK--CLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
             C DI+ECE  N C  K   CVN  GSF C C++G+  +    C D+DEC   V+ CS   +C N VGS+ C     C  G+    D  +C D++EC      C P   C N  GS +C    CP+ M             GF        C+D+DEC  N    +  C     C N  GSY C    KC  G     NG  C+D+DEC        P  IC N  +  +   +  C  +    Y +G C+                            C  G+  N    C D+DEC++ G    C +L  C N  GS+ C    +C  G   +  +  C D++EC  G   CP N  C N VG Y C C+ G+I + N+ C DV+EC   + +  CP+  + C NT GSY C+C  G+  +      C D+NECL  + C     CVNT+GS+ C C  G+ L+ + DT CEDIDEC        C NG C+N  G + C C  GF ++    C DIDECS S+     ES  Q    C N+ G YKC
Sbjct:  594 TCSDIDECE-ENVCPEKETQCVNNPGSFECTCKEGYSFNGT-KCTDLDECESGVSNCSKFAQCVNTVGSHLCF----CLSGFT--GDGKNCSDINECHFQNGGCHPVASCTNSPGSFKCT---CPLGMT----------GSGF-------DCQDVDECNANSTLPH-NCSLLSTCHNTEGSYIC----KCMEG--YWGNGFTCSDLDECF-------PPSICGNNMTCQNFPGTFTCTCTLGLVYDLGTCVTEKDCKNATNACNIYAECKNVHGSNYCSCMKGFHGNGRD-CKDLDECSQIGA---CPNLSNCFNTEGSFHC----DCLQGYQYNGTH--CDDINECSVGNFSCPVNSTCYNEVGGYNCSCNNGFIYSYNSVCLDVDECATGKAQ--CPN-ASNCHNTVGSYYCECWDGYIGNQ---TICEDVNECLNNSRCSDHSICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSICTNGTCLNTIGSFGCVCDMGFRSNGTS-CFDIDECSGSQ----NESICQLHSTCSNIPGSYKC 1080          

HSP 4 Score: 179.489 bits (454), Expect = 2.414e-45
Identity = 177/604 (29.30%), Postives = 264/604 (43.71%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEI---CVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------EDDECPINMKRNNKGICSRCKDGFY------FKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC---------------VASPCAPSQQFDYSV-------GKCMCRDGYRQN--QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMH--CVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGY------------------------------------RLSISGDT--CEDIDECLLEPRKCL-NGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            C D++EC   +   +   +   C NT GS+ C C +G+  +    C D+DEC   +IC ++  C+N  G++ C     C  G   D  T  CV   +C+     C    +C N+ GS+ C              + DEC       N   C   +  F+      ++     C+DI+EC++     N  C     C+N  G Y+C     C  G + + N + C D+DEC   K +C     C NT  SY+C               V      S+  D+S+         C+C DG+  N   D+ C D+DEC+     ++C +   C+N  GS+ C+    C  G FRS+  S C D+DEC   + +    +H  C N+ GSYKC CD G++L +   C D++ECL    ++S     + C+N+ GS++C C  GF+       KCTDINECL+   C     C+N  GSY C C  G+                                    RL   G+   C+DIDEC     +C  +  C+N PG Y C C  GF A    +C D+DEC  + G+C   +       C N +G ++C
Sbjct:  717 CQDVDECNANSTLPHNCSLLSTCHNTEGSYICKCMEGYWGNGF-TCSDLDECFPPSICGNNMTCQNFPGTFTCT----CTLGLVYDLGT--CVTEKDCKNATNACNIYAECKNVHGSNYCSCMKGFHGNGRDCKDLDECSQIGACPNLSNCFNTEGSFHCDCLQGYQYNGTHCDDINECSVG----NFSCPVNSTCYNEVGGYNC----SCNNGFIYSYNSV-CLDVDECATGKAQCPNASNCHNTVGSYYCECWDGYIGNQTICEDVNECLNNSRCSDHSICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSIC-TNGTCLNTIGSFGCV----CDMG-FRSNGTS-CFDIDECSGSQNESICQLHSTCSNIPGSYKCHCDSGFLL-NRTECQDIDECL---ADDSPCTANSVCINSVGSFRCLCASGFKEDGL---KCTDINECLSNGTCRPDQVCINKPGSYLCSCPPGHQEESGNCIDNNECANNTTCHPLARCWNTVGTFTCQCRLGYVGNGTYCKDIDECSTSSSRCHKSSKCINTPGSYVCVCAAGFVA-LGSVCVDLDECQANRGICHPAA------TCYNSIGGFQC 1283          

HSP 5 Score: 167.933 bits (424), Expect = 9.842e-42
Identity = 139/417 (33.33%), Postives = 190/417 (45.56%), Query Frame = 3
Query: 1476 RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSY--------------------HCVASPCAPSQQFDYSVGK-------CMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
             C++G+    +   C+DI+EC  N    NG C    +C N  G  DC     CR G   + NG  C D +EC +    C  +  C N   SY                     C  +P   S    Y   K       C+C  GY+ N  + C D++EC  N     C     C N PGSY    R  CP G   + +   C D++EC+  +  C  N  C N++GSYKC C  G+ L     C D+NEC     +  CP + A CVNTAGS+ C C +G+ ++     +C D++EC A   C     C N  GSYKC C  G++    G  CED+DEC+ E R  +N +C+N PG+Y C C  G+  +    C DI+EC    G C      +N   C N  G Y C+   CP G+
Sbjct:   14 SCQNGY--SGDGFQCQDINECQTN----NGDCHANALCTNKDGGRDC----SCRSG--FSGNGFQCTDDNECARPGI-CHWNATCTNNPGSYVCTCNSGYKGNGNYLCLDVDECSETPGVCSALLGYKGCKNLQGTYTCLCNSGYQSNGQT-CVDINECQIN----FCSPFADCTNLPGSY----RCTCPEGFNGNGLA--CVDINECDR-KNSCDPNALCTNLLGSYKCSCRSGF-LGIGTKCTDINEC---ATDNICPAV-AACVNTAGSFFCDCGQGYNFTQ---NQCVDLDEC-AIGLCSPYASCENMPGSYKCSCIAGFKGD--GLVCEDVDECVTEKRCHVNALCINSPGKYNCSCMVGYTGNGVSQCTDINECLVDNGGC------KNRATCSNSKGSYSCI---CPSGF 385          

HSP 6 Score: 167.162 bits (422), Expect = 1.801e-41
Identity = 166/523 (31.74%), Postives = 227/523 (43.40%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNI-CSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVL-AQNGIACNDIDECKQMKFRCEPDE-------ICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECL---LFRPEE-----------SCPDLE----------------------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL-NGICVNVPGRYECKCPPGFAA 2498
            C D++EC    AC N    C NT GSF CDC +G++++    C+DI+EC   N  C  +  C N VG Y C  S   GF +  +   + C+DVDEC      C     C N  GS+ CE                  C DG+   +    CED++EC       N RC +  +C N  GS+ C+    C  G  L   +   C DIDEC        PD         C+NT  S+ CV                  C  G+R N  S C D+DEC+ +  +++C     C N PGSY C     C  G   +   + CQD+DEC   +  C  N  C+N VGS++C+C  G+       C D+NECL     RP++           SCP                         ARC NT G++ CQC  G+  +      C DI+EC  +++ C K  +C+NT GSY C C  G+     G  C D+DEC      C     C N  G ++C+C  G+ A
Sbjct:  842 CKDLDECSQIGACPN-LSNCFNTEGSFHCDCLQGYQYNGT-HCDDINECSVGNFSCPVNSTCYNEVGGYNC--SCNNGFIYSYN---SVCLDVDECATGKAQCPNASNCHNTVGSYYCE------------------CWDGYIGNQTI--CEDVNEC-----LNNSRCSDHSICVNTLGSFMCL----CDDGFTLNGTSDTQCEDIDECSN------PDNGSICTNGTCLNTIGSFGCV------------------CDMGFRSNGTS-CFDIDECSGSQNESICQLHSTCSNIPGSYKC----HCDSGFLLNR--TECQDIDECLADDSPCTANSVCINSVGSFRCLCASGF-KEDGLKCTDINECLSNGTCRPDQVCINKPGSYLCSCPPGHQEESGNCIDNNECANNTTCHPLARCWNTVGTFTCQCRLGYVGNG---TYCKDIDECSTSSSRCHKSSKCINTPGSYVCVCAAGFV--ALGSVCVDLDECQANRGICHPAATCYNSIGGFQCQCGNGWDA 1291          

HSP 7 Score: 166.777 bits (421), Expect = 2.543e-41
Identity = 152/466 (32.62%), Postives = 213/466 (45.71%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPE---ICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQCVNTVGSYKCKCFQGYRLSISG----DTCEDIDECL 2414
            GF++  +  +C D++EC T  A       C NTVGS+ C+C  G+  ++  ICED++EC+N + CSD   C N +GS+ C+     GF      DT  C D+DEC   P+   IC  G  C+N  GS  C  D                      F+    SC DIDEC+ +       C+    C N+PGSY C     C  G +L  N   C DIDEC      C  + +C+N+  S+                  +C+C  G++++    CTD++EC  NG    C    +CIN PGSY C     CPPG    S   NC D +EC      C     C N VG++ C C  GY+  +   C D++EC       S     ++C+NT GSY C C  GF         C D++EC A    C     C N++G ++C+C  G+  S+        C D +ECL
Sbjct:  915 GFIY-SYNSVCLDVDECATGKAQCPNASNCHNTVGSYYCECWDGYIGNQT-ICEDVNECLNNSRCSDHSICVNTLGSFMCLCDD--GFTLNGTSDT-QCEDIDECSN-PDNGSICTNGT-CLNTIGSFGCVCD--------------------MGFRSNGTSCFDIDECSGS--QNESICQLHSTCSNIPGSYKC----HCDSGFLL--NRTECQDIDECLADDSPCTANSVCINSVGSF------------------RCLCASGFKEDGLK-CTDINECLSNG---TCRPDQVCINKPGSYLC----SCPPGHQEES--GNCIDNNECANNT-TCHPLARCWNTVGTFTCQCRLGYV-GNGTYCKDIDEC---STSSSRCHKSSKCINTPGSYVCVCAAGFVALG---SVCVDLDECQANRGICHPAATCYNSIGGFQCQCGNGWDASVGNGRGMGGCIDQNECL 1309          

HSP 8 Score: 155.606 bits (392), Expect = 7.717e-38
Identity = 138/431 (32.02%), Postives = 197/431 (45.71%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG--ICEDIDECMNVN---ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFP--EICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWS---DYPIKKCTDINECLAANPC 2303
            G++ NQ   IC D+NEC   + C++   ICVNT+GSF C C  GF  +      CEDIDEC N +   IC++   C N +GS+ C+    C  G++ +  +  C D+DEC       IC     C NI GS++C                   C  GF   +    C+DIDEC  +    +  C    VC N  GS+ C+    C  G    ++G+ C DI+EC      C PD++C+N   SY C   P                     Q +   C D +ECA N     C  L  C N  G++ C    +C  G   +  Y  C+D+DEC T   +C ++  C+N  GSY C+C  G++    + C D++EC   R         A C N+ G ++CQC  G++ S      +  C D NECL+ N C
Sbjct:  957 GYIGNQ--TICEDVNECLNNSRCSDH-SICVNTLGSFMCLCDDGFTLNGTSDTQCEDIDECSNPDNGSICTN-GTCLNTIGSFGCV----CDMGFRSNGTS--CFDIDECSGSQNESICQLHSTCSNIPGSYKC------------------HCDSGFLLNR--TECQDIDECLAD----DSPCTANSVCINSVGSFRCL----CASG--FKEDGLKCTDINECLS-NGTCRPDQVCINKPGSYLCSCPP-------------------GHQEESGNCIDNNECANN---TTCHPLARCWNTVGTFTC----QCRLGYVGNGTY--CKDIDECSTSSSRCHKSSKCINTPGSYVCVCAAGFVALG-SVCVDLDECQANRGI---CHPAATCYNSIGGFQCQCGNGWDASVGNGRGMGGCIDQNECLSPNVC 1314          

HSP 9 Score: 80.8777 bits (198), Expect = 7.142e-15
Identity = 60/156 (38.46%), Postives = 74/156 (47.44%), Query Frame = 3
Query: 2184 ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            A C NT GSY C C  G+    +   +C DINEC   N  C     C N  G   C C  G+  S +G  C D +EC   P  C  N  C N PG Y C C  G+  +   +C D+DECS + GVCS    ++    C NL G Y C+   C  GY
Sbjct:    2 AVCTNTLGSYTCSCQNGYSGDGF---QCQDINECQTNNGDCHANALCTNKDGGRDCSCRSGF--SGNGFQCTDDNEC-ARPGICHWNATCTNNPGSYVCTCNSGYKGNGNYLCLDVDECSETPGVCSALLGYKG---CKNLQGTYTCL---CNSGY 145          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000044417.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:16691548:16699432:-1 gene:ENSXETG00000002183.1 transcript:ENSXETT00000044417.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.476 bits (563), Expect = 9.820e-61
Identity = 190/527 (36.05%), Postives = 253/527 (48.01%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            C DINEC ++         C+N+ GSFRC+C  GF  S    C DIDEC N  ICS    C+N+ GS+ C     C  G+  +  +  CVDV+EC      C     C N +GS+ C                   CK GF      + C+DIDEC+ N    +G C+   +C N PGS+ C    +C  G     N   C DIDECK +   C  + +C N+  SY                   C C+ G+       C+D+DEC  N           CIN  GSY+C     C  G FR   + NC+DVDEC +  G C +N  C N  GS+ C C+ G+ +T N +CAD+NEC    P   C +  A C NT GS+ C+C  GF  +      C D+NEC    P C    QC+N VGS+ C+C++GY  +  G  C DIDECL  P  C +  +C+N PG Y+C C  GF  +    C+DI+EC   E +  R     NG  CIN +G + C    C VG+
Sbjct:   64 CTDINECLSS--------TCINSEGSFRCECPLGFTVSDFK-CTDIDECKN-GICSPFASCQNSPGSFTC----SCRSGFSGNGTS--CVDVNECIQNNGGCHGNAICNNTQGSYSCS------------------CKGGFVGDGIIQ-CKDIDECSEN----SGICQYGGLCLNTPGSFRC----QCASGFQALNN--TCQDIDECKTVNGNCPLNALCQNSLGSY------------------SCQCKAGFSGINS--CSDIDECLSNPCH---AQATYCINTQGSYSCT----CKEG-FRGDGF-NCKDVDEC-SASGVCGENSRCENSFGSFSCWCNSGFTMT-NGSCADINEC---SPPHPCNE-HANCNNTKGSFLCKCKSGFSGNG---TTCEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGYEKN--GSLCLDIDECL-HPSMCHHHSVCINSPGSYDCICVEGFTGN-GSFCEDINECE-QENITHR---CHNGSQCINTMGSFIC---QCNVGF 496          

HSP 2 Score: 216.083 bits (549), Expect = 8.272e-59
Identity = 183/553 (33.09%), Postives = 245/553 (44.30%), Query Frame = 3
Query: 1140 VGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIK-------------------------------------KCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
             G + C C+ GF      +C DI+EC  +++ C  D  C N VGSY C+    C  G+  D     C D++EC +          C+N  GS RCE   CP+                  F      C DIDEC       NG C     C N PGS+ C     CR G   + NG +C D++EC Q    C  + IC NT  SY                   C C+ G+  +    C D+DEC+EN G  +C    +C+N PGS+    R +C  G    ++ + CQD+DEC+T  G CP N  C N +GSY C C  G+  +  N+C+D++ECL       C      C+NT GSY C C +GF    +  K                                      C DINEC   +PC +   C NT GS+ CKC  G+  S +G TCED++EC  EP  C LN  C+N  G + C+C  G+  +   +C DIDEC     +C   S      +CIN  G Y C+   C  G+    TGNG  CE
Sbjct:    5 AGDYFCVCKTGFDGDGT-VCTDINECAASLHKCHKDSACVNTVGSYSCV----CKSGYTGDGFA--CTDINECLS--------STCINSEGSFRCE---CPLG-----------------FTVSDFKCTDIDECK------NGICSPFASCQNSPGSFTC----SCRSG--FSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSY------------------SCSCKGGFVGDGIIQCKDIDECSENSG--ICQYGGLCLNTPGSF----RCQCASGF--QALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGF--SGINSCSDIDECL----SNPCHAQATYCINTQGSYSCTCKEGFRGDGFNCKDVDECSASGVCGENSRCENSFGSFSCWCNSGFTMTNGSCADINECSPPHPCNEHANCNNTKGSFLCKCKSGF--SGNGTTCEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGYEKN-GSLCLDIDEC-LHPSMCHHHS------VCINSPGSYDCI---CVEGF----TGNGSFCE 461          

HSP 3 Score: 159.073 bits (401), Expect = 8.886e-40
Identity = 151/471 (32.06%), Postives = 205/471 (43.52%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAAN---PCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGI-CVNVPGRY 2468
            C D+NEC   N   +   IC NT GS+ C C+ GF    +  C+DIDEC  N  IC     C N  GS++C     C  G++   +T  C D+DEC+     C     C N  GS+ C+                  CK GF       SC DIDEC  N         +   C N  GSY C  K+  R       +G  C D+DEC      C  +  C N++ S+                   C C  G+     S C D++EC+     + C     C N  GS+ C    +C  G   S   + C+DV+EC      CP N  C+N VGS+ C C  GY   + + C D++ECL      S     + C+N+ GSY C C +GF  +      C DINEC   N    C    QC+NT+GS+ C+C  G+    +G  C D+DEC +    C +   C+N  G Y
Sbjct:  136 CVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGFVGDGIIQCKDIDECSENSGICQYGGLCLNTPGSFRC----QCASGFQALNNT--CQDIDECKTVNGNCPLNALCQNSLGSYSCQ------------------CKAGF---SGINSCSDIDECLSNPCH-----AQATYCINTQGSYSCTCKEGFRG------DGFNCKDVDECSASGV-CGENSRCENSFGSF------------------SCWCNSGFTMTNGS-CADINECSP---PHPCNEHANCNNTKGSFLC----KCKSGF--SGNGTTCEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGY-EKNGSLCLDIDECL----HPSMCHHHSVCINSPGSYDCICVEGFTGNG---SFCEDINECEQENITHRCHNGSQCINTMGSFICQCNVGF--GSNGSLCLDLDECAMNLSNCSSFQNCINTIGSY 529          

HSP 4 Score: 131.339 bits (329), Expect = 8.412e-31
Identity = 122/390 (31.28%), Postives = 176/390 (45.13%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGE--GKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSY 2213
            F      C DI+EC+T N       +C N++GS+ C C+ GF  S +  C DIDEC++    +    C N  GSY C     C  G++ D    +C DVDEC A   +CG   +C N  GS  C                   C  GF       SC DI+EC+         C E   C N  GS+ C    KC+ G   + NG  C D++EC      C  +  C+N   S++                  C C +GY +N  S+C D+DEC      ++C    +CIN PGSY CI    C  G   +  +  C+D++ECE      +C     C+N +GS+ C C+ G+  ++ + C D++EC +     +C   +  C+NT GSY
Sbjct:  212 FQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGF--SGINSCSDIDECLSNPCHAQATYCINTQGSYSC----TCKEGFRGDGF--NCKDVDECSA-SGVCGENSRCENSFGSFSC------------------WCNSGFTMTN--GSCADINECSP-----PHPCNEHANCNNTKGSFLC----KCKSG--FSGNGTTCEDVNECGFEPPVCPLNSQCINEVGSFY------------------CECWEGYEKN-GSLCLDIDECLH---PSMCHHHSVCINSPGSYDCI----CVEGFTGNGSF--CEDINECEQENITHRCHNGSQCINTMGSFICQCNVGF-GSNGSLCLDLDECAM--NLSNCSSFQ-NCINTIGSY 529          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000044344.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:16690183:16699488:-1 gene:ENSXETG00000002183.1 transcript:ENSXETT00000044344.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.705 bits (561), Expect = 1.050e-59
Identity = 195/554 (35.20%), Postives = 258/554 (46.57%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEI-CVNTVGSFRCDCQKGFKHSKLGICEDIDECMNV-NICSDD---KKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC----------------------VASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGI-CVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            GF  N     C D +EC  ++ C   W   C+NT GS+ C C+ GFK +   +C DIDEC     +CS       CKN  GSY+C     C  G++     N CVDVDEC    ++C     C N  GS+ C                   C+ G  F      C DI+EC       N +C     CFNLPGSY+C+    C+PG     NG+ C DIDEC Q    C  +  C+N+  S+ C                      + SP A  Q    S   C CR G+  N  S C DV+EC +N G   C    IC N  GSY+C  +     G F       C+D+DEC    G C     C+N  GS++C C  G+    NNTC D++EC       +CP L A C N+ GSY CQC  GF      I  C+DI+ECL +NPC  +  C NT GS++C C   +    +G  C DIDEC + P  C +   C N+ G Y+C+C  GF  +    C+D++EC+     CS ++      +CIN  G Y C
Sbjct:   97 GFTGNGI--TCMDNDECTASSVC--HWNASCINTPGSYYCSCKSGFKGNGYYLCLDIDECTETPGVCSSAFGFYGCKNLPGSYQCT----CASGYQFTD--NKCVDVDECAN--KVCHVFSNCTNTPGSYSC------------------VCRQG--FNGNGLVCVDINECET-----NNKCHIKANCFNLPGSYNCV----CKPG--FTGNGLVCADIDECAQANI-CPAESTCINSEGSFRCECPLGFTVSDFKCTDIDECKNGICSPFASCQNSPGSF-TCSCRSGFSGNGTS-CVDVNECIQNNGG--CHGNAICNNTQGSYSCSCK-----GGFVGDGIIQCKDIDECSENSGICQYGGLCLNTPGSFRCQCASGFQAL-NNTCQDIDECKTVNG--NCP-LNALCQNSLGSYSCQCKAGFSG----INSCSDIDECL-SNPCHAQATCKNTFGSFECSCNDWFVG--NGFNCTDIDEC-INPSSCHSKANCQNLYGGYKCECFQGFLGN-GFFCEDVNECALKNETCSNDT------VCINSEGSYVC 578          

HSP 2 Score: 216.083 bits (549), Expect = 4.044e-58
Identity = 186/557 (33.39%), Postives = 253/557 (45.42%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNG-ICVNVPGR---------------------------------------YECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            C D++EC  AN   + +  C NT GS+ C C++GF  + L +C DI+EC   N C     C N  GSY C+    C  G+  +     C D+DEC A   IC     C+N  GS RCE   CP+                  F      C DIDEC       NG C     C N PGS+ C     CR G   + NG +C D++EC Q    C  + IC NT  SY                   C C+ G+  +    C D+DEC+EN G  +C    +C+N PGS+    R +C  G    ++ + CQD+DEC+T  G CP N  C N +GSY C C  G+  +  N+C+D++ECL   P  +    +A C NT GS++C C   F  + +    CTDI+EC+  + C  K  C N  G YKC+CFQG+    +G  CED++EC L+   C N  +C+N  G                                        Y C C  GF  D    C DIDEC  +  VC  ++     R C+N  G Y+C+
Sbjct:  190 CVDVDEC--ANKVCHVFSNCTNTPGSYSCVCRQGFNGNGL-VCVDINECETNNKCHIKANCFNLPGSYNCV----CKPGFTGNGLV--CADIDEC-AQANICPAESTCINSEGSFRCE---CPLG-----------------FTVSDFKCTDIDECK------NGICSPFASCQNSPGSFTC----SCRSG--FSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSY------------------SCSCKGGFVGDGIIQCKDIDECSENSG--ICQYGGLCLNTPGSF----RCQCASGF--QALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGF--SGINSCSDIDECLS-NPCHA----QATCKNTFGSFECSCNDWFVGNGF---NCTDIDECINPSSCHSKANCQNLYGGYKCECFQGFLG--NGFFCEDVNECALKNETCSNDTVCINSEGSYVCSCLNGTLLVNGSCVMPSSACRPTCHPKGLCHKTFMGYRCVCDVGFQGDGVS-CADIDEC--TRDVCKDDT-----RFCVNTPGSYRCI 658          

HSP 3 Score: 183.341 bits (464), Expect = 3.192e-47
Identity = 164/481 (34.10%), Postives = 218/481 (45.32%), Query Frame = 3
Query: 1263 VGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYH--------------------CVASPCAPSQQFDYSVGK-------CMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL-NGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
             G Y C+    C  G+  D D   C D++EC A    C     CVN  GS+ C                   CK G  +  +  +C DI+EC       NG C +   C N PGS      + C   +    NGI C D DEC      C  +  C+NT  SY+                    C  +P   S  F +   K       C C  GY Q  D+ C DVDECA    + +C     C N PGSY+C+    C  G   + +   C D++ECET   KC    +C N+ GSY C+C  G+  T N   CAD++EC        CP  E+ C+N+ GS++C+CP GF  SD+   KCTDI+EC     C     C N+ GS+ C C  G+  S +G +C D++EC+     C  N IC N  G Y C C  GF  D    C+DIDECS + G+C      Q G LC+N  G ++C
Sbjct:    5 AGDYFCV----CKTGF--DGDGTVCTDINECAASLHKCHKDSACVNTVGSYSC------------------VCKSG--YTGDGFACTDINECLS----ANGGCHKDASCANTPGS------RICTCNSGFTGNGITCMDNDECTASSV-CHWNASCINTPGSYYCSCKSGFKGNGYYLCLDIDECTETPGVCSSAFGFYGCKNLPGSYQCTCASGY-QFTDNKCVDVDECA----NKVCHVFSNCTNTPGSYSCV----CRQGFNGNGLV--CVDINECET-NNKCHIKANCFNLPGSYNCVCKPGF--TGNGLVCADIDEC---AQANICP-AESTCINSEGSFRCECPLGFTVSDF---KCTDIDECKNG-ICSPFASCQNSPGSFTCSCRSGF--SGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGFVGDGIIQCKDIDECSENSGIC------QYGGLCLNTPGSFRC 418          

HSP 4 Score: 174.866 bits (442), Expect = 1.587e-44
Identity = 175/540 (32.41%), Postives = 234/540 (43.33%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------EDDECPINMKR-NNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSY------------------HCVASPCAPSQQFDYSVG--KCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDL---EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDT-CEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKEICQDI 2525
            FN    +C DINECET N C  K   C N  GS+ C C+ GF  + L +C DIDEC   NIC  +  C N+ GS++C    P GF   +      C D+DEC+    IC P   C N  GS  C              + +EC  N    +   IC+         CK GF        C+DIDEC+ N    +G C+   +C N PGS+ C    +C  G     N   C DIDECK +   C  + +C N+  SY                   C+++PC        + G  +C C D +  N  + CTD+DEC      + C S   C N  G Y C    EC  G   +  +  C+DV+EC      C  +  C+N  GSY C C  G +L  N +C          P  +C      +  C  T   Y+C C  GF+        C DI+EC           CVNT GSY+C C  G+ L+   DT C DIDEC    + C     C N  G YEC+C  GF  + +   +++
Sbjct:  222 FNGNGLVCVDINECETNNKCHIKAN-CFNLPGSYNCVCKPGFTGNGL-VCADIDECAQANICPAESTCINSEGSFRC--ECPLGFTVSDFK----CTDIDECKN--GICSPFASCQNSPGSFTCSCRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGF-VGDGIIQCKDIDECSEN----SGICQYGGLCLNTPGSFRC----QCASGFQALNN--TCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGFSGINSCSDIDECLSNPCHAQATCKNTFGSFECSCNDWFVGNGFN-CTDIDECIN---PSSCHSKANCQNLYGGYKC----ECFQGFLGNGFF--CEDVNECALKNETCSNDTVCINSEGSYVCSCLNGTLLV-NGSCV--------MPSSACRPTCHPKGLCHKTFMGYRCVCDVGFQGDGV---SCADIDECTRDVCKDDTRFCVNTPGSYRCICKNGFFLN---DTHCSDIDECATGAQDCHPLAECFNTVGSYECRCQTGFHGNGRNCTENL 715          

HSP 5 Score: 145.976 bits (367), Expect = 3.692e-35
Identity = 122/354 (34.46%), Postives = 161/354 (45.48%), Query Frame = 3
Query: 1599 PGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDEC-AENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
             G Y C+ K      T    +G  C DI+EC     +C  D  CVNT  SY CV                  C+ GY  +  + CTD++EC + NGG   C     C N PGS  C     C  G   + +   C D DEC T    C  N  C+N  GSY C C  G+       C D++EC       S       C N  GSY+C C  G++++D    KC D++EC A   C     C NT GSY C C QG+    +G  C DI+EC    +  +   C N+PG Y C C PGF  +   +C DIDEC+ +  +C  ES       CIN  G ++C    CP+G+T  +
Sbjct:    5 AGDYFCVCK------TGFDGDGTVCTDINECAASLHKCHKDSACVNTVGSYSCV------------------CKSGYTGDGFA-CTDINECLSANGG---CHKDASCANTPGSRICT----CNSGFTGNGI--TCMDNDEC-TASSVCHWNASCINTPGSYYCSCKSGFKGNGYYLCLDIDECTETPGVCSSAFGFYGCKNLPGSYQCTCASGYQFTD---NKCVDVDEC-ANKVCHVFSNCTNTPGSYSCVCRQGFNG--NGLVCVDINECETNNKCHIKANCFNLPGSYNCVCKPGFTGNGL-VCADIDECAQAN-ICPAES------TCINSEGSFRC---ECPLGFTVSD 306          

HSP 6 Score: 125.946 bits (315), Expect = 7.827e-29
Identity = 120/376 (31.91%), Postives = 161/376 (42.82%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNI-CSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV---------------ASPCAPSQQ------FDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY 2102
            GF+ +  ++ C DI+EC   +       +C+NT GSFRC C  GF+ +    C+DIDEC  VN  C  +  C+N++GSY C     C  G+      N C D+DEC + P  C     C N  GS  C                   C D  +F     +C DIDEC          C     C NL G Y C    +C  G     NG  C D++EC      C  D +C+N+  SY C                +S C P+          +   +C+C  G++ +  S C D+DEC     D        C+N PGSY CI    C  G F +  +  C D+DEC TG   C     C N VGSY+C C  G+
Sbjct:  381 GFVGDGIIQ-CKDIDECSENSGICQYGGLCLNTPGSFRCQCASGFQ-ALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSC----QCKAGFS---GINSCSDIDECLSNP--CHAQATCKNTFGSFECS------------------CND--WFVGNGFNCTDIDECINP-----SSCHSKANCQNLYGGYKC----ECFQG--FLGNGFFCEDVNECALKNETCSNDTVCINSEGSYVCSCLNGTLLVNGSCVMPSSACRPTCHPKGLCHKTFMGYRCVCDVGFQGDGVS-CADIDECTR---DVCKDDTRFCVNTPGSYRCI----CKNGFFLNDTH--CSDIDECATGAQDCHPLAECFNTVGSYECRCQTGF 704          

HSP 7 Score: 108.612 bits (270), Expect = 1.747e-23
Identity = 94/254 (37.01%), Postives = 121/254 (47.64%), Query Frame = 3
Query: 1998 CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGI----CVNVPGRYECKCPPGFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPND-----ADCLN 2729
            C D++EC     KC ++  CVN VGSY C+C  GY       C D+NECL       C   +A C NT GS  C C  GF  +      C D +EC A++ C     C+NT GSY C C  G++ +     C DIDEC   P  C +      C N+PG Y+C C  G+   D K  C D+DEC+    VC   S+      C N  G Y CV   C  G+     GNG +C   +E  CE N+     A+C N
Sbjct:   23 CTDINECAASLHKCHKDSACVNTVGSYSCVCKSGYT-GDGFACTDINECL--SANGGCHK-DASCANTPGSRICTCNSGFTGNGI---TCMDNDECTASSVCHWNASCINTPGSYYCSCKSGFKGN-GYYLCLDIDECTETPGVCSSAFGFYGCKNLPGSYQCTCASGYQFTDNK--CVDVDECANK--VCHVFSN------CTNTPGSYSCV---CRQGF----NGNGLVCVDINE--CETNNKCHIKANCFN 249          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000044357.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:16691548:16699432:-1 gene:ENSXETG00000002183.1 transcript:ENSXETT00000044357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 1.413e-59
Identity = 199/613 (32.46%), Postives = 261/613 (42.58%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVN-ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECL------------LFRPEE------------------------SCPDLEARCVNTAGSYKCQCPKGFEWSDYPIK-------------------------------------KCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
            +C DINEC  +    +K   CVNTVGS+ C C+ G+       C DI+EC++ N  C  D  C N  GS    R   C  G+  +  T  C+D DEC A          C+N  GS RC   ECP+                  F      C DIDEC       NG C     C N PGS+ C     CR G   + NG +C D++EC Q    C  + IC NT  SY                   C C+ G+  +    C D+DEC+EN G  +C    +C+N PGS+    R +C  G    ++ + CQD+DEC+T  G CP N  C N +GSY C C  G+  +  N+C+D++ECL             F   E                        SC      C+NT GSY C C +GF    +  K                                      C DINEC   +PC +   C NT GS+ CKC  G+  S +G TCED++EC  EP  C LN  C+N  G + C+C  G+  +   +C DIDEC     +C   S      +CIN  G Y C+   C  G+    TGNG  CE
Sbjct:   22 VCTDINECAASLHKCHKDSACVNTVGSYSCVCKSGYTGDGFA-CTDINECLSANGGCHKDASCANTPGS----RICTCNSGFTGNGIT--CMDNDECTA------SSSTCINSEGSFRC---ECPLG-----------------FTVSDFKCTDIDECK------NGICSPFASCQNSPGSFTC----SCRSG--FSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSY------------------SCSCKGGFVGDGIIQCKDIDECSENSG--ICQYGGLCLNTPGSF----RCQCASGF--QALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGF--SGINSCSDIDECLSNPCHAQATCKNTFGSFECSCNDWFVGNGFNCTDIDECINPSSCHSKANYCINTQGSYSCTCKEGFRGDGFNCKDVDECSASGVCGENSRCENSFGSFSCWCNSGFTMTNGSCADINECSPPHPCNEHANCNNTKGSFLCKCKSGF--SGNGTTCEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGYEKN-GSLCLDIDEC-LHPSMCHHHS------VCINSPGSYDCI---CVEGF----TGNGSFCE 544          

HSP 2 Score: 211.46 bits (537), Expect = 6.507e-57
Identity = 181/505 (35.84%), Postives = 244/505 (48.32%), Query Frame = 3
Query: 1089 CETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSY------------------HCVASPCAPSQQFDYSVG--KCMCRDGYRQNQDSICTDVDECAENGGDNLCGS-LYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKEICQDIDEC 2534
            C   + C      C+N+ GSFRC+C  GF  S    C DIDEC N  ICS    C+N+ GS+ C     C  G+  +  +  CVDV+EC      C     C N +GS+ C                   CK GF      + C+DIDEC+ N    +G C+   +C N PGS+ C    +C  G     N   C DIDECK +   C  + +C N+  SY                   C+++PC        + G  +C C D +  N  + CTD+DEC      + C S    CIN  GSY+C     C  G FR   + NC+DVDEC +  G C +N  C N  GS+ C C+ G+ +T N +CAD+NEC    P   C +  A C NT GS+ C+C  GF  +      C D+NEC    P C    QC+N VGS+ C+C++GY  +  G  C DIDECL  P  C +  +C+N PG Y+C C  GF  +    C+DI+EC
Sbjct:  105 CMDNDECTASSSTCINSEGSFRCECPLGFTVSDFK-CTDIDECKN-GICSPFASCQNSPGSFTC----SCRSGFSGNGTS--CVDVNECIQNNGGCHGNAICNNTQGSYSCS------------------CKGGFVGDGIIQ-CKDIDECSEN----SGICQYGGLCLNTPGSFRC----QCASGFQALNN--TCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGFSGINSCSDIDECLSNPCHAQATCKNTFGSFECSCNDWFVGNGFN-CTDIDECIN---PSSCHSKANYCINTQGSYSCT----CKEG-FRGDGF-NCKDVDEC-SASGVCGENSRCENSFGSFSCWCNSGFTMT-NGSCADINEC---SPPHPCNE-HANCNNTKGSFLCKCKSGFSGNG---TTCEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGYEKN--GSLCLDIDECL-HPSMCHHHSVCINSPGSYDCICVEGFTGN-GSFCEDINEC 549          

HSP 3 Score: 177.563 bits (449), Expect = 1.148e-45
Identity = 168/480 (35.00%), Postives = 212/480 (44.17%), Query Frame = 3
Query: 1263 VGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDEC---------KQMKFRCE-------PDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLN--GICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
             G Y C+    C  G+  D D   C D++EC A    C     CVN  GS+ C                   CK G  +  +  +C DI+EC       NG C +   C N PGS  C     C  G     NGI C D DEC          +  FRCE        D  C +     + + SP A  Q    S   C CR G+  N  S C DV+EC +N G   C    IC N  GSY+C  +     G F       C+D+DEC    G C     C+N  GS++C C  G+    NNTC D++EC       +CP L A C N+ GSY CQC  GF      I  C+DI+ECL +NPC  +  C NT GS++C C   +    +G  C DIDEC + P  C +    C+N  G Y C C  GF  D    C+D+DECS S GVC   S       C N  G + C    C  G+T
Sbjct:    5 AGDYFCV----CKTGF--DGDGTVCTDINECAASLHKCHKDSACVNTVGSYSC------------------VCKSG--YTGDGFACTDINECLS----ANGGCHKDASCANTPGSRIC----TCNSG--FTGNGITCMDNDECTASSSTCINSEGSFRCECPLGFTVSDFKCTDIDECKNGICSPFASCQNSPGSF-TCSCRSGFSGNGTS-CVDVNECIQNNGG--CHGNAICNNTQGSYSCSCK-----GGFVGDGIIQCKDIDECSENSGICQYGGLCLNTPGSFRCQCASGF-QALNNTCQDIDECKTVNG--NCP-LNALCQNSLGSYSCQCKAGFSG----INSCSDIDECL-SNPCHAQATCKNTFGSFECSCNDWFVG--NGFNCTDIDEC-INPSSCHSKANYCINTQGSYSCTCKEGFRGDGFN-CKDVDECSAS-GVCGENS------RCENSFGSFSCW---CNSGFT 416          

HSP 4 Score: 163.696 bits (413), Expect = 3.987e-41
Identity = 149/451 (33.04%), Postives = 205/451 (45.45%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLE 2420
            C D+NEC   N   +   IC NT GS+ C C+ GF    +  C+DIDEC  N  IC     C N  GS++C     C  G++   +T  C D+DEC+     C     C N  GS+ C+                  CK GF       SC DIDEC  N       C     C N  GS++C              NG  C DIDEC            C+NT  SY                   C C++G+R +  + C DVDEC+ +G   +CG    C N  GS++C     C  G   ++   +C D++EC      C ++ +C N  GS+ C C  G+   +  TC DVNEC    P   CP L ++C+N  GS+ C+C +G+E +      C DI+ECL  + C     C+N+ GSY C C +G+  + +G  CEDI+EC  E
Sbjct:  179 CVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGFVGDGIIQCKDIDECSENSGICQYGGLCLNTPGSFRC----QCASGFQALNNT--CQDIDECKTVNGNCPLNALCQNSLGSYSCQ------------------CKAGF---SGINSCSDIDECLSN------PCHAQATCKNTFGSFECSCND------WFVGNGFNCTDIDECINPSSCHSKANYCINTQGSY------------------SCTCKEGFRGDGFN-CKDVDECSASG---VCGENSRCENSFGSFSCW----CNSGFTMTN--GSCADINECSPPH-PCNEHANCNNTKGSFLCKCKSGF-SGNGTTCEDVNECGFEPP--VCP-LNSQCINEVGSFYCECWEGYEKNG---SLCLDIDECLHPSMCHHHSVCINSPGSYDCICVEGF--TGNGSFCEDINECEQE 552          

HSP 5 Score: 107.842 bits (268), Expect = 2.532e-23
Identity = 106/344 (30.81%), Postives = 151/344 (43.90%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDE--------CPINMKRNNKGIC---SRCKDGF---------YFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECE 2021
            F      C DI+EC+T N       +C N++GS+ C C+ GF  S +  C DIDEC++ N C     CKN  GS++C  +      W      N C D+DEC            C+N +GS+ C   E        C    + +  G+C   SRC++ F          F     SC DI+EC+         C E   C N  GS+ C    KC+ G   + NG  C D++EC      C  +  C+N   S++                  C C +GY +N  S+C D+DEC      ++C    +CIN PGSY CI    C  G   +  +  C+D++ECE
Sbjct:  255 FQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGF--SGINSCSDIDECLS-NPCHAQATCKNTFGSFECSCN-----DWFVGNGFN-CTDIDECINPSSCHSKANYCINTQGSYSCTCKEGFRGDGFNCKDVDECSASGVCGENSRCENSFGSFSCWCNSGFTMTNGSCADINECSP-----PHPCNEHANCNNTKGSFLC----KCKSG--FSGNGTTCEDVNECGFEPPVCPLNSQCINEVGSFY------------------CECWEGYEKN-GSLCLDIDECLH---PSMCHHHSVCINSPGSYDCI----CVEGFTGNGSF--CEDINECE 550          

HSP 6 Score: 93.9745 bits (232), Expect = 6.312e-19
Identity = 86/291 (29.55%), Postives = 129/291 (44.33%), Query Frame = 3
Query: 1044 FLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYIC 1916
            F+ N F   C DI+EC   ++C +K   C+NT GS+ C C++GF+      C+D+DEC    +C ++ +C+N+ GS+ C     C  G+     +  C D++EC   P  C     C N +GS  C                  +CK GF     T  CED++EC    G+    C     C N  GS+ C    +C  G    +NG  C DIDEC      C    +C+N+  SY C+                  C +G+  N  S C D++EC +    + C ++  C
Sbjct:  334 FVGNGFN--CTDIDECINPSSCHSKANYCINTQGSYSCTCKEGFRGDGFN-CKDVDECSASGVCGENSRCENSFGSFSCW----CNSGFTMTNGS--CADINECSP-PHPCNEHANCNNTKGSFLC------------------KCKSGFSGNGTT--CEDVNEC----GFEPPVCPLNSQCINEVGSFYC----ECWEG--YEKNGSLCLDIDECLHPSM-CHHHSVCINSPGSYDCI------------------CVEGFTGN-GSFCEDINECEQENITHRCHNVAAC 564          

HSP 7 Score: 79.7221 bits (195), Expect = 1.486e-14
Identity = 61/154 (39.61%), Postives = 73/154 (47.40%), Query Frame = 3
Query: 2202 AGSYKCQCPKGFEWSDYPIKKCTDINECLAA-NPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL-NGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            AG Y C C  GF   D     CTDINEC A+ + C K   CVNTVGSY C C  GY  +  G  C DI+ECL     C  +  C N PG   C C  GF  +    C D DEC+ S               CIN  G ++C    CP+G+T  +
Sbjct:    5 AGDYFCVCKTGF---DGDGTVCTDINECAASLHKCHKDSACVNTVGSYSCVCKSGY--TGDGFACTDINECLSANGGCHKDASCANTPGSRICTCNSGFTGNGI-TCMDNDECTASS------------STCINSEGSFRC---ECPLGFTVSD 137          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: FBN2 (fibrillin 2 (congenital contractural arachnodactyly) [Source:NCBI gene;Acc:100494368])

HSP 1 Score: 210.305 bits (534), Expect = 1.290e-54
Identity = 205/612 (33.50%), Postives = 277/612 (45.26%), Query Frame = 3
Query: 1065 EICGDINECETA-NACANKWEICVNTVGSFRCDCQKGFKHS--KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC----------------EDDECPINMK-------RNNKG-ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNM----HCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSIS----------GDTCED-------IDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKIS 2750
            + C DINEC  + N C N    CVN VG+++C C  G++ +  +LG C DIDEC  +N    D  C N+ GSY+C     C  G+   PD   C D+DECE  P+IC  G +C NI G +RC                + +EC IN          N KG     C+ G+  KK T  C D+DEC ++       C     C N+PGS+ C     C+ G +   NGI CND+DEC     RC     C+NT  SYHC                   C +GY  +  + C+DVDEC EN   NLC +   C+N PGSY    R EC  G   +S   +CQD+DEC        QN+     C N+ G ++C+C+ GY L  +   C DV+EC      +    +   CVNT G Y+C CP  F+ +   +  C D         C   H      G+  C    G  +S S          G+ CE        I  C   P  C  G C+N  G ++C+CP G+  ++   IC+DIDEC T  GVC   +       C N LG Y C+   CP  Y +   G+  +   KS      N   C NE P+ ++
Sbjct: 1106 DACVDINECALSDNLCRNGK--CVNIVGTYQCSCNPGYQATLDRLG-CTDIDECTIMNG-GCDTHCTNSEGSYEC----SCLEGYALMPDKRTCTDIDECEDNPDIC-DGGQCTNIPGEYRCLCFDGFMASMDMKTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDECEIDTH----NCHLHATCLNVPGSFKCT----CKEGWI--GNGIKCNDLDECLNGTHRCSVSAHCLNTPGSYHC------------------SCAEGYTGDGFT-CSDVDECTEN--INLCENGQ-CLNIPGSY----RCECDMGFTPASDSRSCQDIDECAF------QNICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECA-----DPINCVNGFCVNTPGRYECNCPPDFQLNPTGVG-CVDTR----VGNCYLNHG-ARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSYIFMCQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFTHPGVCGPGT-------CYNTLGNYTCI---CPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVT 1645          

HSP 2 Score: 197.978 bits (502), Expect = 1.065e-50
Identity = 187/542 (34.50%), Postives = 246/542 (45.39%), Query Frame = 3
Query: 1077 DINECET-ANACANKWEICVNTVGSFRCDCQKGFK-HSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKC--IRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFA-ADRKEICQDIDECSTSEGVCSRESDFQN---GRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            DINEC+     C N    C NT+GSF+C C  GF    +   C DIDEC ++ ++C     C N  GS++C        GF   ++     C+D+DECE  P +C  G +C+N  GS  C                   C +G        +C DI+EC ++     NG+C       N+ G+Y C     C PG     + + C DIDEC  M   C  D  C N+  SY                  +C C +GY    D   CTD+DEC +N   ++C     C N PG Y C+    C  G   S     C DV+EC+     C     C N  GS+ C C  GY +    T C DV+EC +     +C  L A C+N  GS+KC C +G  W    IK C D++ECL   + C     C+NT GSY C C +GY  +  G TC D+DEC      C NG C+N+PG Y C+C  GF  A     CQDIDEC+           FQN      C NL G ++C+   C  GY    TG
Sbjct:  983 DINECKAFPGICTNGK--CRNTIGSFKCKCNNGFALDMEERNCTDIDECRISPDLCGS-GTCINTPGSFECECFEGFESGFMMMKN-----CMDIDECERNPLLC-RGGECINTEGSFLC------------------NCPNGHELTPSGDACVDINECALSDNLCRNGKC------VNIVGTYQC----SCNPGYQATLDRLGCTDIDECTIMNGGC--DTHCTNSEGSY------------------ECSCLEGYALMPDKRTCTDIDECEDN--PDICDGGQ-CTNIPGEYRCL----CFDGFMASMDMKTCIDVNECDINSNIC-MFGECENTKGSFVCHCQVGYAVKKGTTGCTDVDECEI--DTHNC-HLHATCLNVPGSFKCTCKEG--WIGNGIK-CNDLDECLNGTHRCSVSAHCLNTPGSYHCSCAEGY--TGDGFTCSDVDECTENINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQDIDECA-----------FQNICVFGTCSNLPGMFRCI---CNEGYELDRTG 1437          

HSP 3 Score: 190.66 bits (483), Expect = 2.224e-48
Identity = 193/581 (33.22%), Postives = 264/581 (45.44%), Query Frame = 3
Query: 1077 DINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC-----VASPCAPSQQFDYSVGKCM-----------------------CRDGYRQ--NQDSIC----------------------TDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            D+NEC E    CAN    C+NT GSFRC+C  G+     G+ C D DEC   N C +   C N +G+++C+    C  G++  P    C D++EC   P +C    +C+N  G++ C                   C  G+  +++ + C+D+DEC    G+++   +   VC NL G++ CI    C PG V   +G  C D +EC+     CE +  CVNT  SY C       S  + ++  D   G C                        C +G R   NQ  IC                       D+DEC      NLC +   CIN+ GSY C     C PG       + C D+DEC      C  N  C N  GSY+C C RGYIL  +  +C D++EC     + +C  L   CVNT G + C+CP GF         C D NEC   +N CG K  C N+ GS+ C+C +GY L  +G  CED+DEC    R C +G C N+ G Y C CP G+    +   C D +EC+ S+  C   S       C N LG YKC   +CP G+T
Sbjct: 2041 DVNECLENPGICANGH--CINTDGSFRCECPMGYNLDYTGVNCVDTDECSIGNPCGN-GTCTNAIGTFECL----CDEGFEPGP-MMVCEDINECILNPLLCA--FRCINTYGAYEC------------------TCPAGYILREDQKMCKDLDECIE--GFHDCESRGM-VCKNLIGTFMCI----CPPGMVRRPDGEGCMDENECRTKPGICE-NGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDECKVM--PNLCRNGQ-CINNIGSYRCF----CNPGYTTDIGGTACVDLDECSQSPKPC--NFICKNTEGSYQCSCPRGYILQEDGKSCKDLDECQT--KQHNCQFL---CVNTIGGFTCKCPPGFTQHH---TACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGNHR-CQHG-CQNIVGGYRCSCPQGYIQHYQWNQCVDENECA-SQNTCGSAS-------CFNTLGSYKC---ACPTGFT 2555          

HSP 4 Score: 190.66 bits (483), Expect = 2.283e-48
Identity = 182/561 (32.44%), Postives = 256/561 (45.63%), Query Frame = 3
Query: 1077 DINECET-ANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCK--------ETDVCFNLPGSYDCIPKKKCR-----PGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECP-PGMF-------RSSMYSN----------CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDL--EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            DINEC    + CAN   IC N  GSFRC+C  GF+    G  C DIDEC+   +  D+  C+N  GSY C  + P G+ ++ D +T  C D++ECE+ P + G    C NI GS  CE                  C  G         C D  + T  +   +GRC+        +++ C  L  ++   P ++C      P       G++C D++EC+     C P+ +C+NT  S+ C    C      D   G+ +C D  R     +  D DEC           L  C    G+    +  ECP PG         R   ++N           +D++EC+   G C  N  C N +GS+KC C+ G+ L      C D++EC +       PDL     C+NT GS++C+C +GFE     +K C DI+EC       +  +C+NT GS+ C C  G+ L+ SGD C DI+EC L    C NG CVN+ G Y+C C PG+ A    + C DIDEC+   G C           C N  G Y+C   SC  GY 
Sbjct:  678 DINECALDPDICANG--ICENLRGSFRCNCNSGFESDSTGKNCIDIDECLVNRLLCDNGLCRNTPGSYSC--TCPKGYVFRSDSET--CEDINECESSPCVNG---ACRNILGSFNCE------------------CSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWG-SPCERCEIDPACPRGFARVKGVSCEDVNECEVFPGVC-PNGLCLNTKGSFLC---ECPDGLTLD-GTGR-LCLD-LRMEHCFLKWDEDECVHPVPGKF--RLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGIC-TNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRIS------PDLCGSGTCINTPGSFECECFEGFESGFMMMKNCMDIDECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDIDECTIMNGGCDTH--------CTNSEGSYEC---SCLEGYA 1183          

HSP 5 Score: 182.57 bits (462), Expect = 6.541e-46
Identity = 177/583 (30.36%), Postives = 257/583 (44.08%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKED------------------------------------------PDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGI-CSRCKDGFYFKK----------ETRSCEDIDECTMN--VGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRE-SDFQNGRLCINLLGYYKCVNSSCPVG 2642
            C D +EC   N C N    C N +G+F C C +GF+   + +CEDI+EC +N  +C+   +C N  G+Y+C  + P G+  +ED                                          PD   C+D +EC   P IC  G +CVN  GS+RC+ +E     +    G  C   + GF F +           +R+     EC  N   GW N    + ++C  LPG+     KK C  G     +G    DIDECK M   C   + C+N   SY                  +C C  GY  +   + C D+DEC+++     C   +IC N  GSY C     CP G        +C+D+DEC+T +  C     CVN +G + C C  G+    +  C D NEC     + +   L+  C N+ GS+ C+C +G+   D     C D++EC   + C  +H C N VG Y+C C QGY      + C D +EC  +   C +  C N  G Y+C CP GF  ++    C D+DEC++S+  C+   S+ + G LC    GYY+     C  G
Sbjct: 2081 CVDTDECSIGNPCGNG--TCTNAIGTFECLCDEGFEPGPMMVCEDINECILNPLLCA--FRCINTYGAYEC--TCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKPGICENG-RCVNTIGSYRCDCNE---GFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGN----QCEIC-PLPGTAQ--YKKMCPHGPGYTTDG---KDIDECKVMPNLCRNGQ-CINNIGSY------------------RCFCNPGYTTDIGGTACVDLDECSQS--PKPCN--FICKNTEGSYQC----SCPRGYILQEDGKSCKDLDECQTKQHNC--QFLCVNTIGGFTCKCPPGFT-QHHTACIDNNEC---GTQSNVCGLKGVCQNSPGSFTCECQRGYSL-DSTGMNCEDVDECGGNHRC--QHGCQNIVGGYRCSCPQGYIQHYQWNQCVDENECASQ-NTCGSASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSG 2606          

HSP 6 Score: 181.415 bits (459), Expect = 1.633e-45
Identity = 170/523 (32.50%), Postives = 240/523 (45.89%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNV--NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTM--NVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMC----------------RDGYRQNQDSICT--------------DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEA-RCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAA-NPCGKKHQ-CVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA 2498
            GF  +    +C DI+ECE    C N    C NTVGS+ C C  GF+ +    C DIDEC ++   +C +   C N +GS+ C+    C  G++  PD  +C+D++EC AFP  C PG  C N+ GS RC                   C  G+  ++E  +C DIDEC    N+  +         C N PGS+ CI    C PG VL++NG  C D  +             C   + +       C+  + ++ +  KC C                ++G    QD +C               DV+EC EN G  +C + + CIN  GS+    R ECP G        NC D DEC  G   C  N  C N +G+++C+CD G+       C D+NEC+L       P L A RC+NT G+Y+C CP G+   +   K C D++EC+   + C  +   C N +G++ C C  G      G+ C D +EC  +P  C NG CVN  G Y C C  GF +
Sbjct: 1792 GFKVSPDQTMCMDIDECE-RQPCGNG--TCKNTVGSYNCLCYPGFEITHNNDCLDIDECSSLYGQVCRN-GHCFNEIGSFICL----CNEGYELTPDGKNCIDINECVAFPGSCSPGT-CQNLEGSFRC------------------ICPPGYEVERE--NCIDIDECIEEPNICLFG-------ACSNTPGSFQCI----CPPGFVLSENGRRCFDTRQ-----------SFCFTRFEN-----GKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQD-LCPYGHGTIPGIGDTREDVNECLENPG--ICANGH-CINTDGSF----RCECPMGYNLDYTGVNCVDTDECSIGN-PC-GNGTCTNAIGTFECLCDEGFEPGPMMVCEDINECILN------PLLCAFRCINTYGAYECTCPAGYILRE-DQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKPGICENGRCVNTIGSYRCDCNEGFQS 2241          

HSP 7 Score: 180.644 bits (457), Expect = 2.862e-45
Identity = 191/603 (31.67%), Postives = 262/603 (43.45%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSK-LGICED---------------------ID----ECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDEC------ETGEGKCPQNMH-------CVNVVG----------------SYKCMCDRGY--ILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA-DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNG 2669
            GF F+       DI+EC E    C N   +C+N +GSFRC+C  GF ++  L +CE                      ID    EC+ + N+CS    C +  GSY C+    C  G+K  PD   C+D+DECE  P  CG G  C N  GS+ C                   C  GF        C DIDEC+     Y   C+    CFN  GS+ C+    C  G  L  +G  C DI+EC      C P   C N   S+ C+  P                  GY   +++ C D+DEC E    N+C     C N PGS+ CI    CPPG   S     C D  +       E G+   P+  +       C  + G                +++ +C  G+  I    +T  DVNECL    E         C+NT GS++C+CP G+   DY    C D +EC   NPCG    C N +G+++C C +G+        CEDI+EC+L P  C    C+N  G YEC CP G+   + +++C+D+DEC   EG    ES    G +C NL+G + C+   CP G  ++  G G
Sbjct: 1683 GFTFDIHTGKAVDIDECKEIPGICTNG--VCINQIGSFRCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLYIDEYRNECLEIPNVCS-HGTCVDTEGSYHCV----CNNGFKVSPDQTMCMDIDECERQP--CGNGT-CKNTVGSYNC------------------LCYPGFEI-THNNDCLDIDECSS---LYGQVCRNGH-CFNEIGSFICL----CNEGYELTPDGKNCIDINECVAFPGSCSPG-TCQNLEGSFRCICPP------------------GYEVEREN-CIDIDECIEE--PNIC-LFGACSNTPGSFQCI----CPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECL----ENPGICANGHCINTDGSFRCECPMGYNL-DYTGVNCVDTDECSIGNPCGNG-TCTNAIGTFECLCDEGFEPGPM-MVCEDINECILNPLLCAF-RCINTYGAYECTCPAGYILREDQKMCKDLDEC--IEGFHDCES---RGMVCKNLIGTFMCI---CPPGMVRRPDGEG 2205          

HSP 8 Score: 167.933 bits (424), Expect = 2.073e-41
Identity = 179/587 (30.49%), Postives = 249/587 (42.42%), Query Frame = 3
Query: 1065 EICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDK----KCKNNVGSYKCIRSIP----------------------CGFGWKEDPDTNDCV-DVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSL-YICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPE-ESCPDLEARCVNTAGSYKCQCPKGFEWSDY----PI-------KKC----------TDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            E C DI+EC E  N C   +  C NT GSF+C C  GF  S+ G  C D  +        + K    K  N+  +  C   +P                      C +G    P   D   DV+EC   P IC  G  C+N  GS RCE   CP+    +  G+               +C D DEC++     NG C       N  G+++C+  +   PG ++      C DI+EC      C     C+NTY +Y                  +C C  GY   +D  +C D+DEC E  G + C S   +C N  G++ CI    CPPGM R      C D +EC T  G C +N  CVN +GSY+C C+ G+  T + T C D  +   F    ++   + +   N     +C C  G  W +     P+       K C           DI+EC       +  QC+N +GSY+C C  GY   I G  C D+DEC   P+ C N IC N  G Y+C CP G+   +  + C+D+DEC T +  C          LC+N +G + C    CP G+T+  T
Sbjct: 1922 ENCIDIDECIEEPNICL--FGACSNTPGSFQCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANG-HCINTDGSFRCE---CPMGYNLDYTGV---------------NCVDTDECSIGNPCGNGTCT------NAIGTFECLCDEGFEPGPMMV-----CEDINECILNPLLCAFR--CINTYGAY------------------ECTCPAGYILREDQKMCKDLDECIE--GFHDCESRGMVCKNLIGTFMCI----CPPGMVRRPDGEGCMDENECRTKPGIC-ENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDECSQSPKPC-NFICKNTEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQ--------FLCVNTIGGFTC---KCPPGFTQHHT 2437          

HSP 9 Score: 163.696 bits (413), Expect = 4.545e-40
Identity = 195/666 (29.28%), Postives = 272/666 (40.84%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPC--------------GFGWKEDP------------------DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMN-VGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-----QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADV--NECLLFRPEESCPD-------LEARC--VNTAGSYKCQ-------------CPKGFEW-------SDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI--CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHM 2822
            GF+       C DI+EC+T   C N    C+NT GSFRCDC  G     L I  D   C++ ++      C   +    C+R  P               GFG    P                   T D  D++EC   P+IC  G+ C N+RGS RC                   C  GF      ++C DIDEC +N +   NG C+      N PGSY C     C  G V   +   C DI+EC+        +  C N   S++C    C+P  + D +    +C D  +       QD  C +V+          C +L      P     I  A CP G  R    S C+DV+ECE   G CP  + C+N  GS+ C C  G  L  +   C D+    C L   E+ C         L+A C  V  A   +C+             CP+G  +       S  P  K  DINEC A        +C NT+GS+KCKC  G+ L +    C DIDEC + P  C +G C+N PG +EC+C  GF +    +  C DIDEC  +  +C        G  CIN  G + C   +CP G+    +G+  +      + C  +D  C N K   I   + + S +  ++ T+ R   + +
Sbjct:  556 GFVLASNGRYCTDIDECQTPGICMNGH--CINTEGSFRCDCPPG-----LAIGVDGRVCVDTHM---RSTCYGGIKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAEFQGLCSGGVGITVDGRDINECALDPDICANGI-CENLRGSFRC------------------NCNSGFESDSTGKNCIDIDECLVNRLLCDNGLCR------NTPGSYSCT----CPKGYVFRSDSETCEDINECESSPCV---NGACRNILGSFNC---ECSPGSRLDAT--GLICIDSLKGTCWLNIQDGRC-EVNINGATLKSECCATLGAAWGSPCERCEIDPA-CPRGFARVKGVS-CEDVNECEVFPGVCPNGL-CLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGDVLSGRPFYK--DINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISPDLCGSGTCINTPGSFECECFEGFESGFMMMKNCMDIDECERNPLLC-------RGGECINTEGSFLC---NCPNGHELTPSGDACV----DINECALSDNLCRNGKCVNIVGTY-QCSCNPGYQATLDRLGCTDI 1153          

HSP 10 Score: 155.992 bits (393), Expect = 1.301e-37
Identity = 165/572 (28.85%), Postives = 238/572 (41.61%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECK-------------QMKFRCE---------PDEICVNTYSSYHC------------------------------VASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCP----------------KGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSY------KCK----CFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDI 2525
             NQ ++IC      +  N C N    C+  + S+RC+C  G+K      C D+DEC + N C+ +  C N  GSY C     C  G++  P    C+D+DEC     +C  G +CVN  GS +C                   C  GF    + ++C D DEC+      NG      +C N  GS+ CI    C+PG VLA NG  C DIDEC+             +  FRC+            +CV+T+    C                                 PC P    + +  + +C  G     D    D++ECA +   ++C +  IC N  GS+    R  C  G    S   NC D+DEC      C  N  C N  GSY C C +GY+  S++ TC D+NEC      ES P +   C N  GS+ C+C                 KG  W +    +C      +  N    K +C  T+G+       +C+    C +G+   + G +CED++EC + P  C NG+C+N  G + C+CP G   D    +C D+
Sbjct:  401 LNQTIDICK-----QYPNLCLNGR--CIPNLNSYRCECNMGYKQDTQTECIDVDECTS-NPCT-NGDCVNTPGSYYC----KCHSGFQRTPTKQACIDIDECIQNGILCKHG-RCVNTEGSFQC------------------ICNAGFELTPDGKNCADHDECSTTNMCLNG------MCINEDGSFKCI----CKPGFVLASNGRYCTDIDECQTPGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMRSTCYGGIKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAEFQGLCSGGVGITVDG--RDINECALD--PDICAN-GICENLRGSF----RCNCNSGFESDSTGKNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTCPKGYVFRSDSETCEDINEC------ESSPCVNGACRNILGSFNCECSPGSRLDATGLICIDSLKGTCWLNIQDGRCE-----VNINGATLKSECCATLGAAWGSPCERCEIDPACPRGF-ARVKGVSCEDVNECEVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDL 908          

HSP 11 Score: 153.68 bits (387), Expect = 6.164e-37
Identity = 174/594 (29.29%), Postives = 241/594 (40.57%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CED--IDEC-MNVNICSDDK-KCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDE----CEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVN-------------TYSSYHCVASPCAPSQQFDYSVGKCMCRD--GYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQD-------------------------VDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            G+  ++    C D++EC     C N +  CVNT G + C+C   F+ +  G+ C D  +  C +N     D    C   +G      S  C  G         C  V+     C+  P +C  G  C+N  GS +CE                  C  G+Y  +ETR CEDIDEC  + G           C+N  G+Y CI      P   +  NG   N +D  K   +R      C N             TY+     + PC P      +  K +C    G+  +       D+DEC E  G    G   +CIN  GS+    R ECP G   + +   C+                           +EC      C     CV+  GSY C+C+ G+ ++ + T C D++EC      E  P     C NT GSY C C  GFE +      C DI+EC  L    C   H C N +GS+ C C +GY L+  G  C DI+EC+  P  C  G C N+ G + C CPPG+  +R E C DIDEC     +C   +       C N  G ++C+   CP G+   E G
Sbjct: 1430 GYELDRTGGNCTDVDECADPINCVNGF--CVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSYIFMCQELPGLC-QGGNCINTFGSFQCE------------------CPQGYYLSEETRICEDIDECFTHPGVCG-----PGTCYNTLGNYTCI-----CPSEYMQVNGGH-NCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNG---VCINQIGSF----RCECPTGFSYNDLLLVCEGNNFSLKETITQITIYFILLLYIDEYRNECLEIPNVCSHGT-CVDTEGSYHCVCNNGFKVSPDQTMCMDIDEC------ERQPCGNGTCKNTVGSYNCLCYPGFEITHN--NDCLDIDECSSLYGQVCRNGH-CFNEIGSFICLCNEGYELTPDGKNCIDINECVAFPGSCSPGTCQNLEGSFRCICPPGYEVER-ENCIDIDECIEEPNICLFGA-------CSNTPGSFQCI---CPPGFVLSENG 1963          

HSP 12 Score: 144.05 bits (362), Expect = 5.349e-34
Identity = 151/485 (31.13%), Postives = 205/485 (42.27%), Query Frame = 3
Query: 1293 PCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICIN-------------------------------HPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKK-CTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            PC  G+  +  +  C DVDEC+A P +C  G  C+N  GS+ C    CP+  K++               + T+ CEDIDECT   G  NG       C N  GSY CI    C  G V + +G  C D           +   +C ++  + HC     A  Q   ++  +C C  G      SI    + C   G D       +CI                                HPG        + P  +    + +  Q +D C+     C  N  C+  + SY+C C+ GY   +   C DV+EC       S P     CVNT GSY C+C  GF+ +  P K+ C DI+EC+      K  +CVNT GS++C C  G+ L+  G  C D DEC      CLNG+C+N  G ++C C PGF  A     C DIDEC T  G+C       NG  CIN  G ++C    CP G  
Sbjct:  188 PCRRGFIPNIRSGACQDVDECQAIPGLC-QGGNCINTDGSYECR---CPVGHKQS---------------ETTQKCEDIDECTTIPGVCNG-----GECSNTIGSYYCI----CPRGYVTSGDGSRCID-----------QRSGVCFSSLVNGHC-----AQEQAGRFTKMQCCCESGRCWALGSI---PEMCPIRGTDEY---RRLCIEGVPFGGPGGFVPNGFGPGGTGFIPGPGGNGFHPGIGGTGIDGQGP--VINGGVATLNQTIDICKQYPNLC-LNGRCIPNLNSYRCECNMGYKQDTQTECIDVDECT------SNPCTNGDCVNTPGSYYCKCHSGFQRT--PTKQACIDIDECIQNGILCKHGRCVNTEGSFQCICNAGFELTPDGKNCADHDECSTT-NMCLNGMCINEDGSFKCICKPGFVLASNGRYCTDIDECQTP-GIC------MNGH-CINTEGSFRC---DCPPGLA 599          

HSP 13 Score: 131.724 bits (330), Expect = 3.737e-30
Identity = 170/623 (27.29%), Postives = 250/623 (40.13%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDI--------------DECMNVNICSDDKKCKNNVGSYKCIRSIPCGF--------------GWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKET------DVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL--------------AANPCGKKHQCVNTVG----------------SYKCKCFQGY-RLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEP 2708
            G+  ++   IC DI+EC T          C NT+G++ C C   +     G  C D+              D  +  N+      C  N+G        PC                G+  D  T   VD+DEC+  P IC  G+ C+N  GS RC   ECP     N+  +     + F  K+            + +  Y   C E         C +  GSY C+    C  G  ++ +   C DIDEC++       +  C NT  SY+C+  P                  G+    ++ C D+DEC+   G  +C + + C N  GS+ C+    C  G   +    NC D++EC    G C     C N+ GS++C+C  GY +   N C D++EC+    EE    L   C NT GS++C CP GF  S+   ++C D  +                A N    K  C    G                +++  C  G+  +   GDT ED++ECL  P  C NG C+N  G + C+CP G+  D   + C D DECS         +   NG  C N +G ++C+   C  G+   E G   +CE  +E I  P
Sbjct: 1567 GYYLSEETRICEDIDECFTHPGVCGPG-TCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGV-CINQIGSFRC---ECPTGFSYNDLLLVCE-GNNFSLKETITQITIYFILLLYIDEYRNECLEIPNVCSHGTCVDTEGSYHCV----CNNGFKVSPDQTMCMDIDECERQPCG---NGTCKNTVGSYNCLCYP------------------GFEITHNNDCLDIDECSSLYGQ-VCRNGH-CFNEIGSFICL----CNEGYELTPDGKNCIDINECVAFPGSCSPGT-CQNLEGSFRCICPPGYEVEREN-CIDIDECI----EEPNICLFGACSNTPGSFQCICPPGFVLSENG-RRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDECSIG-------NPCGNG-TCTNAIGTFECL---CDEGF---EPGPMMVCEDINECILNP 2131          

HSP 14 Score: 108.997 bits (271), Expect = 2.845e-23
Identity = 105/322 (32.61%), Postives = 149/322 (46.27%), Query Frame = 3
Query: 1806 KCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDI---DECLLEPRKCLNGICVN-VPG---RYEC--------------KCPPGFAADRKEIC----------QDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFI 2675
            +C C  GY+Q+  + C DVDEC  N   N       C+N PGSY C    +C  G  R+     C D+DEC      C ++  CVN  GS++C+C+ G+ LT +   CAD +EC        C  L   C+N  GS+KC C  GF  +    + CTDI+EC     C   H C+NT GS++C C  G  + + G  C D      C    +K   G+CV   PG   + EC               CPP  +A+ + +C          +DI+EC+    +C+      NG +C NL G ++C   +C  G+    TG   I
Sbjct:  428 RCECNMGYKQDTQTECIDVDECTSNPCTN-----GDCVNTPGSYYC----KCHSGFQRTPTKQACIDIDECIQNGILC-KHGRCVNTEGSFQCICNAGFELTPDGKNCADHDEC---STTNMC--LNGMCINEDGSFKCICKPGFVLASNG-RYCTDIDECQTPGICMNGH-CINTEGSFRCDCPPGLAIGVDGRVCVDTHMRSTCYGGIKK---GLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAEFQGLCSGGVGITVDGRDINECALDPDICA------NG-ICENLRGSFRC---NCNSGFESDSTGKNCI 719          

HSP 15 Score: 84.3445 bits (207), Expect = 1.147e-15
Identity = 63/164 (38.41%), Postives = 86/164 (52.44%), Query Frame = 3
Query: 2178 LEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF--AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            L  RC+    SY+C+C  G++       +C D++EC  +NPC     CVNT GSY CKC  G++ + +   C DIDEC+     C +G CVN  G ++C C  GF    D K  C D DECST+  +C       NG +CIN  G +KC+   C  G+     G
Sbjct:  416 LNGRCIPNLNSYRCECNMGYKQDTQ--TECIDVDEC-TSNPC-TNGDCVNTPGSYYCKCHSGFQRTPTKQACIDIDECIQNGILCKHGRCVNTEGSFQCICNAGFELTPDGKN-CADHDECSTTN-MC------LNG-MCINEDGSFKCI---CKPGFVLASNG 563          

HSP 16 Score: 52.7582 bits (125), Expect = 4.185e-6
Identity = 36/102 (35.29%), Postives = 50/102 (49.02%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVD 1343
            GF+ N     C D++EC+           C+NT GS+ C C  G K S+    CEDIDEC  +    +  +C N +GSY CI    C  G+    D + C+D
Sbjct:  192 GFIPNIRSGACQDVDECQAIPGLCQGGN-CINTDGSYECRCPVGHKQSETTQKCEDIDECTTIPGVCNGGECSNTIGSYYCI----CPRGYVTSGDGSRCID 288          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000044459.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:16691548:16693922:-1 gene:ENSXETG00000002183.1 transcript:ENSXETT00000044459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 9.204e-54
Identity = 171/523 (32.70%), Postives = 238/523 (45.51%), Query Frame = 3
Query: 1080 INECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            I+EC+  N   +    C NT G F C C KGF+      C+D+DEC    +C ++ +C+N+ GS+ C     C  G+        C D++EC   P  C     C N +GS  C                  +CK GF       +CED++EC    G+    C     C N  GS+ C    +C  G    +NG  C DIDEC      C    +C+N+  SY C+                  C +G+  N  S C D++EC +    + C +   CIN  GS+ C    +C  G    S  S C D+DEC      C    +C+N +GSY C C +G+I    N C DV+EC L     +C +  A C+NT G+Y C C  GF  +      CTDI+ECL    C +   C+NT GS+       + +S     C DIDECL +   C + GIC+N+PG Y C CP G+   +   C DIDECS     C +++       C+N  G Y C+   C  GY
Sbjct:   25 IDECQKHNGGCHGSATCTNTPGRFYCSCFKGFRGDGFN-CKDVDECSASGVCGENSRCENSFGSFSCW----CNSGFTMT--NGSCADINECSP-PHPCNEHANCNNTKGSFLC------------------KCKSGF--SGNGTTCEDVNEC----GFEPPVCPLNSQCINEVGSFYC----ECWEG--YEKNGSLCLDIDECLHPSM-CHHHSVCINSPGSYDCI------------------CVEGFTGN-GSFCEDINECEQENITHRCHNGSQCINTMGSFIC----QCNVGF--GSNGSLCLDLDECAMNLSNCSSFQNCINTIGSYTCQCKKGFIPDGEN-CTDVDECFL--NGTACHE-RASCINTLGTYLCSCQSGFSGNGV---MCTDIDECLGGASCSENMVCMNTPGSF-------HYIS-----CIDIDECLNKTFYCGSAGICMNLPGSYSCTCPLGY-IQKGNTCFDIDECSNPTKYCHQQAQ------CLNTPGSYSCL---CREGY 454          

HSP 2 Score: 188.348 bits (477), Expect = 1.189e-49
Identity = 169/504 (33.53%), Postives = 221/504 (43.85%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQ--MKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAAN-PCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESD 2570
            C D++EC  +  C      C N+ GSF C C  GF  +  G C DI+EC   + C++   C N  GS+ C     C  G+  +  T  C DV+EC   P +C    +C+N  GS  CE                  C +G  ++K    C DIDEC      +   C    VC N PGSYDCI    C  G     NG  C DI+EC+Q  +  RC     C+NT  S+                   C C  G+  N  S+C D+DECA N  +  C S   CIN  GSY C    +C  G        NC DVDEC      C +   C+N +G+Y C C  G+   +   C D++ECL      SC +    C+NT GS+                 C DI+ECL     CG    C+N  GSY C C  GY     G+TC DIDEC    + C     C+N PG Y C C  G+ +   + C DIDEC      C  +++
Sbjct:   63 CKDVDECSASGVCGENSR-CENSFGSFSCWCNSGFTMTN-GSCADINECSPPHPCNEHANCNNTKGSFLC----KCKSGFSGNGTT--CEDVNECGFEPPVCPLNSQCINEVGSFYCE------------------CWEG--YEKNGSLCLDIDEC-----LHPSMCHHHSVCINSPGSYDCI----CVEG--FTGNGSFCEDINECEQENITHRCHNGSQCINTMGSF------------------ICQCNVGFGSN-GSLCLDLDECAMNLSN--CSSFQNCINTIGSYTC----QCKKGFIPDG--ENCTDVDECFLNGTACHERASCINTLGTYLCSCQSGF-SGNGVMCTDIDECL---GGASCSE-NMVCMNTPGSFH-------------YISCIDIDECLNKTFYCGSAGICMNLPGSYSCTCPLGYIQ--KGNTCFDIDECSNPTKYCHQQAQCLNTPGSYSCLCREGYLS-YGDTCTDIDECLIRNNDCHSQAE 479          

HSP 3 Score: 142.895 bits (359), Expect = 1.206e-34
Identity = 127/405 (31.36%), Postives = 181/405 (44.69%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEA--FPEICGPGMKCVNIRGSHRCE--------------DDECPINMKR--------NNKGICS-RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLL------FRPEESCPDLEARC 2192
            C D+NEC            C+N VGSF C+C +G++ +   +C DIDEC++ ++C     C N+ GSY CI    C  G+  +     C D++ECE       C  G +C+N  GS  C+               DEC +N+          N  G  + +CK GF    +  +C D+DEC +N       C E   C N  G+Y C     C+ G   + NG+ C DIDEC      C  + +C+NT  S+H ++                             C D+DEC        CGS  IC+N PGSY+C     CP G  +    + C D+DEC      C Q   C+N  GSY C+C  GY L+  +TC D++ECL+       + E +CP  +  C
Sbjct:  143 CEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGYEKNG-SLCLDIDECLHPSMCHHHSVCINSPGSYDCI----CVEGFTGNGSF--CEDINECEQENITHRCHNGSQCINTMGSFICQCNVGFGSNGSLCLDLDECAMNLSNCSSFQNCINTIGSYTCQCKKGFI--PDGENCTDVDECFLN----GTACHERASCINTLGTYLC----SCQSG--FSGNGVMCTDIDECLGGA-SCSENMVCMNTPGSFHYIS-----------------------------CIDIDECLNK--TFYCGSAGICMNLPGSYSCT----CPLGYIQKG--NTCFDIDECSNPTKYCHQQAQCLNTPGSYSCLCREGY-LSYGDTCTDIDECLIRNNDCHSQAESACPMQQRVC 489          

HSP 4 Score: 130.954 bits (328), Expect = 8.019e-31
Identity = 109/318 (34.28%), Postives = 160/318 (50.31%), Query Frame = 3
Query: 1674 NDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLE--PRKCLNGI-CVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            N IDEC++    C     C NT   ++                  C C  G+R +  + C DVDEC+ +G   +CG    C N  GS++C     C  G   ++   +C D++EC      C ++ +C N  GS+ C C  G+   +  TC DVNEC    P   CP L ++C+N  GS+ C+C +G+E +      C DI+ECL  + C     C+N+ GSY C C +G+  + +G  CEDI+EC  E    +C NG  C+N  G + C+C  GF ++   +C D+DEC+ +   CS    FQN   CIN +G Y C
Sbjct:   23 NYIDECQKHNGGCHGSATCTNTPGRFY------------------CSCFKGFRGDGFN-CKDVDECSASG---VCGENSRCENSFGSFSCW----CNSGFTMTN--GSCADINECSPPH-PCNEHANCNNTKGSFLCKCKSGF-SGNGTTCEDVNECGFEPP--VCP-LNSQCINEVGSFYCECWEGYEKNG---SLCLDIDECLHPSMCHHHSVCINSPGSYDCICVEGF--TGNGSFCEDINECEQENITHRCHNGSQCINTMGSFICQCNVGFGSN-GSLCLDLDECAMNLSNCSS---FQN---CINTIGSYTC 295          

HSP 5 Score: 86.2705 bits (212), Expect = 1.134e-16
Identity = 65/209 (31.10%), Postives = 95/209 (45.45%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDEC 1691
            E C D++EC       ++   C+NT+G++ C CQ GF  + + +C DIDEC+    CS++  C N  GS+  I                 C+D+DEC      CG    C+N+ GS+ C    CP+                  + ++  +C DIDEC+    +    C +   C N PGSY C+    CR G +    G  C DIDEC
Sbjct:  306 ENCTDVDECFLNGTACHERASCINTLGTYLCSCQSGFSGNGV-MCTDIDECLGGASCSENMVCMNTPGSFHYIS----------------CIDIDECLNKTFYCGSAGICMNLPGSYSC---TCPLG-----------------YIQKGNTCFDIDECSNPTKY----CHQQAQCLNTPGSYSCL----CREGYL--SYGDTCTDIDEC 467          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Ltbp4 (latent transforming growth factor beta binding protein 4 [Source:MGI Symbol;Acc:MGI:1321395])

HSP 1 Score: 218.394 bits (555), Expect = 8.746e-58
Identity = 181/518 (34.94%), Postives = 228/518 (44.02%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIAC-NDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            CV     + C C  GF+    G  C DIDEC  V       +C+N  GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR     VC NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDEC+ +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P      L  +C NT GS+ C C  G+         C DINECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C DIDEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  538 CVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCV----CGTGFQAGPRATECLDVDECRRVPPPCDRG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GVCENLPGSFRCVCPAGFR--------GSACEEDVDECAQQPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECSRSPSPCAYGR---CENTEGSFKCV----CPTGFQPNAAGSECEDVDECEN-RLACP-GQECVNSPGSFQCRACPVGHHL-HRGRCTDVDECSSGTPC----GLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHPGPEGT 978          

HSP 2 Score: 196.052 bits (497), Expect = 1.206e-50
Identity = 191/586 (32.59%), Postives = 259/586 (44.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVA---------------------SPCAPSQQFDYSVGK--CMCRDGYR--QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDL--EARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKC--KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            GF        C DI+EC      CA     C NT GSFRC C  GF+       C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G+ C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC+ +      GRC+ T+      GS+ C+    C  G      G  C D+DEC+  +  C P + CVN+  S+ C A                     +PC    Q   + G   C C  GYR    Q   C D++EC E    + C     C+N  GS+ C     C PG       ++C DVDEC   E  C Q+  C N  GS++C+C  G+    +  +C D++EC      E  P L    RC N+ GSY+C   C  G+     P   C DI+EC    +  CG + +C NT GSY+C   C  GY+ +  G  C+D+DEC        + +C N+PG ++C C  G+   R    C D++EC T +GVC          LC N+ G + CV
Sbjct:  552 GFRLGPQGTRCIDIDECRRVPTPCAPGR--CENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGV-CENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTE------GSFKCV----CPTGFQPNAAGSECEDVDECEN-RLAC-PGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEG---DFCFPHGECLNTDGSFTCT----CAPGYRPGPRGASCLDVDECSE-EDLC-QSGICTNTDGSFECICPPGHRAGPDLASCLDIDEC-----RERGPALCGSQRCENSPGSYRCVRDCDPGYHPG--PEGTCDDIDECREYGSAICGAQ-RCENTPGSYRCTPACDPGYQPTPGGG-CQDVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCGSA-------LCENVEGSFLCV 1093          

HSP 3 Score: 147.132 bits (370), Expect = 2.858e-35
Identity = 131/412 (31.80%), Postives = 176/412 (42.72%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF  N     C D++ECE   AC  +   CVN+ GSF+C       H   G C D+DEC +   C    +C N  GS+ C     C  G++        C D++EC    + C P  +C+N  GS  C                   C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C DIDEC++        + C N+  SY CV                  C  GY    +  C D+DEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  759 GFQPNAAGSECEDVDECENRLACPGQE--CVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCS----CSTGYRAPSGQPGPCADINECLEG-DFCFPHGECLNTDGSFTCT------------------CAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHPGPEGTCDDIDECREYG-SAICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETL--QGVC--GSALCENVEGSFLCVCPNSPEEFDPMTGRCV 1109          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Ltbp4 (latent transforming growth factor beta binding protein 4 [Source:MGI Symbol;Acc:MGI:1321395])

HSP 1 Score: 218.009 bits (554), Expect = 2.751e-57
Identity = 181/518 (34.94%), Postives = 228/518 (44.02%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIAC-NDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            CV     + C C  GF+    G  C DIDEC  V       +C+N  GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR     VC NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDEC+ +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P      L  +C NT GS+ C C  G+         C DINECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C DIDEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  604 CVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCV----CGTGFQAGPRATECLDVDECRRVPPPCDRG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GVCENLPGSFRCVCPAGFR--------GSACEEDVDECAQQPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECSRSPSPCAYGR---CENTEGSFKCV----CPTGFQPNAAGSECEDVDECEN-RLACP-GQECVNSPGSFQCRACPVGHHL-HRGRCTDVDECSSGTPC----GLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHPGPEGT 1044          

HSP 2 Score: 195.667 bits (496), Expect = 2.637e-50
Identity = 191/586 (32.59%), Postives = 259/586 (44.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVA---------------------SPCAPSQQFDYSVGK--CMCRDGYR--QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDL--EARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKC--KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            GF        C DI+EC      CA     C NT GSFRC C  GF+       C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G+ C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC+ +      GRC+ T+      GS+ C+    C  G      G  C D+DEC+  +  C P + CVN+  S+ C A                     +PC    Q   + G   C C  GYR    Q   C D++EC E    + C     C+N  GS+ C     C PG       ++C DVDEC   E  C Q+  C N  GS++C+C  G+    +  +C D++EC      E  P L    RC N+ GSY+C   C  G+     P   C DI+EC    +  CG + +C NT GSY+C   C  GY+ +  G  C+D+DEC        + +C N+PG ++C C  G+   R    C D++EC T +GVC          LC N+ G + CV
Sbjct:  618 GFRLGPQGTRCIDIDECRRVPTPCAPGR--CENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGV-CENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTE------GSFKCV----CPTGFQPNAAGSECEDVDECEN-RLAC-PGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEG---DFCFPHGECLNTDGSFTCT----CAPGYRPGPRGASCLDVDECSE-EDLC-QSGICTNTDGSFECICPPGHRAGPDLASCLDIDEC-----RERGPALCGSQRCENSPGSYRCVRDCDPGYHPG--PEGTCDDIDECREYGSAICGAQ-RCENTPGSYRCTPACDPGYQPTPGGG-CQDVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCGSA-------LCENVEGSFLCV 1159          

HSP 3 Score: 146.747 bits (369), Expect = 5.032e-35
Identity = 131/412 (31.80%), Postives = 176/412 (42.72%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF  N     C D++ECE   AC    + CVN+ GSF+C       H   G C D+DEC +   C    +C N  GS+ C     C  G++        C D++EC    + C P  +C+N  GS  C                   C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C DIDEC++        + C N+  SY CV                  C  GY    +  C D+DEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  825 GFQPNAAGSECEDVDECENRLACPG--QECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCS----CSTGYRAPSGQPGPCADINECLEG-DFCFPHGECLNTDGSFTCT------------------CAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHPGPEGTCDDIDECREYG-SAICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETL--QGVC--GSALCENVEGSFLCVCPNSPEEFDPMTGRCV 1175          

HSP 4 Score: 114.39 bits (285), Expect = 4.821e-25
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             CV     Y C CD G+ L    T C D++EC         P    RC NT GS++C C  GF+       +C D++EC    P   + +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G+C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  603 RCVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRV----PTPCAPGRCENTPGSFRCVCGTGFQAGPR-ATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACE--EDVDECAQQPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 790          

HSP 5 Score: 89.3521 bits (220), Expect = 2.175e-17
Identity = 116/430 (26.98%), Postives = 164/430 (38.14%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            G      L  C DI+EC          + C N+ GS+RC  DC  G+     G C+DIDEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C+                  N  +E   M  RC P      T+      + P AP+                     Q   S G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+  + +  ++  CVN    Y C C  G+   ++   C D +EC    P  +C     RCVNT GSY C C
Sbjct:  991 GHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDDIDECREYGSAICGA-QRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAMCQNLPGSFQCV------------------CDQGYEGARDGRHCVDVNECET----LQGVCGSA-LCENVEGSFLCV----------------CPNSPEEFDPMTGRCVPPRAPAGTFPG----SQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLVPSGDLSARRDVDECQLFQDQVCKSGVCVNTAPGYSCYCSNGFYYHAHRLECVDNDECADEEP--AC--EGGRCVNTVGSYHCTC 1365          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Ltbp4 (latent transforming growth factor beta binding protein 4 [Source:MGI Symbol;Acc:MGI:1321395])

HSP 1 Score: 217.624 bits (553), Expect = 3.199e-57
Identity = 181/518 (34.94%), Postives = 228/518 (44.02%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIAC-NDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            CV     + C C  GF+    G  C DIDEC  V       +C+N  GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR     VC NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDEC+ +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P      L  +C NT GS+ C C  G+         C DINECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C DIDEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  538 CVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCV----CGTGFQAGPRATECLDVDECRRVPPPCDRG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GVCENLPGSFRCVCPAGFR--------GSACEEDVDECAQQPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECSRSPSPCAYGR---CENTEGSFKCV----CPTGFQPNAAGSECEDVDECEN-RLACP-GQECVNSPGSFQCRACPVGHHL-HRGRCTDVDECSSGTPC----GLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHPGPEGT 978          

HSP 2 Score: 195.667 bits (496), Expect = 2.768e-50
Identity = 191/586 (32.59%), Postives = 259/586 (44.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVA---------------------SPCAPSQQFDYSVGK--CMCRDGYR--QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDL--EARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKC--KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            GF        C DI+EC      CA     C NT GSFRC C  GF+       C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G+ C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC+ +      GRC+ T+      GS+ C+    C  G      G  C D+DEC+  +  C P + CVN+  S+ C A                     +PC    Q   + G   C C  GYR    Q   C D++EC E    + C     C+N  GS+ C     C PG       ++C DVDEC   E  C Q+  C N  GS++C+C  G+    +  +C D++EC      E  P L    RC N+ GSY+C   C  G+     P   C DI+EC    +  CG + +C NT GSY+C   C  GY+ +  G  C+D+DEC        + +C N+PG ++C C  G+   R    C D++EC T +GVC          LC N+ G + CV
Sbjct:  552 GFRLGPQGTRCIDIDECRRVPTPCAPGR--CENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGV-CENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTE------GSFKCV----CPTGFQPNAAGSECEDVDECEN-RLAC-PGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEG---DFCFPHGECLNTDGSFTCT----CAPGYRPGPRGASCLDVDECSE-EDLC-QSGICTNTDGSFECICPPGHRAGPDLASCLDIDEC-----RERGPALCGSQRCENSPGSYRCVRDCDPGYHPG--PEGTCDDIDECREYGSAICGAQ-RCENTPGSYRCTPACDPGYQPTPGGG-CQDVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCGSA-------LCENVEGSFLCV 1093          

HSP 3 Score: 146.362 bits (368), Expect = 5.820e-35
Identity = 131/412 (31.80%), Postives = 176/412 (42.72%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF  N     C D++ECE   AC  +   CVN+ GSF+C       H   G C D+DEC +   C    +C N  GS+ C     C  G++        C D++EC    + C P  +C+N  GS  C                   C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C DIDEC++        + C N+  SY CV                  C  GY    +  C D+DEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  759 GFQPNAAGSECEDVDECENRLACPGQE--CVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCS----CSTGYRAPSGQPGPCADINECLEG-DFCFPHGECLNTDGSFTCT------------------CAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHPGPEGTCDDIDECREYG-SAICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETL--QGVC--GSALCENVEGSFLCVCPNSPEEFDPMTGRCV 1109          

HSP 4 Score: 114.39 bits (285), Expect = 4.943e-25
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             CV     Y C CD G+ L    T C D++EC         P    RC NT GS++C C  GF+       +C D++EC    P   + +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G+C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  537 RCVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRV----PTPCAPGRCENTPGSFRCVCGTGFQAGPR-ATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACE--EDVDECAQQPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 724          

HSP 5 Score: 88.9669 bits (219), Expect = 2.567e-17
Identity = 115/423 (27.19%), Postives = 163/423 (38.53%), Query Frame = 3
Query: 1062 LEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            L  C DI+EC          + C N+ GS+RC  DC  G+     G C+DIDEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C+                  N  +E   M  RC P      T+      + P AP+                     Q   S G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+  + +  ++  CVN    Y C C  G+   ++   C D +EC    P  +C     RCVNT GSY C C
Sbjct:  932 LASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDDIDECREYGSAICGA-QRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAMCQNLPGSFQCV------------------CDQGYEGARDGRHCVDVNECET----LQGVCGSA-LCENVEGSFLCV----------------CPNSPEEFDPMTGRCVPPRAPAGTFPG----SQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLVPSGDLSARRDVDECQLFQDQVCKSGVCVNTAPGYSCYCSNGFYYHAHRLECVDNDECADEEP--AC--EGGRCVNTVGSYHCTC 1299          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Ltbp4 (latent transforming growth factor beta binding protein 4 [Source:MGI Symbol;Acc:MGI:1321395])

HSP 1 Score: 217.238 bits (552), Expect = 3.734e-57
Identity = 181/518 (34.94%), Postives = 228/518 (44.02%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIAC-NDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            CV     + C C  GF+    G  C DIDEC  V       +C+N  GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR     VC NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDEC+ +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P      L  +C NT GS+ C C  G+         C DINECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C DIDEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  538 CVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCV----CGTGFQAGPRATECLDVDECRRVPPPCDRG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GVCENLPGSFRCVCPAGFR--------GSACEEDVDECAQQPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECSRSPSPCAYGR---CENTEGSFKCV----CPTGFQPNAAGSECEDVDECEN-RLACP-GQECVNSPGSFQCRACPVGHHL-HRGRCTDVDECSSGTPC----GLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHPGPEGT 978          

HSP 2 Score: 195.282 bits (495), Expect = 3.263e-50
Identity = 191/586 (32.59%), Postives = 259/586 (44.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVA---------------------SPCAPSQQFDYSVGK--CMCRDGYR--QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDL--EARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKC--KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            GF        C DI+EC      CA     C NT GSFRC C  GF+       C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G+ C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC+ +      GRC+ T+      GS+ C+    C  G      G  C D+DEC+  +  C P + CVN+  S+ C A                     +PC    Q   + G   C C  GYR    Q   C D++EC E    + C     C+N  GS+ C     C PG       ++C DVDEC   E  C Q+  C N  GS++C+C  G+    +  +C D++EC      E  P L    RC N+ GSY+C   C  G+     P   C DI+EC    +  CG + +C NT GSY+C   C  GY+ +  G  C+D+DEC        + +C N+PG ++C C  G+   R    C D++EC T +GVC          LC N+ G + CV
Sbjct:  552 GFRLGPQGTRCIDIDECRRVPTPCAPGR--CENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGV-CENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTE------GSFKCV----CPTGFQPNAAGSECEDVDECEN-RLAC-PGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEG---DFCFPHGECLNTDGSFTCT----CAPGYRPGPRGASCLDVDECSE-EDLC-QSGICTNTDGSFECICPPGHRAGPDLASCLDIDEC-----RERGPALCGSQRCENSPGSYRCVRDCDPGYHPG--PEGTCDDIDECREYGSAICGAQ-RCENTPGSYRCTPACDPGYQPTPGGG-CQDVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCGSA-------LCENVEGSFLCV 1093          

HSP 3 Score: 146.362 bits (368), Expect = 6.282e-35
Identity = 131/412 (31.80%), Postives = 176/412 (42.72%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF  N     C D++ECE   AC  +   CVN+ GSF+C       H   G C D+DEC +   C    +C N  GS+ C     C  G++        C D++EC    + C P  +C+N  GS  C                   C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C DIDEC++        + C N+  SY CV                  C  GY    +  C D+DEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  759 GFQPNAAGSECEDVDECENRLACPGQE--CVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCS----CSTGYRAPSGQPGPCADINECLEG-DFCFPHGECLNTDGSFTCT------------------CAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHPGPEGTCDDIDECREYG-SAICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETL--QGVC--GSALCENVEGSFLCVCPNSPEEFDPMTGRCV 1109          

HSP 4 Score: 114.005 bits (284), Expect = 5.184e-25
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             CV     Y C CD G+ L    T C D++EC         P    RC NT GS++C C  GF+       +C D++EC    P   + +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G+C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  537 RCVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRV----PTPCAPGRCENTPGSFRCVCGTGFQAGPR-ATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACE--EDVDECAQQPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 724          

HSP 5 Score: 88.9669 bits (219), Expect = 2.440e-17
Identity = 115/423 (27.19%), Postives = 163/423 (38.53%), Query Frame = 3
Query: 1062 LEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            L  C DI+EC          + C N+ GS+RC  DC  G+     G C+DIDEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C+                  N  +E   M  RC P      T+      + P AP+                     Q   S G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+  + +  ++  CVN    Y C C  G+   ++   C D +EC    P  +C     RCVNT GSY C C
Sbjct:  932 LASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDDIDECREYGSAICGA-QRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAMCQNLPGSFQCV------------------CDQGYEGARDGRHCVDVNECET----LQGVCGSA-LCENVEGSFLCV----------------CPNSPEEFDPMTGRCVPPRAPAGTFPG----SQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLVPSGDLSARRDVDECQLFQDQVCKSGVCVNTAPGYSCYCSNGFYYHAHRLECVDNDECADEEP--AC--EGGRCVNTVGSYHCTC 1299          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Ltbp4 (latent transforming growth factor beta binding protein 4 [Source:MGI Symbol;Acc:MGI:1321395])

HSP 1 Score: 217.624 bits (553), Expect = 3.742e-57
Identity = 181/518 (34.94%), Postives = 228/518 (44.02%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIAC-NDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            CV     + C C  GF+    G  C DIDEC  V       +C+N  GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR     VC NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDEC+ +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P      L  +C NT GS+ C C  G+         C DINECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C DIDEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  603 CVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCV----CGTGFQAGPRATECLDVDECRRVPPPCDRG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPG-LCGR----GVCENLPGSFRCVCPAGFR--------GSACEEDVDECAQQPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECSRSPSPCAYGR---CENTEGSFKCV----CPTGFQPNAAGSECEDVDECEN-RLACP-GQECVNSPGSFQCRACPVGHHL-HRGRCTDVDECSSGTPC----GLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHPGPEGT 1043          

HSP 2 Score: 195.282 bits (495), Expect = 4.367e-50
Identity = 191/586 (32.59%), Postives = 259/586 (44.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVA---------------------SPCAPSQQFDYSVGK--CMCRDGYR--QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDL--EARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKC--KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            GF        C DI+EC      CA     C NT GSFRC C  GF+       C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G+ C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC+ +      GRC+ T+      GS+ C+    C  G      G  C D+DEC+  +  C P + CVN+  S+ C A                     +PC    Q   + G   C C  GYR    Q   C D++EC E    + C     C+N  GS+ C     C PG       ++C DVDEC   E  C Q+  C N  GS++C+C  G+    +  +C D++EC      E  P L    RC N+ GSY+C   C  G+     P   C DI+EC    +  CG + +C NT GSY+C   C  GY+ +  G  C+D+DEC        + +C N+PG ++C C  G+   R    C D++EC T +GVC          LC N+ G + CV
Sbjct:  617 GFRLGPQGTRCIDIDECRRVPTPCAPG--RCENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGV-CENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTE------GSFKCV----CPTGFQPNAAGSECEDVDECEN-RLAC-PGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEG---DFCFPHGECLNTDGSFTCT----CAPGYRPGPRGASCLDVDECSE-EDLC-QSGICTNTDGSFECICPPGHRAGPDLASCLDIDEC-----RERGPALCGSQRCENSPGSYRCVRDCDPGYHPG--PEGTCDDIDECREYGSAICGAQ-RCENTPGSYRCTPACDPGYQPTPGGG-CQDVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCGSA-------LCENVEGSFLCV 1158          

HSP 3 Score: 145.976 bits (367), Expect = 8.695e-35
Identity = 131/412 (31.80%), Postives = 176/412 (42.72%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF  N     C D++ECE   AC    + CVN+ GSF+C       H   G C D+DEC +   C    +C N  GS+ C     C  G++        C D++EC    + C P  +C+N  GS  C                   C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C DIDEC++        + C N+  SY CV                  C  GY    +  C D+DEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  824 GFQPNAAGSECEDVDECENRLACPG--QECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCS----CSTGYRAPSGQPGPCADINECLEG-DFCFPHGECLNTDGSFTCT------------------CAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHPGPEGTCDDIDECREYG-SAICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETL--QGVC--GSALCENVEGSFLCVCPNSPEEFDPMTGRCV 1174          

HSP 4 Score: 114.005 bits (284), Expect = 5.861e-25
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             CV     Y C CD G+ L    T C D++EC         P    RC NT GS++C C  GF+       +C D++EC    P   + +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G+C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  602 RCVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRV----PTPCAPGRCENTPGSFRCVCGTGFQAGPR-ATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACE--EDVDECAQQPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 789          

HSP 5 Score: 88.5817 bits (218), Expect = 3.322e-17
Identity = 116/430 (26.98%), Postives = 164/430 (38.14%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            G      L  C DI+EC          + C N+ GS+RC  DC  G+     G C+DIDEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C+                  N  +E   M  RC P      T+      + P AP+                     Q   S G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+  + +  ++  CVN    Y C C  G+   ++   C D +EC    P  +C     RCVNT GSY C C
Sbjct:  990 GHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDDIDECREYGSAICGA-QRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAMCQNLPGSFQCV------------------CDQGYEGARDGRHCVDVNECET----LQGVCGSA-LCENVEGSFLCV----------------CPNSPEEFDPMTGRCVPPRAPAGTFPG----SQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLVPSGDLSARRDVDECQLFQDQVCKSGVCVNTAPGYSCYCSNGFYYHAHRLECVDNDECADEEP--AC--EGGRCVNTVGSYHCTC 1364          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|Q14767|LTBP2_HUMAN (Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3)

HSP 1 Score: 218.009 bits (554), Expect = 1.833e-56
Identity = 175/522 (33.52%), Postives = 251/522 (48.08%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDE--------------CPINMKRNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVC 2555
            C DINECE    C+     C NT GS+ C+C +G+   + G C+DI+EC +   C D + C N+ GSY C+    C  G++    +  CVDV+EC   P +C  G KC N+ GS RC          DE              CP  +  N +G   CS C++G++  ++  +CED+DEC      + G C  + VC N  GS+ C   K C  G   +  G +C D+DEC+  +  C   E C NT  SY                  +C+C  G++    ++C DV+EC    G+  C     C+N  GS+ C+    C PG   +   ++CQDVDEC T +  C    HCVN  GS+ C+C+ G+  +  +  C D++EC  +  +  C     +C N+ GSY+C   C  GF  +  P   C DI+EC     CG    C NT GS++C C QG+ +S SG  C D++EC L    C   +C NV G + C C             D++E    EG C
Sbjct:  928 CQDINECEQPGVCSGGQ--CTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTCPDGR-CVNSPGSYTCLA---CEEGYRGQ--SGSCVDVNEC-LTPGVCAHG-KCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECA-----FPGVCP-SGVCTNTAGSFSC---KDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGE-CKNTVGSY------------------QCLCPQGFQLANGTVCEDVNECM---GEEHCAPHGECLNSHGSFFCL----CAPGFVSAEGGTSCQDVDECATTD-PC-VGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECEDYG-DPVCGTW--KCENSPGSYRCVLGCQPGFHMA--PNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLC-----------ASDLEEYDAQEGHC 1386          

HSP 2 Score: 198.749 bits (504), Expect = 2.292e-50
Identity = 175/528 (33.14%), Postives = 247/528 (46.78%), Query Frame = 3
Query: 1125 ICVNTVGSFRCDCQKGFK-HSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDE---------------------CPINMKRNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQD-SICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC--LLEPRKCLNGICVNVPGRYEC--KCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
             CVN    +RC C  G++ H     C D +EC+  + C    +C N VGSY C    P G+       T +C D++ECE  P +C  G +C N  GS+ CE D+                     CP     N+ G   C  C++G  ++ ++ SC D++EC       +G+C       NL GS+ C     C  G  +  +   C D+DEC   +  C P  +C+NT  S+ C A                 C +GY  N+D + C D+DECA  G   +C S  +C N  GS++C    +C  G   S +  +C+DVDECE  +  C     C N VGSY+C+C +G+ L +   C DVNEC+    EE C      C+N+ GS+ C C  GF  ++     C D++EC   +PC   H CVNT GS+ C C  G++ S     C DIDEC    +P  C    C N PG Y C   C PGF       C DIDEC+ ++ +C           C N  G ++C+
Sbjct:  860 TCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLR-DPCKGKGRCINRVGSYSCF-CYP-GYTLATSGATQECQDINECEQ-PGVCS-GGQCTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEG--YRGQSGSCVDVNECLTPGVCAHGKCT------NLEGSFRC----SCEQGYEVTSDEKGCQDVDECAS-RASC-PTGLCLNTEGSFACSA-----------------CENGYWVNEDGTACEDLDECAFPG---VCPS-GVCTNTAGSFSC---KDCDGGYRPSPLGDSCEDVDECEDPQSSC-LGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMG---EEHCAP-HGECLNSHGSFFCLCAPGFVSAEG-GTSCQDVDECATTDPCVGGH-CVNTEGSFNCLCETGFQPSPESGECVDIDECEDYGDP-VCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECA-NDTMCGSHG------FCDNTDGSFRCL 1329          

HSP 3 Score: 164.466 bits (415), Expect = 1.258e-39
Identity = 149/446 (33.41%), Postives = 195/446 (43.72%), Query Frame = 3
Query: 1344 VDECEA-FPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIA--CNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCK-CFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            +D C A    +CGPG  CVN+   +RC                   C  G+        C D +EC  +       CK    C N  GSY C     C PG  LA +G    C DI+EC+Q    C   + C NT  SYHC                   C  GY   +   C D++EC   G    C     C+N PGSY C+   E     +R    S C DV+EC T  G C     C N+ GS++C C++GY +TS+   C DV+EC       SCP     C+NT GS+ C   +   W +     C D++EC     C     C NT GS+ CK C  GYR S  GD+CED+DEC      CL G C N  G Y+C CP GF      +C+D++EC   E  C+   +      C+N  G + C+   C  G+   E G 
Sbjct:  845 IDRCAAGATNVCGPGT-CVNLPDGYRC------------------VCSPGYQLHPSQAYCTDDNECLRDP------CKGKGRCINRVGSYSCF----CYPGYTLATSGATQECQDINECEQPGV-CSGGQ-CTNTEGSYHC------------------ECDQGYIMVRKGHCQDINECRHPG---TCPDGR-CVNSPGSYTCLACEE----GYRGQSGS-CVDVNECLT-PGVCAHGK-CTNLEGSFRCSCEQGYEVTSDEKGCQDVDECAS---RASCPT--GLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVC-PSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEE-HCAPHGE------CLNSHGSFFCL---CAPGFVSAEGGT 1214          

HSP 4 Score: 133.265 bits (334), Expect = 5.805e-30
Identity = 150/505 (29.70%), Postives = 203/505 (40.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACI----------QRAECPPGMFRSSMYSNCQDVDECETGE-GKCPQNMHCVN-VVGSYKCMCDRGYILTSNNTC----ADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD 2501
            G+  +   + C D++ECE   +     E C NTVGS++C C +GF+ +   +CED++ECM    C+   +C N+ GS+ C+    C  G+        C DVDEC A  + C  G  CVN  GS  C                   C+ GF    E+  C DIDEC      Y      T  C N PGSY C+    C+PG  +A NG  C DIDEC      C     C NT  S+                  +C+C  G+  +     C DV+EC       +CG+  +C N  GS+ C+          Q   C P        +  Q + E  TG+    P  M C +   G   C    G   T    C    A   +     P E   +    C +  G    +    F  + Y     TD +EC+   P      +C+NTV  Y C C  G+    S   CED DEC  +   C NG CVN  G + C C P    D
Sbjct: 1123 GYRPSPLGDSCEDVDECEDPQSSCLGGE-CKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCL----CAPGFVSAEGGTSCQDVDEC-ATTDPC-VGGHCVNTEGSFNC------------------LCETGFQPSPESGECVDIDECED----YGDPVCGTWKCENSPGSYRCV--LGCQPGFHMAPNG-DCIDIDECANDTM-CGSHGFCDNTDGSF------------------RCLCDQGFEISPSGWDCVDVNECELMLA--VCGAA-LCENVEGSFLCLCASDLEEYDAQEGHCRP------RGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMY-----TDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDEC--QDLACENGECVNTEGSFHCFCSPPLTLD 1560          

HSP 5 Score: 70.0922 bits (170), Expect = 1.202e-10
Identity = 140/559 (25.04%), Postives = 205/559 (36.67%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDE------------CMNVN-----ICSDD--------KKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCED--------------DECPINMKRNNKGICSRCK-----DGFYFKKETRSCEDIDECTMNVGWY--NGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCG--------SLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGE------------GKCPQNMH----------CVNVVGSYKCMCDRGYILTSNNTCADVNECL--LFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC--LLEPR-KCLNGICVNVPGRYECKCPPGFAAD 2501
            C DI+EC     C +    C NT GSFRC C +GF+ S  G  C D++E            C NV      +C+ D          C+      + +   P G      P   DC    +  A          C ++ G +  +               D CP         IC   K     +G +   +T    D DEC +       NGRC  T     +PG Y C+    C PG     +   C D DEC+ +   CE  E CVNT  S+HC    C+P    D S  +CM      ++       +D C +   +++C         +   C    G     Q A CPP    S +Y+   +V   E               G  P ++H            N +G    + +  +  T+ ++ AD    L    +P E  P   A           + P GFE      ++C  +N C       +  +CV     Y C CF+G++L  +   C D++EC  L  P   C++G C N  G Y C C PG+ A+
Sbjct: 1301 CIDIDECANDTMCGSHG-FCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAPTG-DHAPAPTRMDCYSGQKGHA---------PCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMY-TDADECVIFGPGLCPNGRCLNT-----VPG-YVCL----CNPGFHYDASHKKCEDHDECQDLA--CENGE-CVNTEGSFHCF---CSPPLTLDLSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQCALCPP--RSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYLGPEDTVPEPAFPNTAGHS-ADRTPILESPLQPSELQPHYVAS--------HPEPPAGFE--GLQAEECGILNGC-------ENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAE 1811          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|Q8K4G1|LTBP4_MOUSE (Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 1.924e-56
Identity = 181/518 (34.94%), Postives = 228/518 (44.02%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIAC-NDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            CV     + C C  GF+    G  C DIDEC  V       +C+N  GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR     VC NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDEC+ +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P      L  +C NT GS+ C C  G+         C DINECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C DIDEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  604 CVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRVPTPCAPGRCENTPGSFRCV----CGTGFQAGPRATECLDVDECRRVPPPCDRG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GVCENLPGSFRCVCPAGFR--------GSACEEDVDECAQQPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECSRSPSPCAYGR---CENTEGSFKCV----CPTGFQPNAAGSECEDVDECEN-RLACP-GQECVNSPGSFQCRACPVGHHL-HRGRCTDVDECSSGTPC----GLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHPGPEGT 1044          

HSP 2 Score: 195.667 bits (496), Expect = 1.844e-49
Identity = 191/586 (32.59%), Postives = 259/586 (44.20%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVA---------------------SPCAPSQQFDYSVGK--CMCRDGYR--QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDL--EARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKC--KCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            GF        C DI+EC      CA     C NT GSFRC C  GF+       C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G+ C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC+ +      GRC+ T+      GS+ C+    C  G      G  C D+DEC+  +  C P + CVN+  S+ C A                     +PC    Q   + G   C C  GYR    Q   C D++EC E    + C     C+N  GS+ C     C PG       ++C DVDEC   E  C Q+  C N  GS++C+C  G+    +  +C D++EC      E  P L    RC N+ GSY+C   C  G+     P   C DI+EC    +  CG + +C NT GSY+C   C  GY+ +  G  C+D+DEC        + +C N+PG ++C C  G+   R    C D++EC T +GVC          LC N+ G + CV
Sbjct:  618 GFRLGPQGTRCIDIDECRRVPTPCAPGR--CENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPPCDRGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGV-CENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECSRSPSPCAYGRCENTE------GSFKCV----CPTGFQPNAAGSECEDVDECEN-RLAC-PGQECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPCADINECLEG---DFCFPHGECLNTDGSFTCT----CAPGYRPGPRGASCLDVDECSE-EDLC-QSGICTNTDGSFECICPPGHRAGPDLASCLDIDEC-----RERGPALCGSQRCENSPGSYRCVRDCDPGYHPG--PEGTCDDIDECREYGSAICGAQ-RCENTPGSYRCTPACDPGYQPTPGGG-CQDVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCGSA-------LCENVEGSFLCV 1159          

HSP 3 Score: 146.747 bits (369), Expect = 3.520e-34
Identity = 131/412 (31.80%), Postives = 176/412 (42.72%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF  N     C D++ECE   AC    + CVN+ GSF+C       H   G C D+DEC +   C    +C N  GS+ C     C  G++        C D++EC    + C P  +C+N  GS  C                   C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C DIDEC++        + C N+  SY CV                  C  GY    +  C D+DEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  825 GFQPNAAGSECEDVDECENRLACPG--QECVNSPGSFQCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCS----CSTGYRAPSGQPGPCADINECLEG-DFCFPHGECLNTDGSFTCT------------------CAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHPGPEGTCDDIDECREYG-SAICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETL--QGVC--GSALCENVEGSFLCVCPNSPEEFDPMTGRCV 1175          

HSP 4 Score: 114.39 bits (285), Expect = 3.372e-24
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             CV     Y C CD G+ L    T C D++EC         P    RC NT GS++C C  GF+       +C D++EC    P   + +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G+C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  603 RCVPRPSGYTCACDPGFRLGPQGTRCIDIDECRRV----PTPCAPGRCENTPGSFRCVCGTGFQAGPR-ATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACE--EDVDECAQQPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 790          

HSP 5 Score: 89.3521 bits (220), Expect = 1.521e-16
Identity = 116/430 (26.98%), Postives = 164/430 (38.14%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            G      L  C DI+EC          + C N+ GS+RC  DC  G+     G C+DIDEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C+                  N  +E   M  RC P      T+      + P AP+                     Q   S G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+  + +  ++  CVN    Y C C  G+   ++   C D +EC    P  +C     RCVNT GSY C C
Sbjct:  991 GHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDDIDECREYGSAICGA-QRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAMCQNLPGSFQCV------------------CDQGYEGARDGRHCVDVNECET----LQGVCGSA-LCENVEGSFLCV----------------CPNSPEEFDPMTGRCVPPRAPAGTFPG----SQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLVPSGDLSARRDVDECQLFQDQVCKSGVCVNTAPGYSCYCSNGFYYHAHRLECVDNDECADEEP--AC--EGGRCVNTVGSYHCTC 1365          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|Q8N2S1|LTBP4_HUMAN (Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 3.080e-55
Identity = 177/518 (34.17%), Postives = 229/518 (44.21%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN-DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC-MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGN 2666
            C++    + C C  GF+ S  G  C D+DEC  V       +C+N+ GS++C+    CG G++  P   +C+DVDEC   P  C  G +C N  GS  C                   C  G+       SC+D+DECT + G   GR      C NLPGS+ C+     R        G AC  D+DEC Q    C P   C NT  S+HC                   C  G+R +   + C DVDECA +      G    C N  GS+ C+    CP G   ++  S C+DVDECE     CP    CVN  GS++C  C  G+ L     C DV+EC    P          C NT GS++C C  G+         C D+NECL  + C    +C+NT GS+ C C  GYR    G +C D+DEC  E   C +GIC N  G +EC CPPG  A      C D+DEC        R       + C N  G Y+CV   C  GY     G 
Sbjct:  561 CISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCV----CGPGFRAGPRAAECLDVDECHRVPPPCDLG-RCENTPGSFLCV------------------CPAGYQAAPHGASCQDVDECTQSPGLC-GR----GACKNLPGSFRCVCPAGFR--------GSACEEDVDECAQEPPPCGPGR-CDNTAGSFHCA------------------CPAGFRSRGPGAPCQDVDECARSPPPCTYGR---CENTEGSFQCV----CPMGFQPNTAGSECEDVDECEN-HLACP-GQECVNSPGSFQCRTCPSGHHL-HRGRCTDVDECSSGAPPCG---PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEE-DLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECR------ERGPALCGSQRCENSPGSYRCVR-DCDPGYHAGPEGT 1002          

HSP 2 Score: 198.749 bits (504), Expect = 1.983e-50
Identity = 187/571 (32.75%), Postives = 245/571 (42.91%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHS-KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC------------ED-DECPINMKRNNKGICS--------RCKDGFYFKKETRSCEDIDECTMNVGWYN-GRCKETDV-----------------------------------CFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPC--APSQQ--------------FDYSVGKCM---------CRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDEC-ETGEGKCPQNMHCVNVVGSYKCM--CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCP 2483
            GF  +     C D++EC      CA     C N+ GSFRC C  GF+   +   C D+DEC  V    D  +C+N  GS+ C+    C  G++  P    C DVDEC   P +CG G  C N+ GS RC            ED DEC         G C          C  GF  +     C+D+DEC  +      GRC+ T+                                    C N PGS+ C   + C  G  L +    C D+DEC      C P   C NT  S+ C  +P   APS +              F +  G+C+         C  GYR   + + C DVDEC+E   ++LC S  IC N  GS+ CI    CPPG       ++C DVDEC E G   C  +  C N  GSY+C+  CD GY      TC DV+EC  + PE        RC NT GSY+C   C  G++ +  P   C D++EC   + CG    C N  GS++C C QGY  +  G  C D++EC      C   +C NV G + C CP
Sbjct:  575 GFRLSPQGTRCIDVDECRRVPPPCAPGR--CENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCV----CPAGYQAAPHGASCQDVDECTQSPGLCGRGA-CKNLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQC---RTCPSGHHLHRG--RCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSE---EDLCQS-GICTNTDGSFECI----CPPGHRAGPDLASCLDVDECRERGPALC-GSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEIC---GAQRCENTPGSYRCTPACDPGYQPT--PGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCP 1119          

HSP 3 Score: 149.828 bits (377), Expect = 4.330e-35
Identity = 142/437 (32.49%), Postives = 186/437 (42.56%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC-----------------------EDDEC-PINMKRNNKG-ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCT 2270
            GF        C D++EC  +      +  C NT GSF+C C  GF+ +  G  CED+DEC N   C   ++C N+ GS++C R+ P G           C DVDEC +    CGP   C N  GS RC                       E D C P     N  G     C  G+       SC D+DEC+      +G C  TD      GS++CI    C PG     +  +C D+DEC++        + C N+  SY CV                  C  GY    +  C DVDEC E G   +CG+   C N PGSY C     C PG ++ +    CQDVDEC      C  +  C N+ GS++C+CD+GY    +   C DVNEC     +  C    A C N  GS+ C CP   E  D    +C 
Sbjct:  740 GFRSRGPGAPCQDVDECARSPP-PCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPG-QECVNSPGSFQC-RTCPSGHHLHR----GRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTD------GSFECI----CPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRD----------------CDPGYHAGPEGTCDDVDECQEYG-PEICGAQR-CENTPGSYRCT--PACDPG-YQPTPGGGCQDVDECRN-RSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETL--QGVC--GAALCENVEGSFLCVCPNSPEEFDPMTGRCV 1133          

HSP 4 Score: 113.235 bits (282), Expect = 6.990e-24
Identity = 72/205 (35.12%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2052 HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
             C++    Y C CD G+ L+   T C DV+EC    P    P    RC N+ GS++C C  GF        +C D++EC    P     +C NT GS+ C C  GY+ +  G +C+D+DEC   P  C  G C N+PG + C CP GF     E  +D+DEC+     C        GR C N  G + C   +CP G+  +  G
Sbjct:  560 RCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPP----PCAPGRCENSPGSFRCVCGPGFRAGPR-AAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACE--EDVDECAQEPPPCG------PGR-CDNTAGSFHC---ACPAGFRSRGPG 747          

HSP 5 Score: 85.8853 bits (211), Expect = 1.677e-15
Identity = 113/423 (26.71%), Postives = 158/423 (37.35%), Query Frame = 3
Query: 1062 LEICGDINECETANACANKWEICVNTVGSFRC--DCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQ--------------------QFDYSVGKCMCRDGYRQNQDSICTDV-------DECAENGGDNLCGSLYICINHPGSYACIQRAECPPG---MFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQC 2225
            L  C D++EC          + C N+ GS+RC  DC  G+     G C+D+DEC      IC   ++C+N  GSY+C  +  C  G++  P    C DVDEC      CG    C N+ GS +C                   C  G+   ++ R C D++EC        G C    +C N+ GS+ C                +  N  +E   M  RC P      T+      + P AP+                     Q     G+  C   +       C ++        EC    G+   GS       PG+     ++ CP G   +  S   S  +DVDEC+    +  ++  CVN    Y C C  GY   T    C D +EC    P         RCVNT GSY C C
Sbjct:  956 LASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICG-AQRCENTPGSYRCTPA--CDPGYQPTPG-GGCQDVDECRNR-SFCGAHAVCQNLPGSFQC------------------LCDQGYEGARDGRHCVDVNECET----LQGVCGAA-LCENVEGSFLC----------------VCPNSPEEFDPMTGRCVPPRTSAGTFPG----SQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECY--FDTAAPDACDNILARNVTWQECCCTVGEGW-GSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACE----GGRCVNTVGSYHCTC 1323          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|Q61555|FBN2_MOUSE (Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2)

HSP 1 Score: 214.542 bits (545), Expect = 3.210e-55
Identity = 213/639 (33.33%), Postives = 286/639 (44.76%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETA-NACANKWEICVNTVGSFRCDCQKGFKHS--KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC----------------EDDECPINMK-------RNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNM----HCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTD--INEC-LAANPCGKKHQCVNT-----VGSYKCKCFQGYRLSISGDTC---------------------------EDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKIS 2750
            G   +   E C DINEC  + N C N    CVN +G+++C C  G++ +  + G C DIDECM +N    D +C N+ GSY+C     C  G+   PD   C D+DECE  P+IC  G +C NI G +RC                + +EC +N          N KG  IC  C+ G+  KK T  C D+DEC   +G +N  C     C N+PGS+ C     CR G V   NGI C D+DEC     +C  +  CVNT  SY                  +C C +G+       C+DVDECAEN   NLC +   C+N PG+Y    R EC  G   +S   +CQD+DEC        QN+     C N+ G + C+CD GY L  +   C D++EC      +    +   CVNT G Y+C CP  F+ +   +  C D  +  C L   P G      NT     V    C C  G       +TC                           EDIDEC   P  C  G C+N  G ++C+CP G+  ++   IC+DIDEC    GVC   +       C N LG Y C+   CP  Y +   G+  +   KS      N   C NE P+ ++
Sbjct: 1181 GHELSPSREDCVDINECSLSDNLCRNGK--CVNMIGTYQCSCNPGYQATPDRQG-CTDIDECMIMNG-GCDTQCTNSEGSYEC----SCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGECENTKGSFIC-HCQLGYSVKKGTTGCTDVDEC--EIGAHN--CDMHASCLNVPGSFKC----SCREGWV--GNGIKCIDLDECANGTHQCSINAQCVNTPGSY------------------RCACSEGF-TGDGFTCSDVDECAEN--TNLCENGQ-CLNVPGAY----RCECEMGFTPASDSRSCQDIDECSF------QNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA-----DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVG-CVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGT-------CYNTLGNYTCI---CPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVT 1751          

HSP 2 Score: 203.371 bits (516), Expect = 9.660e-52
Identity = 189/572 (33.04%), Postives = 260/572 (45.45%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSK-LGICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPK--GFEWSDYPIKKCT--------------------------DINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            GF F+       DI+EC E    CAN   +C+N +GSFRC+C  GF ++  L +CEDIDEC N  N+C  +  C N+ GSY+C     C  G+K  P+   CVD +EC   P +C  G+ CV+++GS++C                   C +GF   ++   C D+DEC  +    NG CK      N  GSY+C+    C PG  L  N   C DIDEC     +   +  C N   S+                  KC+C +GY    D   C D +EC    G    G+   C N  GS+ CI    CPPG    S   NC D++EC+     C     C N  G ++C+C  G++L+ N   C D  +   F   E+      +  NT  + KC C K  G  W D P + C                           D+NECL +       QC+NT GS++C+C  GY L  +G  C D DEC +    C NG C NV G +EC C  GF       C+DI+EC+ +  +C+          C+N  G Y+C   +CPVGY  +E
Sbjct: 1789 GFTFDIHTGKAVDIDECKEIPGICANG--VCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRC----ECAAGFKLSPN-GACVDRNECLEIPNVCSHGL-CVDLQGSYQC------------------ICNNGFKASQDQTMCMDVDECERHP-CGNGTCK------NTVGSYNCL----CYPGFELTHNN-DCLDIDECSSFFGQVCRNGRCFNEIGSF------------------KCLCNEGYELTPDGKNCIDTNECVALPGSCSPGT---CQNLEGSFRCI----CPPGYEVRS--ENCIDINECDEDPNICLFG-SCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKA-KCCCSKMPGEGWGD-PCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIG-NPCGNGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFR--------CMNTFGSYEC---TCPVGYALRE 2280          

HSP 3 Score: 188.348 bits (477), Expect = 4.968e-47
Identity = 186/627 (29.67%), Postives = 263/627 (41.95%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CED--IDEC-----------------MNVNI------CSDDKKCKNN------VGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFR------CEPD-------EICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRD--GYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLF---------------------------RPEESCPDLE---------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            G+  ++    C DI+EC     C N   +CVNT G + C+C   F+ +  G+ C D  +  C                 + V +      CS  K   N       V S +     P G G++ +P T    D+DEC+  P +C  G  C+N  GS +CE                  C  G+Y  +ETR CEDIDEC  + G           C+N  G+Y CI    C P  +    G  C D+   K   +R      CE +        +C  TY+       PC P      +  K +C +  G+  +       D+DEC E  G  +C +  +CIN  GS+    R ECP G   + +   C+D+DEC  G+  C +N  C+N  GSY+C C  G+ L+ N  C D NECL                             + +  C D++           C NT GSY C C  GFE +      C DI+EC       C +  +C N +GS+KC C +GY L+  G  C D +EC+  P  C  G C N+ G + C CPPG+   R E C DI+EC     +C   S       C N  G ++C+   CP G+   + G
Sbjct: 1513 GYELDRTGGNCTDIDECADPINCVNG--LCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC-QGGNCINTFGSFQCE------------------CPQGYYLSEETRICEDIDECFAHPGVCG-----PGTCYNTLGNYTCI----CPPEYMQVNGGHNCMDMR--KSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPG--ICAN-GVCINQIGSF----RCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHN--NDCLDIDECSSFFGQVC-RNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEV-RSENCIDINECDEDPNICLFGS-------CTNTPGGFQCI---CPPGFVLSDNG 2086          

HSP 4 Score: 180.644 bits (457), Expect = 1.465e-44
Identity = 188/581 (32.36%), Postives = 260/581 (44.75%), Query Frame = 3
Query: 1077 DINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC-----VASPCAPSQQFDYSVGKCM-----------------------CRDGYRQ--NQDSICT----------------------DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            D+NEC E+   C+N    C+NT GSFRC+C  G+     G+ C D DEC   N C +   C N +GS++C     C  G++  P  N C D++EC   P +C    +C+N  GS+ C    CP+               G+  +++ + C+D+DEC   +     R     +C NL G++ CI    C PG     +G  C D +EC+     CE +  CVN   SY C       S  + ++  D   G C                        C DG R   +Q  +C                       D+DEC      +LC +   C+N  GS+ C     C  G       + C D+DEC      C  N  C N  GSY+C C RGY+L  +  TC D++EC     + +C  L   CVNT G + C+CP GF         C D NEC +  + CG K  C NT GS+ C+C +G+ L  SG  CED+DEC    R C +G C N+ G Y C CP G+    +   C D +ECS + G C   S       C N LG YKC   +CP G++
Sbjct: 2164 DVNECLESPGICSNGQ--CINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGN-GTCTNVIGSFECT----CNEGFEPGPMMN-CEDINECAQNPLLCA--FRCMNTFGSYECT---CPV---------------GYALREDQKMCKDLDECAEGLHDCESR---GMMCKNLIGTFMCI----CPPGMARRPDGEGCVDENECRTKPGICE-NGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDECKVM--PSLCTNGQ-CVNTMGSFRCF----CKVGYTTDISGTACVDLDECSQSPKPC--NFICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQT--KQHNCQFL---CVNTLGGFTCKCPPGFTQHH---TACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGNHR-CQHG-CQNILGGYRCGCPQGYVQHYQWNQCVDENECS-NPGACGSAS-------CYNTLGSYKC---ACPSGFS 2678          

HSP 5 Score: 176.407 bits (446), Expect = 2.628e-43
Identity = 178/560 (31.79%), Postives = 256/560 (45.71%), Query Frame = 3
Query: 1077 DINECET-ANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGIC--SRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCR-----PGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECP-PGMF-------RSSMYSN----------CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDL--EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            DINEC    + CAN   IC N  GS+RC+C  G++    G  C DIDEC+   +  D+  C+N  GSY C  + P G+ ++ + +T  C DV+ECE+ P + G    C N  GS  CE   C    K ++ G+      K   +   +   CE      +N+   NG   +++ C  L  ++   P ++C      P       G+ C D++EC+     C P+  CVN+  S+HC    C      D +   C+     R     +  D DEC           +  C    G+    +  ECP PG         R   ++N           +D++EC+   G C     C N +GS+KC C+ G+ L      C D++EC +       PDL     CVNT GS++C+C +G+E     +K C DI+EC       +   CVNT GS++C C  G+ LS S + C DI+EC L    C NG CVN+ G Y+C C PG+ A   ++ C DIDEC    G C  +        C N  G Y+C   SC  GY     G
Sbjct:  761 DINECALDPDICANG--ICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSC--TCPPGYVFRTETET--CEDVNECESNPCVNG---ACRNNLGSFHCE---CSPGSKLSSTGLICIDSLKGTCWLNIQDNRCE------VNI---NGATLKSECCATLGAAWG-SPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVC-PNGRCVNSKGSFHC---ECPEGLTLDGTGRVCL---DIRMEHCFLKWDEDECIHPVPGKF--RMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYG-KCRNTIGSFKCRCNNGFALDMEERNCTDIDECRIS------PDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQ--------CTNSEGSYEC---SCSEGYALMPDG 1271          

HSP 6 Score: 175.252 bits (443), Expect = 7.321e-43
Identity = 187/588 (31.80%), Postives = 253/588 (43.03%), Query Frame = 3
Query: 1065 EICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDK----KCKNNVGSYKCIRSIPCGFGW--------KED---------------PDTNDCV-DVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSL-YICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPE-ESCPDLEARCVNTAGSYKCQCPKGFEWSDY----PIKKCT-----------------DINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            E C DINEC E  N C   +  C NT G F+C C  GF  S  G  C D  +        + K    K  N   +  C   +P G GW        K+D               P  +D   DV+EC   P IC  G +C+N  GS RCE   CP+    +  G+                C D DEC++     NG C       N+ GS++C   +   PG ++      C DI+EC Q    C     C+NT+ SY                  +C C  GY   +D  +C D+DECAE  G + C S   +C N  G++ CI    CPPGM R      C D +EC T  G C +N  CVN++GSY+C C+ G+  +S+ T C D  + L F    ++   + +   N     +C C  G  W       P+                     DI+EC          QCVNT+GS++C C  GY   ISG  C D+DEC   P+ C N IC N  G Y+C CP G+   +  + C+D+DEC T +  C          LC+N LG + C    CP G+T+  T
Sbjct: 2045 ENCIDINECDEDPNICL--FGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMP-GEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNG-QCINTDGSFRCE---CPMGYNLDYTGV---------------RCVDTDECSIGNPCGNGTCT------NVIGSFECTCNEGFEPGPMMN-----CEDINECAQNPLLCA--FRCMNTFGSY------------------ECTCPVGYALREDQKMCKDLDECAE--GLHDCESRGMMCKNLIGTFMCI----CPPGMARRPDGEGCVDENECRTKPGIC-ENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPC-NFICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQ--------FLCVNTLGGFTC---KCPPGFTQHHT 2560          

HSP 7 Score: 171.014 bits (432), Expect = 1.603e-41
Identity = 205/779 (26.32%), Postives = 309/779 (39.67%), Query Frame = 3
Query:  900 LCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKED------------------------------------------PDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGI-CSRCKDGFYFKK----------ETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV-----------------------ASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC-VNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRF----NMSHMPMGSSRINLKVKYALNSNTNQSVYV------KNVFHLDKDRYDPGNIEVIMKKM 2966
            LC  G    P LH   + +  C ++  +  N          +  C  G+  +     C D +EC   N C N    C N +GSF C C +GF+   +  CEDI+EC  N  +C+   +C N  GSY+C  + P G+  +ED                                          PD   CVD +EC   P IC  G +CVNI GS+RCE +E     + ++ G  C   + G  F +           +R+     EC  + G   G   + ++C  LPG+     KK C  G   A +G    DIDECK M   C   + CVNT  S+ C                          PC    +      +C C  GY   +D   C D+DEC     +      ++C+N  G + C    +CPPG   +  ++ C D +EC +    C     C N  GS+ C C RG+ L  S   C DV+EC      +     +  C N  G Y+C CP+G+    Y   +C D NEC     CG    C NT+GSYKC C  G+        C D++EC      C  G C N  G Y C CPPG+    +  C      +  + + S +++ ++    ++    Y+C +N     GYTKK+         +  S  EP  A        +IS E + + S +  +  +S      ++  +      +N  ++Y ++      V+        +  H  K +  PG   + +  +
Sbjct: 2147 LCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNG--TCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCA--FRCMNTFGSYEC--TCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENG-RCVNIIGSYRCECNE---GFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGH--QCELC-PLPGTAQ--YKKICPHGPGYATDG---RDIDECKVMPSLCTNGQ-CVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPCNFICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHN----CQFLCVNTLGGFTC----KCPPGF--TQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDEC------DGNHRCQHGCQNILGGYRCGCPQGY-VQHYQWNQCVDENECSNPGACGSA-SCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYG-CSNTEGGYLCGCPPGYFRVGQGHCVSGMGFNKGQYL-SVDAEAEDDENALSPEACYECKIN-----GYTKKDG-------RRKRSAQEPEPA----SAEEQISLESVAMDSPVNMKFNLSGLGSKEHILELVPAIEPLNNHIRYVISQGNEDGVFRIHQRNGLSYLHTAKKKLAPGTYTLEITSI 2870          

HSP 8 Score: 166.777 bits (421), Expect = 2.544e-40
Identity = 200/723 (27.66%), Postives = 278/723 (38.45%), Query Frame = 3
Query:  831 MTTTSDATSALLKISQTTSSP-------------TVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNVNICSDD--------------------------------KKCKNNVGSYKCIRSIPC--------------GFGWKEDP------------------DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMN-VGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQ-----FDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVN--ECLLFRPEESCPD-------LEARCVNTAGS---------------YKCQCPKGFEWSDY-------PIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI--CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            M    DA    + + + TS+P                C  G +  P    C+  I  C +N +L  N          +  C+ GF      + C D +EC T N C N   +C+N  GSF+C C+ GF  +  G  C D+DEC    IC +                                   C   +    C+R  P               GFG    P                   T D  D++EC   P+IC  G+ C N+RGS+RC                   C  G+      R+C DIDEC +N +   NG C+      N PGSY C     C PG V       C D++EC+        +  C N   S+HC  SP +          D   G C     +   QD+ C +V+          C +L      P    C   A CP G  R    + C+DV+ECE   G CP N  CVN  GS+ C C  G  L  +   C D+    C L   E+ C         ++A C     +               Y+  CP+G  +++        P  K  DINEC A        +C NT+GS+KC+C  G+ L +    C DIDEC + P  C +GICVN PG +EC+C  G+ +    +  C DIDEC  +  +C        G  C+N  G ++C    CP+G+
Sbjct:  516 MGYKQDANGDCIDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNG--MCINEDGSFKCVCKPGFILAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICANGI-CENLRGSYRC------------------NCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCR------NTPGSYSCT----CPPGYVFRTETETCEDVNECESNPCV---NGACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTC-----WLNIQDNRC-EVNINGATLKSECCATLGAAWGSP-CERCELDAACPRGFARIKGVT-CEDVNECEVFPGVCP-NGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYK--DINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLC-------RGGTCVNTEGSFQC---DCPLGH 1182          

HSP 9 Score: 164.851 bits (416), Expect = 1.038e-39
Identity = 193/626 (30.83%), Postives = 256/626 (40.89%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------EDDECPINMKRNNKGIC--------SRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQF--------DYSVGKCMCRDGYRQNQDSIC-TDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNC---------------QDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCP----------------KGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVG----------------SYKCKC--FQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA-DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            GF+ +  ++ C D+NEC+   N C   +  C NT GSF C CQ G+   K    C D+DEC +  + C     C N  GS+KC     C  GW    +   C+D+DEC      C    +CVN  GS+RC              + DEC  N      G C          C+ GF    ++RSC+DIDEC+       G C       NLPG + CI    C  G  L + G  C DIDEC      C  + +CVNT   Y C    C P  Q         D  VG C  + G R +    C T+V         + C SL     +P          CPP +  +  Y+ C               +D+DEC+   G C Q  +C+N  GS++C C +GY L+     C D++EC    P    P     C NT G+Y C CP                K F +  Y    C   NE L  N   +   C   VG                 +K  C    G+   I      DIDEC   P  C NG+C+N  G + C+CP GF+  D   +C+DIDECS  + +C R +D      CIN  G Y+C    C  G+     G
Sbjct: 1306 GFMASMDMKTCIDVNECDLNPNICM--FGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKC----SCREGWVG--NGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCN------NLPGMFHCI----CDDGYELDRTGGNCTDIDECAD-PINCV-NGLCVNTPGRYECN---CPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSR--SSCCCSLGKAWGNPCE-------TCPP-VNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC-QGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFA-HPGVCGP---GTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCE--NE-LPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNAD------CINSPGSYRC---ECAAGFKLSPNG 1881          

HSP 10 Score: 164.466 bits (415), Expect = 1.621e-39
Identity = 174/569 (30.58%), Postives = 235/569 (41.30%), Query Frame = 3
Query: 1047 LFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECK-------------QMKFRCE---------PDEICVNTYSSYHC------------------------------VASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDI-----------NEC-LAANPCGKKHQCVNTVGS----------YKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDI 2525
            + NQ ++IC        AN C N    C+ TV S+RC+C  G+K    G C D+DEC + N CS +  C N  GSY C     C  G++  P    C+D+DEC     +C  G +CVN  GS +C                   C  GF    + ++C D DECT      NG      +C N  GS+ C+    C+PG +LA NG  C D+DEC+             +  FRC+            +CV+T+    C                                 PC P    + +    +C  G     D    D++ECA +   ++C +  IC N  GSY    R  C  G    +   NC D+DEC      C  N  C N  GSY C C  GY+  T   TC DVNEC      ES P +   C N  GS+ C+C  G + S   +  C D            N C +  N    K +C  T+G+              C +G+   I G TCED++EC + P  C NG CVN  G + C+CP G   D    +C DI
Sbjct:  483 ILNQTIDICK-----HHANLCLNGR--CIPTVSSYRCECNMGYKQDANGDCIDVDECTS-NPCS-NGDCVNTPGSYYC----KCHAGFQRTPTKQACIDIDECIQNGVLCKNG-RCVNTDGSFQC------------------ICNAGFELTTDGKNCVDHDECTTTNMCLNG------MCINEDGSFKCV----CKPGFILAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDG--RDINECALD--PDICAN-GICENLRGSY----RCNCNSGYEPDASGRNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNEC------ESNPCVNGACRNNLGSFHCECSPGSKLSSTGL-ICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGF-ARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDI 991          

HSP 11 Score: 118.627 bits (296), Expect = 2.009e-25
Identity = 88/223 (39.46%), Postives = 114/223 (51.12%), Query Frame = 3
Query: 2001 QDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKK-CTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            Q +D C+     C  N  C+  V SY+C C+ GY   +N  C DV+EC       S P     CVNT GSY C+C  GF+ +  P K+ C DI+EC+      K  +CVNT GS++C C  G+ L+  G  C D DEC      CLNG+C+N  G ++C C PGF  A     C D+DEC T  G+C       NG  CIN  G ++C    CP G      G
Sbjct:  486 QTIDICKHHANLC-LNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT------SNPCSNGDCVNTPGSYYCKCHAGFQRT--PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT-NMCLNGMCINEDGSFKCVCKPGFILAPNGRYCTDVDECQTP-GIC------MNGH-CINNEGSFRC---DCPPGLAVGVDG 687          

HSP 12 Score: 108.227 bits (269), Expect = 2.617e-22
Identity = 108/339 (31.86%), Postives = 153/339 (45.13%), Query Frame = 3
Query: 1755 CVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDI---DECLLEPRKCLNGICVN-VPG---RYEC--------------KCPPGFAADRKEIC----------QDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFI 2675
            C+   C P+     S  +C C  GY+Q+ +  C DVDEC  N   N       C+N PGSY C    +C  G  R+     C D+DEC      C +N  CVN  GS++C+C+ G+ LT++   C D +EC        C  L   C+N  GS+KC C  GF  +    + CTD++EC     C   H C+N  GS++C C  G  + + G  C D      C  E +K   G+CV   PG   + EC               CP   +A+   +C          +DI+EC+    +C+      NG +C NL G Y+C   +C  GY    +G   I
Sbjct:  498 CLNGRCIPT----VSSYRCECNMGYKQDANGDCIDVDECTSNPCSN-----GDCVNTPGSYYC----KCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTT---TNMC--LNGMCINEDGSFKCVCKPGFILAPNG-RYCTDVDECQTPGICMNGH-CINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKK---GVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICA------NG-ICENLRGSYRC---NCNSGYEPDASGRNCI 802          

HSP 13 Score: 66.2402 bits (160), Expect = 1.732e-9
Identity = 37/92 (40.22%), Postives = 50/92 (54.35%), Query Frame = 3
Query: 2223 CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA 2498
            C +GF   +     C D++EC A     +   C+NTVGS++C+C  G++ S +   CEDIDEC + P  C  G C N  G Y C CP GF  
Sbjct:  261 CRRGF-IPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGFVT 351          

HSP 14 Score: 55.8398 bits (133), Expect = 2.723e-6
Identity = 38/102 (37.25%), Postives = 50/102 (49.02%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVD 1343
            GF+ N     C D++EC+           C+NTVGSF C C  G K S+    CEDIDEC  +    +   C N VGSY C+    C  G+    D + C+D
Sbjct:  264 GFIPNIRTGACQDVDECQAIPGLCQGGN-CINTVGSFECRCPAGHKQSETTQKCEDIDECSVIPGVCETGDCSNTVGSYFCL----CPRGFVTSTDGSRCID 360          

HSP 15 Score: 55.4546 bits (132), Expect = 3.278e-6
Identity = 46/149 (30.87%), Postives = 61/149 (40.94%), Query Frame = 3
Query: 1161 CQKGF-KHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPG 1604
            C++GF  + + G C+D+DEC  +        C N VGS++C     C  G K+   T  C D+DEC   P +C  G  C N  GS+ C                   C  GF    +   C D    T   G  NGRC +      LPG
Sbjct:  261 CRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECR----CPAGHKQSETTQKCEDIDECSVIPGVCETG-DCSNTVGSYFC------------------LCPRGFVTSTDGSRCIDQRAGTCFSGLVNGRCAQ-----ELPG 381          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|P35556|FBN2_HUMAN (Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3)

HSP 1 Score: 213.386 bits (542), Expect = 8.736e-55
Identity = 212/639 (33.18%), Postives = 288/639 (45.07%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETA-NACANKWEICVNTVGSFRCDCQKGFKHS--KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC----------------EDDECPINMK-------RNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNM----HCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTD--INEC-LAANPCGKKHQCVNT-----VGSYKCKCFQGYRLSISGDTC---------------------------EDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKIS 2750
            G   +   E C DINEC  + N C N    CVN +G+++C C  G++ +  + G C DIDECM +N    D +C N+ GSY+C     C  G+   PD   C D+DECE  P+IC  G +C NI G +RC                + +EC +N          N KG  IC  C+ G+  KK T  C D+DEC   +G +N  C     C N+PGS+ C     CR G +   NGI C D+DEC     +C  +  CVNT  SY                  +C C +G+  +  + C+DVDECAEN   NLC +   C+N PG+Y    R EC  G   +S   +CQD+DEC        QN+     C N+ G + C+CD GY L  +   C D++EC      +    +   CVNT G Y+C CP  F+ +   +  C D  +  C L   P G      NT     V    C C  G       +TC                           EDIDEC   P  C  G C+N  G ++C+CP G+  ++   IC+DIDEC    GVC   +       C N LG Y C+   CP  Y +   G+  +   KS      N   C NE P+ ++
Sbjct: 1188 GHELSPSREDCVDINECSLSDNLCRNGK--CVNMIGTYQCSCNPGYQATPDRQG-CTDIDECMIMNG-GCDTQCTNSEGSYEC----SCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFIC-HCQLGYSVKKGTTGCTDVDEC--EIGAHN--CDMHASCLNIPGSFKC----SCREGWI--GNGIKCIDLDECSNGTHQCSINAQCVNTPGSY------------------RCACSEGFTGDGFT-CSDVDECAEN--INLCENGQ-CLNVPGAY----RCECEMGFTPASDSRSCQDIDECSF------QNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECA-----DPINCVNGLCVNTPGRYECNCPPDFQLNPTGVG-CVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFAHPGVCGPGT-------CYNTLGNYTCI---CPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVT 1758          

HSP 2 Score: 203.371 bits (516), Expect = 1.234e-51
Identity = 188/572 (32.87%), Postives = 260/572 (45.45%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSK-LGICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPK--GFEWSDYPIKKCT--------------------------DINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            GF F+       DI+EC E    CAN   +C+N +GSFRC+C  GF ++  L +CEDIDEC N  N+C  +  C N+ GSY+C     C  G+K  P+   CVD +EC   P +C  G+ CV+++GS++C                   C +GF   ++   C D+DEC  +    NG CK      N  GSY+C+    C PG  L  N   C DIDEC     +   +  C N   S+                  KC+C +GY    D   C D +EC    G    G+   C N  GS+ CI    CPPG    S   NC D++EC+     C     C N  G ++C+C  G++L+ N   C D  +   F   E+      +  NT  + KC C K  G  W D P + C                           D+NECL +       QC+NT GS++C+C  GY L  +G  C D DEC +    C NG C NV G +EC C  GF       C+DI+EC+ +  +C+          C+N  G Y+C   +CP+GY  +E
Sbjct: 1796 GFTFDIHTGKAVDIDECKEIPGICANG--VCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRC----ECAAGFKLSPN-GACVDRNECLEIPNVCSHGL-CVDLQGSYQC------------------ICHNGFKASQDQTMCMDVDECERHP-CGNGTCK------NTVGSYNCL----CYPGFELTHNN-DCLDIDECSSFFGQVCRNGRCFNEIGSF------------------KCLCNEGYELTPDGKNCIDTNECVALPGSCSPGT---CQNLEGSFRCI----CPPGYEVKS--ENCIDINECDEDPNICLFG-SCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKA-KCCCSKMPGEGWGD-PCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIG-NPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR--------CMNTFGSYEC---TCPIGYALRE 2287          

HSP 3 Score: 185.267 bits (469), Expect = 5.902e-46
Identity = 184/627 (29.35%), Postives = 263/627 (41.95%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CED--IDEC-----------------MNVNI------CSDDKKCKNN------VGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFR------CEPD-------EICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRD--GYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLF---------------------------RPEESCPDLE---------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            G+  ++    C DI+EC     C N   +CVNT G + C+C   F+ +  G+ C D  +  C                 + V +      CS  K   N       V S +     P G G++ +P T    D+DEC+  P +C  G  C+N  GS +CE                  C  G+Y  ++TR CEDIDEC  + G           C+N  G+Y CI    C P  +    G  C D+   K   +R      CE +        +C  TY+       PC P      +  K +C +  G+  +       D+DEC E  G  +C +  +CIN  GS+    R ECP G   + +   C+D+DEC  G+  C +N  C+N  GSY+C C  G+ L+ N  C D NECL                             + +  C D++           C NT GSY C C  GFE +      C DI+EC       C +  +C N +GS+KC C +GY L+  G  C D +EC+  P  C  G C N+ G + C CPPG+   + E C DI+EC     +C   S       C N  G ++C+   CP G+   + G
Sbjct: 1520 GYELDRTGGNCTDIDECADPINCVNG--LCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC-QGGNCINTFGSFQCE------------------CPQGYYLSEDTRICEDIDECFAHPGVCG-----PGTCYNTLGNYTCI----CPPEYMQVNGGHNCMDMR--KSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPG--ICAN-GVCINQIGSF----RCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHN--NDCLDIDECSSFFGQVC-RNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEV-KSENCIDINECDEDPNICLFGS-------CTNTPGGFQCL---CPPGFVLSDNG 2093          

HSP 4 Score: 180.259 bits (456), Expect = 1.757e-44
Identity = 209/725 (28.83%), Postives = 303/725 (41.79%), Query Frame = 3
Query: 1077 DINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC-----VASPCAPSQQFDYSVGKCM-----------------------CRDGYRQ--NQDSICT----------------------DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC---------------------------------------LLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRE-SDFQNGRLCINLLGYYKCVNSSCPVGY-----------TKKETGNG------FICELKSESICEPNDADCLNE----KPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYV 2897
            D+NEC E+   C+N    C+NT GSFRC+C  G+     G+ C D DEC   N C +   C N +GS++C     C  G++  P  N C D++EC   P +C    +C+N  GS+ C    CPI               G+  +++ + C+D+DEC   +     R     +C NL G++ CI    C PG     +G  C D +EC+     CE +  CVN   SY C       S  + ++  D   G C                        C DG R   +Q  +C                       D+DEC      NLC +   CIN  GS+ C     C  G       ++C D+DEC      C  N  C N  GSY+C C RGY+L  +  TC D++EC     + +C  L   CVNT G + C+CP GF         C D NEC +  + CG K  C NT GS+ C+C +G+ L  +G  CED+DEC                                          P  C +  C N  G Y+C CP GF+ D+    C D++ECS+S+  C+   S+ + G LC    GYY+     C  G            T+ +  N       + C++   S  +      ++E       +IS E +++ S +       +FN+SH  +GS    L+++ A+    N   YV
Sbjct: 2171 DVNECLESPGICSNGQ--CINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGN-GTCTNVIGSFEC----NCNEGFEPGPMMN-CEDINECAQNPLLCA--FRCMNTFGSYECT---CPI---------------GYALREDQKMCKDLDECAEGLHDCESR---GMMCKNLIGTFMCI----CPPGMARRPDGEGCVDENECRTKPGICE-NGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVM--PNLCTNGQ-CINTMGSFRCF----CKVGYTTDISGTSCIDLDECSQSPKPC--NYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQT--KQHNCQFL---CVNTLGGFTCKCPPGFTQHH---TACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSPEACYECKINGYSKKDSRQKRSIHEPDPTAVEQISLESVDMDSPVNM-----KFNLSH--LGSKEHILELRPAIQPLNNHIRYV 2835          

HSP 5 Score: 179.104 bits (453), Expect = 4.344e-44
Identity = 180/559 (32.20%), Postives = 259/559 (46.33%), Query Frame = 3
Query: 1077 DINECET-ANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKG-ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCR-----PGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECP-PGMF-------RSSMYSN----------CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDL--EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            DINEC    + CAN   IC N  GS+RC+C  G++    G  C DIDEC+   +  D+  C+N  GSY C  + P G+ ++ + +T  C D++ECE+ P + G    C N  GS  CE   C    K ++ G IC     G  +     S      C +N+   NG   +++ C  L  ++   P ++C      P  +    G+ C D++EC+     C P+  CVN+  S+HC    C      D +   C+     R  Q  +  D DEC           +  C    G+    +  ECP PG         R + ++N           +D++EC+   G C     C N +GS+KC C+ G+ L      C D++EC +       PDL     CVNT GS++C+C +G+E     +K C DI+EC       +   CVNT GS++C C  G+ LS S + C DI+EC L    C NG CVN+ G Y+C C PG+ A   ++ C DIDEC    G C  +        C N  G Y+C   SC  GY     G
Sbjct:  768 DINECALDPDICANG--ICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSC--TCPPGYVFRTETET--CEDINECESNPCVNG---ACRNNLGSFNCE---CSPGSKLSSTGLICIDSLKGTCWLNIQDS-----RCEVNI---NGATLKSECCATLGAAWG-SPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVC-PNGRCVNSKGSFHC---ECPEGLTLDGTGRVCL---DIRMEQCYLKWDEDECIHPVPGKF--RMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYG-KCRNTIGSFKCRCNSGFALDMEERNCTDIDECRIS------PDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQ--------CTNSEGSYEC---SCSEGYALMPDG 1278          

HSP 6 Score: 172.555 bits (436), Expect = 4.695e-42
Identity = 188/588 (31.97%), Postives = 256/588 (43.54%), Query Frame = 3
Query: 1065 EICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDK----KCKNNVGSYKCIRSIPCGFGW--------KED---------------PDTNDCV-DVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSL-YICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPE-ESCPDLEARCVNTAGSYKCQCPKGFEWSDY----PI-------KKCT----------DINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            E C DINEC E  N C   +  C NT G F+C C  GF  S  G  C D  +        + K    K  N   +  C   +P G GW        K+D               P  +D   DV+EC   P IC  G +C+N  GS RCE   CP+    +  G+                C D DEC++     NG C       N+ GS++C   +   PG ++      C DI+EC Q    C     C+NT+ SY                  +C C  GY   +D  +C D+DECAE  G + C S   +C N  G++ CI    CPPGM R      C D +EC T  G C +N  CVN++GSY+C C+ G+  +S+ T C D  + L F    ++   + +   N     +C C  G  W       P+       K C           DI+EC          QC+NT+GS++C C  GY   ISG +C D+DEC   P+ C N IC N  G Y+C CP G+   +  + C+D+DEC T +  C          LC+N LG + C    CP G+T+  T
Sbjct: 2052 ENCIDINECDEDPNICL--FGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMP-GEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNG-QCINTDGSFRCE---CPMGYNLDYTGV---------------RCVDTDECSIGNPCGNGTCT------NVIGSFECNCNEGFEPGPMMN-----CEDINECAQNPLLCAFR--CMNTFGSY------------------ECTCPIGYALREDQKMCKDLDECAE--GLHDCESRGMMCKNLIGTFMCI----CPPGMARRPDGEGCVDENECRTKPGIC-ENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPC-NYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQ--------FLCVNTLGGFTC---KCPPGFTQHHT 2567          

HSP 7 Score: 170.629 bits (431), Expect = 1.955e-41
Identity = 166/506 (32.81%), Postives = 229/506 (45.26%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNV--NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTM--NVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDE-----------CKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQ--NQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEA-RCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPC-GKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA 2498
            GF  +Q   +C D++ECE  + C N    C NTVGS+ C C  GF+ +    C DIDEC +    +C +  +C N +GS+KC+    C  G++  PD  +C+D +EC A P  C PG  C N+ GS RC                   C  G+  K E  +C DI+EC    N+  +         C N PG + C+    C PG VL+ NG  C D  +           C   K        C  +         PC    + D    + +C  G+    +      DV+EC E+ G  +C S   CIN  GS+    R ECP G         C D DEC  G      N  C NV+GS++C C+ G+       C D+NEC         P L A RC+NT GSY+C CP G+   +   K C D++EC    + C  +   C N +G++ C C  G      G+ C D +EC  +P  C NG CVN+ G Y C+C  GF +
Sbjct: 1922 GFKASQDQTMCMDVDECER-HPCGNG--TCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRN-GRCFNEIGSFKCL----CNEGYELTPDGKNCIDTNECVALPGSCSPGT-CQNLEGSFRC------------------ICPPGYEVKSE--NCIDINECDEDPNICLFGS-------CTNTPGGFQCL----CPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPG--IC-SNGQCINTDGSF----RCECPMGYNLDYTGVRCVDTDECSIGNPC--GNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQN------PLLCAFRCMNTFGSYECTCPIGYALRE-DQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQS 2371          

HSP 8 Score: 166.007 bits (419), Expect = 5.231e-40
Identity = 200/723 (27.66%), Postives = 279/723 (38.59%), Query Frame = 3
Query:  831 MTTTSDATSALLKISQTTSSPTV-------------LCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNVNICSDD--------------------------------KKCKNNVGSYKCIRSIPC--------------GFGWKEDP------------------DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMN-VGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQ-----FDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVN--ECLLFRPEESCPD-------LEARCVNTAGS---------------YKCQCPKGFEWSDY-------PIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI--CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            M    DA    + + + TS+P                C  G +  P    C+  I  C +N +L  N          +  C+ GF      + C D +EC T N C N   +C+N  GSF+C C+ GF  +  G  C D+DEC    IC +                                   C   +    C+R  P               GFG    P                   T D  D++EC   P+IC  G+ C N+RGS+RC                   C  G+      R+C DIDEC +N +   NG C+      N PGSY C     C PG V       C DI+EC+        +  C N   S++C  SP +          D   G C     +   QDS C +V+          C +L      P    C     CP G+ R    + C+DV+ECE   G CP N  CVN  GS+ C C  G  L  +   C D+   +C L   E+ C         ++A C     +               Y+  CP+G  +++        P  K  DINEC A        +C NT+GS+KC+C  G+ L +    C DIDEC + P  C +GICVN PG +EC+C  G+ +    +  C DIDEC  +  +C        G  C+N  G ++C    CP+G+
Sbjct:  523 MGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACID-IDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNG--MCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGI-CENLRGSYRC------------------NCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCR------NTPGSYSCT----CPPGYVFRTETETCEDINECESNPCV---NGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTC-----WLNIQDSRC-EVNINGATLKSECCATLGAAWGSP-CERCELDTACPRGLARIKGVT-CEDVNECEVFPGVCP-NGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYK--DINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLC-------RGGTCVNTEGSFQC---DCPLGH 1189          

HSP 9 Score: 166.007 bits (419), Expect = 5.603e-40
Identity = 192/626 (30.67%), Postives = 259/626 (41.37%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------EDDECPINMKRNNKGIC--------SRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQF--------DYSVGKCMCRDGYRQNQDSIC-TDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNC---------------QDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCP----------------KGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVG----------------SYKCKC--FQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA-DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            GF+ +  ++ C D+NEC+  +N C   +  C NT GSF C CQ G+   K    C D+DEC +  + C     C N  GS+KC     C  GW    +   C+D+DEC      C    +CVN  GS+RC              + DEC  N+     G C          C+ GF    ++RSC+DIDEC+       G C       NLPG + CI    C  G  L + G  C DIDEC      C  + +CVNT   Y C    C P  Q         D  VG C  + G R +    C T++         + C SL     +P          CPP +  +  Y+ C               +D+DEC+   G C Q  +C+N  GS++C C +GY L+ +   C D++EC    P    P     C NT G+Y C CP                K F +  Y    C   NE L  N   +   C   VG                 +K  C    G+   I      DIDEC   P  C NG+C+N  G + C+CP GF+  D   +C+DIDECS  + +C R +D      CIN  G Y+C    C  G+     G
Sbjct: 1313 GFMASMDMKTCIDVNECDLNSNICM--FGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKC----SCREGWIG--NGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCN------NLPGMFHCI----CDDGYELDRTGGNCTDIDECAD-PINCV-NGLCVNTPGRYEC---NCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSR--SSCCCSLGKAWGNPCE-------TCPP-VNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLC-QGGNCINTFGSFQCECPQGYYLSEDTRICEDIDECFA-HPGVCGP---GTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCE--NE-LPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNAD------CINSPGSYRC---ECAAGFKLSPNG 1888          

HSP 10 Score: 160.999 bits (406), Expect = 1.624e-38
Identity = 173/573 (30.19%), Postives = 235/573 (41.01%), Query Frame = 3
Query: 1047 LFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECK-------------QMKFRCE---------PDEICVNTYSSYHC------------------------------VASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCP----------------KGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSY------KCK----CFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDI 2525
            + NQ ++IC        AN C N    C+ TV S+RC+C  G+K    G C D+DEC + N C+ +  C N  GSY C     C  G++  P    C+D+DEC     +C  G +CVN  GS +C                   C  GF    + ++C D DECT      NG      +C N  GS+ CI    C+PG VLA NG  C D+DEC+             +  FRC+            +CV+T+    C                                 PC P    + +    +C  G     D    D++ECA +   ++C +  IC N  GSY    R  C  G    +   NC D+DEC      C  N  C N  GSY C C  GY+  T   TC D+NEC      ES P +   C N  GS+ C+C                 KG  W +    +C      +  N    K +C  T+G+       +C+    C +G    I G TCED++EC + P  C NG CVN  G + C+CP G   D    +C DI
Sbjct:  490 ILNQTIDICK-----HHANLCLNGR--CIPTVSSYRCECNMGYKQDANGDCIDVDECTS-NPCT-NGDCVNTPGSYYC----KCHAGFQRTPTKQACIDIDECIQNGVLCKNG-RCVNTDGSFQC------------------ICNAGFELTTDGKNCVDHDECTTTNMCLNG------MCINEDGSFKCI----CKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG--RDINECALD--PDICAN-GICENLRGSY----RCNCNSGYEPDASGRNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTCPPGYVFRTETETCEDINEC------ESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCE-----VNINGATLKSECCATLGAAWGSPCERCELDTACPRGL-ARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDI 998          

HSP 11 Score: 119.783 bits (299), Expect = 8.752e-26
Identity = 88/223 (39.46%), Postives = 114/223 (51.12%), Query Frame = 3
Query: 2001 QDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKK-CTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            Q +D C+     C  N  C+  V SY+C C+ GY   +N  C DV+EC       S P     CVNT GSY C+C  GF+ +  P K+ C DI+EC+      K  +CVNT GS++C C  G+ L+  G  C D DEC      CLNG+C+N  G ++C C PGF  A     C D+DEC T  G+C       NG  CIN  G ++C    CP G      G
Sbjct:  493 QTIDICKHHANLC-LNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT------SNPCTNGDCVNTPGSYYCKCHAGFQRT--PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT-NMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTP-GIC------MNGH-CINSEGSFRC---DCPPGLAVGMDG 694          

HSP 12 Score: 106.301 bits (264), Expect = 9.900e-22
Identity = 80/211 (37.91%), Postives = 105/211 (49.76%), Query Frame = 3
Query: 1950 RAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECST-----SEGVCSR 2561
            R EC  G ++     +C DVDEC +       N  CVN  GSY C C  G+  T +   C D++EC+    +        RCVNT GS++C C  GFE +    K C D +EC   N C     C+N  GS+KC C  G+ L+ +G  C D+DEC   P  C+NG C+N  G + C CPPG A      +C D    ST      +GVC R
Sbjct:  518 RCECNMG-YKQDANGDCIDVDECTSNPCT---NGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECI----QNGVLCKNGRCVNTDGSFQCICNAGFELTT-DGKNCVDHDECTTTNMC-LNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQT-PGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVR 717          

HSP 13 Score: 105.531 bits (262), Expect = 1.837e-21
Identity = 107/339 (31.56%), Postives = 153/339 (45.13%), Query Frame = 3
Query: 1755 CVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDI---DECLLEPRKCLNGICVN-VPG---RYEC--------------KCPPGFAADRKEIC----------QDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFI 2675
            C+   C P+     S  +C C  GY+Q+ +  C DVDEC  N   N       C+N PGSY C    +C  G  R+     C D+DEC      C +N  CVN  GS++C+C+ G+ LT++   C D +EC        C  L   C+N  GS+KC C  GF  +    + CTD++EC     C   H C+N+ GS++C C  G  + + G  C D      C    +K   G+CV   PG   + EC               CP   +A+   +C          +DI+EC+    +C+      NG +C NL G Y+C   +C  GY    +G   I
Sbjct:  505 CLNGRCIPT----VSSYRCECNMGYKQDANGDCIDVDECTSNPCTN-----GDCVNTPGSYYC----KCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTT---TNMC--LNGMCINEDGSFKCICKPGFVLAPNG-RYCTDVDECQTPGICMNGH-CINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKK---GVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICA------NG-ICENLRGSYRC---NCNSGYEPDASGRNCI 809          

HSP 14 Score: 77.411 bits (189), Expect = 6.778e-13
Identity = 63/191 (32.98%), Postives = 88/191 (46.07%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETD---VCFNLPGSY 1610
            F Q    C D NEC +  +      IC NT GSF C+CQ+GF     G+ CED+DEC   + C     C+N +G Y+C     C  G+ +    N CVD +EC + P  CG    C N  GS++C                   C  GF F + + +C D++EC+ +    N  C  T+   +C   PG Y
Sbjct: 2562 FTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQ--HGCQNILGGYRC----GCPQGYIQHYQWNQCVDENEC-SNPNACG-SASCYNTLGSYKCA------------------CPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYY 2726          

HSP 15 Score: 65.0846 bits (157), Expect = 4.134e-9
Identity = 36/92 (39.13%), Postives = 50/92 (54.35%), Query Frame = 3
Query: 2223 CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA 2498
            C +GF   +     C D++EC A     +   C+NTVGS++C+C  G++ S +   CEDIDEC + P  C  G C N  G Y C CP G+  
Sbjct:  261 CRRGF-IPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVT 351          

HSP 16 Score: 56.6102 bits (135), Expect = 1.698e-6
Identity = 38/102 (37.25%), Postives = 51/102 (50.00%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVD 1343
            GF+ N     C D++EC+           C+NTVGSF C C  G K S+    CEDIDEC  +    +  +C N VGSY C+    C  G+    D + C+D
Sbjct:  264 GFIPNIRTGACQDVDECQAIPGICQGGN-CINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCV----CPRGYVTSTDGSRCID 360          

HSP 17 Score: 54.6842 bits (130), Expect = 6.070e-6
Identity = 46/129 (35.66%), Postives = 57/129 (44.19%), Query Frame = 3
Query: 1293 PCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACND 1679
            PC  G+  +  T  C DVDEC+A P IC  G  C+N  GS  C                  RC  G    + T+ CEDIDEC++  G       ET  C N  GSY C+    C  G V + +G  C D
Sbjct:  260 PCRRGFIPNIRTGACQDVDECQAIPGIC-QGGNCINTVGSFEC------------------RCPAGHKQSETTQKCEDIDECSIIPGIC-----ETGECSNTVGSYFCV----CPRGYVTSTDGSRCID 360          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A4E0RDM7 (Fibulin-2 OS=Fasciola hepatica OX=6192 GN=D915_004705 PE=4 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 307/757 (40.55%), Postives = 430/757 (56.80%), Query Frame = 3
Query:  843 SDATSALLKISQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINECETA-----NACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP--CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRK------CLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTR 3071
            ++ T+ +      T +  V C     W+    +CV+LI +CP    L+  + KCV      V C  GF FN+  + C DINECE         C  +  IC N  GS++C C +GF+ ++ G C DI+EC +  N C   ++C+N +GSY+C+R +PCGFG+  +P T  C DV+EC+A P ICG GM C+N+RG H+C D +CP   +R+  G C  C  G+ F   + SCED+DEC+        +CK  + C N  G + C  K  C  GT +  NG +C+DIDEC +  F C  DEIC+N   SY CV SPC+ +Q +DYS   C C  G R +    C D++EC E     +C     C+NH G + C++  EC PG  R   +  C+D+DEC TG  KC  NM+C+N +GS++C+C+RG+    + TC DV+EC +F  + SCPD  ARCVNT GS+ C CP GF W DYPI KC DI+EC A  P  CGK+H+CVN  GSY C C  GY+ +     C DIDEC     +      C + +CVN PG YEC+CP GF       C DIDEC+   GVC  +      + C+NL+G Y+CV++ CP  YTK   GNGF CEL     C P DA CL E+P  +   FIE+  D    + ++R +  H+P G  R++L+  YA +  T   V V   F L + R   G +EVI+ + +  PV+IL+ L +     ++ +GHS + + L++T+
Sbjct:  273 TEGTTEVATQKTNTENVPVECAANFAWDAEQELCVRLITACPIGMYLNKTSKKCVKRGTETVTCLSGFRFNETSDTCTDINECEDGLPSGEKPCVGEGMICTNYPGSYKCSCSEGFQMAEDGTCVDINECNLPKNPCRSGQQCRNIIGSYQCVRQVPCGFGYVLNPKTQQCEDVNECKADPNICGRGMMCINVRGGHKCVDQKCPGKARRDRFGNCVPCPAGYLFNATSNSCEDVDECSTA-----DQCKPWERCVNQMGYFVCQQKLNCEHGTRINANGTSCDDIDECTEKSFNCRSDEICMNKPGSYDCVPSPCSITQIYDYSNKTCTCEAGLR-DVGGNCVDINECEET--PFMCALGEKCVNHIGGFRCVRMNECQPGFERDGPFGVCRDIDECRTGMAKCGPNMYCLNTIGSFQCLCERGFKNLDHETCVDVDECQVFGSQASCPDPRARCVNTNGSHLCVCPDGFIWVDYPISKCKDIDEC-AQQPDRCGKEHRCVNVEGSYNCVCAPGYQATEDSKRCVDIDECQAHLYQSNSRNLCPHSLCVNTPGSYECRCPDGFRLGPGGRCYDIDECNDIPGVCKSKHAIGYSQACVNLVGGYRCVSNECPPSYTKSRLGNGFRCELNPAHACVPGDAACLAERPQTMDNLFIELDQDTGVPQILTRVDTRHLPSGVIRVDLRQHYANHLRTRNPVRVDQAFRLQRSRTQFGKVEVILIRSLPAPVDILISLHLIASKGDVQVGHSITKLYLFVTQ 1020          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A087W1G0 (Fibulin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000223300 PE=4 SV=2)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 304/766 (39.69%), Postives = 444/766 (57.96%), Query Frame = 3
Query:  828 PMTTTSDATSALLKISQTTSS--PTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINECETA--------NACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAE--NGGDN---LCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLE--PRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLT 3068
            P+T  S +  +     QT  S    ++C+ G  W     +C+  +  CPK   L  N SKC+P +  +  C  G+ F   +  C D+NECE           AC    + C+NT GS+ C+C++GF+ ++ G C DIDEC  ++ +C    +C+N +GS++CIR +PCGFG+  + +T +C D+DEC+A P+ICGP M CVN+RG  +C    CP  ++RN+ G+C  C  G+ F +   SCEDI+EC +NV      C+  + C N PG Y C PK +C  G  L +NG +C+DIDECK   F C   +ICVNT  +Y C  SPC  ++++DY++ KC+C  G+ Q++   C D+DECAE    GD    LCGS  +C+N  G+Y C+   +CP G  R+S  ++C D++EC TGE  C  NMHC N +GSY+C+C+RG+   ++  CAD+NEC +FRPEESCPD  ARCVNTAGSY+C CP GF W  YP+  C D+NEC L  + CG +H+CVN  G Y C+C +GYR +    TC DI+EC  +     C +GICVN PG + C CP GF   +   C D++EC   +G+C+          C+NL G Y+CV+  CP  Y K++  NG+ C L  E  C   D  CL ++P +I +  IE+ S +K R  +   + S +  G+  + L   YA ++ T + + VKN   L     D   +E+++ + I PP +I + + + + H +     S +   LY T
Sbjct:  296 PLTVPSHSRPSYSPPPQTQRSTEAELVCEPGFTWNSEKQLCLHTLARCPKGMYLSVNQSKCLPKIGDRFKCPPGYEFRNDMNGCEDVNECEEGVLEGSHYMAACPKSGQQCINTGGSYECNCKQGFQKTRDGECVDIDECKASLEVCKAGYECRNVIGSFQCIRQVPCGFGYVLNSETQECEDIDECKAQPDICGPNMICVNVRGGMKCVPKRCPGKLRRNSNGLCMPCPSGYTFNERRNSCEDINECELNVTL----CRTFERCTNRPGDYICEPKLRCEMGFQLNKNGTSCDDIDECKLRAFNCRHGQICVNTPGAYKCELSPCHLTERYDYALEKCVCSTGF-QHRGRECVDIDECAEEEKHGDRQNPLCGSHQVCVNTVGAYRCVTLTDCPKGFHRTSPKASCTDINECATGEANCGPNMHCENTLGSYRCLCERGFKNINDTACADINECEVFRPEESCPDRRARCVNTAGSYRCICPNGFVWHSYPVYACRDVNECVLEIDTCGPEHRCVNDEGGYHCECAKGYRRNWDNRTCIDINECTEKGVGAMCQSGICVNTPGSFRCDCPFGFRLGKGGNCVDVNECQERDGICTSRHARGITFSCVNLHGSYRCVSERCPSMYVKQKIPNGYRCSLMPEYECNTFDPYCLKDRPLRIDHLHIELPSVLKKRIVLGELDSSVVKRGTVNVELLEHYAYDTRTKRHISVKNSLKLAVKASDRRTVELLLVRPIEPPADIFVSVRLSEMHGQRRKVRSNTRFYLYAT 1056          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A4S2LUA0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004814 PE=4 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 341/947 (36.01%), Postives = 490/947 (51.74%), Query Frame = 3
Query:  327 CVLFARSCCIKVYSAKICQLGSSQTE-------SCEKYISDLSPVLNQIKMECCMC--CKHGNGGLLFESCSMLK---------GNCSRTRNKDSSRSLGTSA-TPSPNRLFSAQIHSYQPRP---TKATVTNESSVEDISNGNAENNNTVGWEXXXXXXXXXXXXXGKTTEISMKSTRKMSQISLKANPMTTTSDATSALLKISQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINEC-----ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLE---PRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTR 3071
            C      CC+ + + + C++GS           + E + + +   L+ +  ECC+C      NG  L E   M             C    N  ++ SL  S+ T +P  +    +H   P+     ++T TN  S++       E     G        T S   + +T EIS          S+ + P TTT   T             ++LC +   W+    +C++L+ +CP    L+  T+KC   +     C  G+ FN+    C D+NEC       + AC  +   CVN  GS+ C C  GF  ++ G C DI+EC +  N C   ++C+N +GS++C+R +PCGFG+  +P T  C DV+EC+A P ICGPGM C+N+RG H+C D  CP   +R+  G C  C  G+ F   T SC+D++EC+ N       CK  + C N  G + C  K  C  G     NG  C DIDEC +  F C  DE+CVNT   Y CV SPC P+Q FDY V  C C  G++ N +  C D++EC E   DN C     CINH G + CI+  EC PG  R S YS CQD+DEC  G  KC  NM+C+N  GSY CMC +G+    + TC D++ECLLF  +  CPD  ARCVNT GS+ C CP+G+ W  YP  KC DI+EC    + CGK+HQCVN  GSYKC C  GY+   +  +C DIDEC  +   P+ C   +CVN PG + C+CP GF   R   C DIDEC+  E VC  +      + C+NL+G Y+CV S CP  Y K   GNG+ C+L +   C P D++C  E+P +I   F E+  + +  + ++R +   MP G  R++L+  YA +  T   + V   F L +     G +EV++ + I  PV++L+ L +     ++ LG + + + L++T+
Sbjct:   34 CQRVKHLCCVSMRTRRACRIGSEHVVQNGGKRCTGEAWKATVEIQLHGVAKECCLCRLVWTANGSDLKEWHEMRSSAQKSACPGAGCCSLLNSVTADSLQISSDTEAPGGM---NLHENLPQSDEGKQSTATNPVSLQPNEPDEFEFTMVGG----VGFSTNSSSYTAQTDEISG---------SIASVPQTTTLSGTE----------DTSILCHENYVWDKEQELCIRLMTACPIGMYLNRTTNKCTRRIAALESCDTGYRFNEENSSCEDVNECVEGLVNGSQACPGEGMSCVNIPGSYNCSCMPGFSMAQDGSCVDINECDLLRNPCHSGQQCRNIIGSFQCVRQVPCGFGYVLNPKTQQCEDVNECKADPNICGPGMLCINVRGGHKCVDQICPGKARRDRNGHCVPCPQGYVFNVTTGSCDDVNECSGN-----NLCKPWEQCVNKKGYFVCEQKMNCVHGKRADSNGTECVDIDECMEKSFNCALDEVCVNTDGGYKCVPSPCNPTQIFDYEVKNCTCPKGWK-NVNETCIDINECEEL--DNPCPPGETCINHAGGHRCIKLNECAPGFERPSPYSQCQDIDECALGVAKCGDNMNCLNTAGSYMCMCKQGFKNLDDQTCVDLDECLLFGADSVCPDPRARCVNTNGSHICLCPEGYTWHSYPANKCVDIDECAQQQDRCGKEHQCVNLDGSYKCICAAGYQTGENHKSCVDIDECSGQPDSPKLCPYSMCVNTPGSFMCQCPYGFRLGRSNRCYDIDECAEIEDVCQPKYATAASQTCVNLVGGYRCVPSQCPPSYKKTFLGNGYRCDLDAAHACVPGDSNCFAERPQRIDSMFKELDQNTRIPQVLARVDTKTMPHGVIRVDLRQHYANDLRTRNPIKVGQAFRLRRSPSHVGQVEVVLIRSIPAPVDMLISLHLISTRNDLQLGLAITKLYLFVTQ 946          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A068WQV0 (Fibulin OS=Echinococcus granulosus OX=6210 GN=EgrG_000223300 PE=4 SV=1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 298/749 (39.79%), Postives = 438/749 (58.48%), Query Frame = 3
Query:  873 SQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINECETA--------NACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAE--NGGDN---LCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRK--CLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLT 3068
            +Q ++   ++C+ G  W P   +C+  +  CPK   L  N SKC+P +  +  C  G+ F   +  C D+NECE           AC    + C+NT GS+ C+C++GF+ ++ G  E IDEC  +  +C    +C+N +GS++CIR +PCGFG+  + +T +C D+DEC+A P+ICGP M CVN+RG  +C   +CP  ++RN+ G+C  C  G+ F +   SCEDI+EC +N       C+  + C N PG Y C PK +C  G  L +NG +C+DIDECK   F C   +ICVNT  +Y C  SPC  ++++DY++ KC+C  G+ Q++   C D+DECAE    GD    LCGS  +C+N  G+Y C+   +CP G  R+S  ++C D++EC TGE  C  NMHC N +GSY+C+C+RG+   ++  CAD+NEC +FRPEESCPD  ARCVNTAGSY+C CP GF W  YP+  C D+NEC L  + CG +H+CVN  G Y C+C +GYRL+    TC DI+EC  +     C +GICVN PG + C CP GF   +   C D++EC   +G+C+          C+NL G Y+CV+  CP  Y K++  NG+ C L  E  C   D  CL ++P +I +  IE+ S +K R  +   + S +  G+  + L   YA ++ T + + VKN   L     D   +E+++ + I PP +I + + + +   +     S +   LY T
Sbjct:  315 TQRSTEAELVCEPGFTWNPEKQLCLHTLARCPKGMYLSVNQSKCLPKIGDRFKCPPGYEFRNDMNGCEDVNECEEGVLEGSHYVAACPKSGQQCINTGGSYECNCKQGFQKTRDG--EYIDECKASSEVCKAGYECRNVIGSFQCIRQVPCGFGYVLNSETQECEDIDECKAQPDICGPNMICVNVRGGMKCVPKKCPGKLRRNSNGLCMPCPSGYTFNERRNSCEDINECELNATL----CRAFERCTNRPGDYICEPKLRCEMGFQLNKNGTSCDDIDECKLKAFNCRHGQICVNTPGAYECELSPCHLTERYDYALEKCVCSTGF-QHRGRECVDIDECAEEEKHGDRQNPLCGSHQVCVNTVGAYRCVTLTDCPKGFHRTSPKASCTDINECATGEANCGPNMHCENTLGSYRCLCERGFKNINDTACADINECEVFRPEESCPDRRARCVNTAGSYRCICPNGFVWHSYPVYACRDVNECVLEIDTCGPEHRCVNDEGGYHCECAKGYRLNWDNRTCIDINECTEKGAGALCQSGICVNTPGSFRCDCPSGFRLGKGGNCVDVNECQERDGICTSRHARGITFSCVNLHGSYRCVSKRCPSMYVKQKIPNGYRCSLMPEYECNTFDPYCLKDRPLRIDHLHIELPSVLKKRIVLGELDSSVVKRGTVNVELLEHYAYDTRTKRHISVKNSLKLAVKASDRRTVELLLVRPIEPPADIFVSVRLSEMRGQRSKVRSNTRFYLYAT 1056          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A074ZJX6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06607 PE=4 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 5.942e-180
Identity = 302/754 (40.05%), Postives = 428/754 (56.76%), Query Frame = 3
Query:  849 ATSALLKISQTTSSP---TVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINEC-----ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLE---PRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTR 3071
             TSA + ++ T SS    ++LC +   W+    +C++L+ +CP    L+  T+KC   V     C  G+ FN+    C D+NEC       + AC  +   CVN  G++ C C  GF  ++ G C DI+EC +  N C   ++C+N +GS++C+R +PCGFG+  +P T  C DV+EC+A P ICGPGM C+N+RG H+C D  CP   +R+  G C  C  G+ F   T SC+D++EC+++       CK  + C N  G + C  K  C  G     NG  C DIDEC +  F C  DE+CVNT   Y CV SPC P+Q FDY +  C C  G++ N +  C D++EC E   D+ C     CIN  GS+ CI+  EC PG  R S YS CQD+DEC  G  KC  NM+CVN  GSY CMC +G+    + TC D++ECLLF  +  CPD  ARCVNT GS+ C CP+G+ W  YP  KC DI+EC    + CGK+HQCVN  GSYKC C  GY+   +  +C DIDEC  +   P+ C   +CVN PG + C+CP GF   R   C DIDEC+  E VC  +      + C+NL+G Y+CV S CP  Y K   GNG+ C+L +   C P D++C  E+P +I   F E+  + +  + ++R +   MP G  R++L+  YA +  T   + V   F L +     G +EV++ + I  PV++L+ L V     ++ LG + + + L++T+
Sbjct:  303 GTSASVPLTTTPSSTEDTSILCHENYVWDKEQELCIRLMTACPIGMYLNRTTNKCTRRVATLESCDAGYRFNEEKSSCEDVNECVEGLVNGSQACPGEGMSCVNVPGTYNCSCTSGFSMAQDGSCVDINECDVLRNPCHSGQQCRNIIGSFQCVRQVPCGFGYVLNPKTQQCEDVNECKADPNICGPGMLCINVRGGHKCVDQICPGKARRDKHGNCVPCPQGYVFNVTTGSCDDVNECSVS-----NLCKPWEQCVNKKGYFVCEQKMNCVHGKRADSNGTECVDIDECLEKSFHCALDEVCVNTDGGYKCVPSPCNPTQIFDYELKNCTCPKGWK-NVNETCIDINECEEM--DSPCSPGETCINRAGSHRCIRLNECAPGFERPSPYSQCQDIDECALGIAKCGDNMNCVNTAGSYMCMCKQGFKNLDDQTCVDLDECLLFGADSVCPDPRARCVNTNGSHICLCPEGYTWHSYPANKCVDIDECAQQQDRCGKEHQCVNLEGSYKCICAVGYQTGENHKSCVDIDECSGQPDSPKLCPYSMCVNTPGSFMCQCPYGFRLGRSNRCYDIDECAEIEDVCQPKYATAASQTCVNLVGGYRCVPSQCPPSYKKTFLGNGYRCDLDAAHACVPGDSNCFAERPQQIDSIFKELDQNTRVPQVLARVDTKTMPHGVIRVDLRQHYANDLRTRNPIKVGQAFRLRRSPSHVGQVEVVLIRSIPAPVDMLISLHVISTRNDLQLGLAITKLYLFVTQ 1048          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000010369.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:72873715:72914547:-1 gene:ENSAMXG00000010096.2 transcript:ENSAMXT00000010369.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 1.180e-57
Identity = 188/623 (30.18%), Postives = 253/623 (40.61%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP----DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE------TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI------ACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-------CTDVDECAENGGDNLCGSLYICINHPGSYACIQR---AECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINECLAA-NPCGKKHQCVNTVGSYKCKCFQGYR-----LSIS-GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE---------LKSESICEPNDADCLNEK 2735
            D++EC    +      IC NT+G + C C+ GF   +S L +     C D+DEC +  + C  +  C N +G Y C  S   GF           +N C DVDEC      CGP   C N  G + C                   C+ GF           +  C D+DEC +        C    +C N  G Y+C     CR G ++  + +       C+D+DEC      C P+ IC NT   Y+                  C CR G+     ++       CTDVDEC      ++CG   IC N  G Y C  R       P +  S+  + C DVDEC T    C  N  C N +G Y C C  G+ +T       + N C DV+EC   +P  S     + C NT G Y C C  GF  ++  +       CTD++EC  A + CG    C NT+G Y C C  G+      L++S  + C D+DEC   P  C  N IC N  G Y C C  GF      +       C D+DEC  +  +C   S      +C N +G Y C   SC  G+T                    L + SIC PN + CLN K
Sbjct:  168 DVDECVLGTSACGPNSICSNTIGGYNCSCRTGFIVTNSSLPVNISNPCSDVDECVLGTSACGPNSICSNTIGGYNC--SCWTGFTVTNSSLPVNISNPCSDVDECVLGTSACGPNSICSNTIGGYNCS------------------CRTGFIVTNSSLPVNISNPCSDVDECVLGT----SACGPNSICSNTIGGYNC----SCRTGFIVTNSSLPVNISNPCSDVDECATAPSICGPNSICSNTIGGYN------------------CSCRTGFTATNPALNLSTANPCTDVDECKP--APSICGPNSICSNTIGGYNCSCRTGFTATNPALNLSTA-NPCTDVDECATAPSICGPNSICSNTIGGYNCSCRTGFTVTNPALNLSTTNLCTDVDEC---KPAPSICGPNSICSNTIGGYNCSCRTGFTATNPDLNLSTTNPCTDVDECATAPSICGPNSICSNTIGGYNCSCRTGFTATNPALNLSTTNPCTDVDECKPAPSICGPNSICSNTIGGYNCTCRTGFIVTNPALNLSTANPCTDVDECKPAPSICGPNS------ICSNTIGGYNC---SCRTGFTATNPALNLSTTNPCTDVDKCLTTPSICGPN-STCLNTK 728          

HSP 2 Score: 213.001 bits (541), Expect = 6.507e-56
Identity = 196/681 (28.78%), Postives = 276/681 (40.53%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGF--KHSKLGI-----CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP----DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFK------KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI------ACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQR---AECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI-----KKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYR-----LSIS-GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEV 2951
            C D++EC    +      IC NT+G + C C+ GF   +S L +     C D+DEC +  + C  +  C N +G Y C  S   GF           +N C DVDEC   P ICGP   C N  G + C                   C+ GF              C D+DEC          C    +C N  G Y+C     CR G       +       C D+DEC      C P+ IC NT   Y+C               G  +       +  ++CTDVDEC      ++CG   IC N  G Y C  R       P +  S+  + C DVDEC T    C  N  C N +G Y C C  G+        L++ N C DV+EC   +P  S     + C NT G Y C C  GF  ++  +       CTD++EC  A + CG    C NT+G Y C C  G+      L++S  + C D+D+CL  P  C  N  C+N  G Y C C  GF A    +       C D+DEC  ++  C + ++      C N +G Y C   SC +G+T   +         S S+   N    + E P  +S    E     KF  T++  N            ++ K ++ ++ N +       +L    Y PG+++V
Sbjct:  264 CSDVDECVLGTSACGPNSICSNTIGGYNCSCRTGFIVTNSSLPVNISNPCSDVDECVLGTSACGPNSICSNTIGGYNC--SCRTGFIVTNSSLPVNISNPCSDVDECATAPSICGPNSICSNTIGGYNCS------------------CRTGFTATNPALNLSTANPCTDVDECKP----APSICGPNSICSNTIGGYNC----SCRTGFTATNPALNLSTANPCTDVDECATAPSICGPNSICSNTIGGYNCSC-----------RTGFTVTNPALNLSTTNLCTDVDECKP--APSICGPNSICSNTIGGYNCSCRTGFTATNPDLNLSTT-NPCTDVDECATAPSICGPNSICSNTIGGYNCSCRTGFTATNPALNLSTTNPCTDVDEC---KPAPSICGPNSICSNTIGGYNCTCRTGFIVTNPALNLSTANPCTDVDECKPAPSICGPNSICSNTIGGYNCSCRTGFTATNPALNLSTTNPCTDVDKCLTTPSICGPNSTCLNTKGGYNCSCLKGFTALNSSLPVNISNPCIDVDECLFTQLYCGQNTN------CTNTIGGYNC---SCWLGFTTINS---------SLSVSTKNPCILIPEIPVNMSLTLNE-----KFDITLTNPNSGKY--------IQYKNSIENSINDA-------YLKVPGYIPGSVKV 861          

HSP 3 Score: 152.525 bits (384), Expect = 5.327e-37
Identity = 132/385 (34.29%), Postives = 170/385 (44.16%), Query Frame = 3
Query: 1632 CRPGTVLAQNGIACN------DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-------CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPG--MFRSSMYSN----CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-------NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGF--EWSDYPI---KKCTDINECLAA-NPCGKKHQCVNTVGSYKCKCFQGYR-----LSIS-GDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-------CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            C+P T L  N  AC       D+DEC      C P+ IC NT   Y+C                   CR G+     S+       C+DVDEC    G + CG   IC N  G Y C     C  G  +  SS+  N    C DVDEC  G   C  N  C N +G Y C C  G+I+T+       +N C+DV+EC+L     S     + C NT G Y C C  GF    S  P+     C+D++EC  A + CG    C NT+G Y C C  G+      L++S  + C D+DEC   P  C  N IC N  G Y C C  GF A    +       C D+DEC+T+  +C   S      +C N +G Y C   SC  G+T
Sbjct:  148 CQPVTELT-NTTACPTLPPLPDVDECVLGTSACGPNSICSNTIGGYNC------------------SCRTGFIVTNSSLPVNISNPCSDVDECVL--GTSACGPNSICSNTIGGYNC----SCWTGFTVTNSSLPVNISNPCSDVDECVLGTSACGPNSICSNTIGGYNCSCRTGFIVTNSSLPVNISNPCSDVDECVL---GTSACGPNSICSNTIGGYNCSCRTGFIVTNSSLPVNISNPCSDVDECATAPSICGPNSICSNTIGGYNCSCRTGFTATNPALNLSTANPCTDVDECKPAPSICGPNSICSNTIGGYNCSCRTGFTATNPALNLSTANPCTDVDECATAPSICGPNS------ICSNTIGGYNC---SCRTGFT 495          

HSP 4 Score: 102.449 bits (254), Expect = 1.416e-21
Identity = 103/390 (26.41%), Postives = 141/390 (36.15%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKH-------SKLGICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDP----DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFK------KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI------ACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-ILTSNNTCADVNECLLFRPE 2162
            +C D++EC+ A +      IC NT+G + C C+ GF         S    C D+DEC    +IC  +  C N +G Y C  S   GF           TN C DVDEC+  P ICGP   C N  G + C                   C+ GF              C D+DEC          C    +C N  G Y+C     CR G       +       C D+D+C      C P+  C+NT   Y+                  C C  G+                     L  SL + I++P    CI   EC      + +Y               C QN +C N +G Y C C  G+  + S+ + +  N C+L  PE
Sbjct:  508 LCTDVDECKPAPSICGPNSICSNTIGGYNCSCRTGFTATNPDLNLSTTNPCTDVDECATAPSICGPNSICSNTIGGYNC--SCRTGFTATNPALNLSTTNPCTDVDECKPAPSICGPNSICSNTIGGYNC------------------TCRTGFIVTNPALNLSTANPCTDVDECKP----APSICGPNSICSNTIGGYNC----SCRTGFTATNPALNLSTTNPCTDVDKCLTTPSICGPNSTCLNTKGGYN------------------CSCLKGFTA-------------------LNSSLPVNISNP----CIDVDEC----LFTQLY---------------CGQNTNCTNTIGGYNCSCWLGFTTINSSLSVSTKNPCILI-PE 808          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbln1 (fibulin 1 [Source:NCBI gene;Acc:30240])

HSP 1 Score: 206.453 bits (524), Expect = 5.351e-56
Identity = 157/467 (33.62%), Postives = 227/467 (48.61%), Query Frame = 3
Query: 1479 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRA-ECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLS-ISGDTCEDIDECLLEPRKCLNGI-CVNVPGRYECKCPP-GFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESI-----CEPNDADCLNEKPYKISYEFIEISS--------DIKFRRTISRFNMSHM 2822
            C  G+  K + ++CEDI+EC +     +  C+  + C N  GSY C  +  C  G  L  +  +C DIDEC+     C  D  C NT  S+ C      PS Q         C+ GY Q+    C D++EC    G   C S  +CIN  GSY C + +  C  G   +   + C D+DEC   +  C  +  C+N+VGSY+C C  G+   S    C D+NEC  F P   C     +C N  GSYKC C  GF+ +    + C D+NEC  ++PC +  +C N  GSY+C C +GY+LS + G TCEDIDEC L     +    C N PG + C CP  G+  A     CQD+DEC T    CS          C N+ G ++C+N  CP  Y +       +   +S++I     C+PND  C+ +  + +S+  I + +        +I F R+++  +  HM
Sbjct:  115 CFAGYKLKPDGKNCEDINECLLG----SHHCRPGERCINTMGSYRCQREVSCGTGYELTDSN-SCKDIDECETNTHNCPKDFECQNTPGSFRC-----HPSAQ---------CQAGYIQDALGSCIDINECLSVAGP--CPSGQLCINTVGSYTCQRNSVSCGRGYHLNEEGTRCVDIDECAGSDNACAGHG-CINLVGSYRCECRSGFTFNSITRVCEDINECRHF-PGRLCAH---KCDNVLGSYKCSCTTGFKLAS-DGRNCDDLNEC-ESSPCSQ--ECANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICSYRCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTCSETES------CFNIQGGFRCLNFDCPPNYRRSSETRARV--DRSDTIRCIKSCQPNDITCVLDPVHSVSHTVISLPTFREFNKPEEIVFLRSVTPSHYPHM 543          

HSP 2 Score: 187.963 bits (476), Expect = 8.546e-50
Identity = 145/409 (35.45%), Postives = 204/409 (49.88%), Query Frame = 3
Query: 1296 CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKK---HQCVNTVGSYKCKC-FQGYRLSISGDTCEDIDECLLEPRKCLNG-ICVNVPGRYEC---KCPPGF 2492
            C  G+K  PD  +C D++EC      C PG +C+N  GS+RC+ +                C  G+    ++ SC+DIDEC  N       C +   C N PGS+ C P  +C+ G +    G +C DI+EC  +   C   ++C+NT  SY C        Q+   S G+     GY  N++   C D+DECA  G DN C   + CIN  GSY C    EC  G   +S+   C+D++EC    G+   +  C NV+GSYKC C  G+ L S+   C D+NEC      ES P     C N  GSY+C C +G++ SD     C DI+EC  A P G     ++C NT GS+ C C  +GY L+ +G +C+D+DEC+     C     C N+ G + C    CPP +
Sbjct:  115 CFAGYKLKPDGKNCEDINECLLGSHHCRPGERCINTMGSYRCQRE--------------VSCGTGYEL-TDSNSCKDIDECETNT----HNCPKDFECQNTPGSFRCHPSAQCQAGYIQDALG-SCIDINECLSVAGPCPSGQLCINTVGSYTC--------QRNSVSCGR-----GYHLNEEGTRCVDIDECA--GSDNACAG-HGCINLVGSYRC----ECRSGFTFNSITRVCEDINECRHFPGRLCAHK-CDNVLGSYKCSCTTGFKLASDGRNCDDLNEC------ESSP-CSQECANVYGSYQCYCRRGYQLSDVDGITCEDIDEC--ALPTGGHICSYRCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTCSETESCFNIQGGFRCLNFDCPPNY 473          

HSP 3 Score: 148.673 bits (374), Expect = 9.069e-37
Identity = 121/368 (32.88%), Postives = 168/368 (45.65%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCD----CQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV---------------------ASPCAPSQQFDYSVGKCMCRDGYR-QNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPP-GMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM 2087
            C DINEC   +      E C+NT+GS+RC     C  G++ +    C+DIDEC  N + C  D +C+N  GS++C  S  C  G+ +D     C+D++EC +    C  G  C+N  GS+ C+         RN+      C  G++  +E   C DIDEC  +     G       C NL GSY C    +CR G         C DI+EC+    R    + C N   SY C                      +SPC+      Y   +C CR GY+  + D I C D+DECA   G ++C   Y C N PGS+ C     CP  G   +    +CQDVDEC TG   C +   C N+ G ++C+
Sbjct:  128 CEDINECLLGSHHCRPGERCINTMGSYRCQREVSCGTGYELTDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPSAQCQAGYIQDA-LGSCIDINECLSVAGPCPSGQLCINTVGSYTCQ---------RNSVS----CGRGYHLNEEGTRCVDIDECAGSDNACAGH-----GCINLVGSYRC----ECRSGFTFNSITRVCEDINECRHFPGRLCAHK-CDNVLGSYKCSCTTGFKLASDGRNCDDLNECESSPCSQECANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICS--YRCHNTPGSFHCT----CPAKGYTLAPNGRSCQDVDECVTGTHTCSETESCFNIQGGFRCL 465          

HSP 4 Score: 145.591 bits (366), Expect = 9.778e-36
Identity = 108/303 (35.64%), Postives = 154/303 (50.83%), Query Frame = 3
Query: 1809 CMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC----MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQ-----CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF--AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
            C C  GY+   D   C D++EC    G + C     CIN  GSY C +   C  G +  +  ++C+D+DECET    CP++  C N  GS++C     C  GYI  +  +C D+NECL       CP  +  C+NT GSY CQ     C +G+  ++    +C DI+EC  ++     H C+N VGSY+C+C  G+  +     CEDI+EC   P +     C NV G Y+C C  GF  A+D +  C D++EC +S   CS+E        C N+ G Y+C    C  GY   +  +G  CE
Sbjct:  113 CACFAGYKLKPDGKNCEDINECLL--GSHHCRPGERCINTMGSYRCQREVSCGTG-YELTDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPSAQCQAGYIQDALGSCIDINECLSV--AGPCPSGQL-CINTVGSYTCQRNSVSCGRGYHLNEEG-TRCVDIDECAGSDNACAGHGCINLVGSYRCECRSGFTFNSITRVCEDINECRHFPGRLCAHKCDNVLGSYKCSCTTGFKLASDGRN-CDDLNECESSP--CSQE--------CANVYGSYQCY---CRRGYQLSDV-DGITCE 393          

HSP 5 Score: 83.5741 bits (205), Expect = 4.942e-16
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECET--ANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWK-EDPDTNDCVDVDECEAFP---EICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI 1619
            GF FN    +C DINEC       CA+K   C N +GS++C C  GFK +  G  C+D++EC + + CS  ++C N  GSY+C     C  G++  D D   C D+DEC A P    IC    +C N  GS  C    CP                G+      RSC+D+DEC          C ET+ CFN+ G + C+
Sbjct:  300 GFTFNSITRVCEDINECRHFPGRLCAHK---CDNVLGSYKCSCTTGFKLASDGRNCDDLNECES-SPCS--QECANVYGSYQCY----CRRGYQLSDVDGITCEDIDEC-ALPTGGHIC--SYRCHNTPGSFHC---TCP--------------AKGYTLAPNGRSCQDVDECVTGTHT----CSETESCFNIQGGFRCL 465          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbln1 (fibulin 1 [Source:NCBI gene;Acc:30240])

HSP 1 Score: 206.838 bits (525), Expect = 6.311e-56
Identity = 172/550 (31.27%), Postives = 262/550 (47.64%), Query Frame = 3
Query: 1479 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRA-ECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLS-ISGDTCEDIDECLLEPRKCLNGI-CVNVPGRYECKCPP-GFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESI-----CEPNDADCLNEKPYKISYEFIEISS--------DIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKM--INPPVEILLYLDVKKYHQEMFLGHSESFINLYL 3065
            C  G+  K + ++CEDI+EC +     +  C+  + C N  GSY C  +  C  G  L  +  +C DIDEC+     C  D  C NT  S+ C      PS Q         C+ GY Q+    C D++EC    G   C S  +CIN  GSY C + +  C  G   +   + C D+DEC   +  C  +  C+N+VGSY+C C  G+   S    C D+NEC  F P   C     +C N  GSYKC C  GF+ +    + C D+NEC  ++PC +  +C N  GSY+C C +GY+LS + G TCEDIDEC L     +    C N PG + C CP  G+  A     CQD+DEC T    CS          C N+ G ++C+N  CP  Y +       +   +S++I     C+PND  C+ +  + +S+  I + +        +I F R+++  +  HM       + ++ Y +     Q   + N F + K R + G I  +++++  +  P   +L L +  Y     + H  + IN+++
Sbjct:  142 CFAGYKLKPDGKNCEDINECLLG----SHHCRPGERCINTMGSYRCQREVSCGTGYELTDSN-SCKDIDECETNTHNCPKDFECQNTPGSFRC-----HPSAQ---------CQAGYIQDALGSCIDINECLSVAGP--CPSGQLCINTVGSYTCQRNSVSCGRGYHLNEEGTRCVDIDECAGSDNACAGHG-CINLVGSYRCECRSGFTFNSITRVCEDINECRHF-PGRLCAH---KCDNVLGSYKCSCTTGFKLAS-DGRNCDDLNEC-ESSPCSQ--ECANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICSYRCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTCSETES------CFNIQGGFRCLNFDCPPNYRRSSETRARV--DRSDTIRCIKSCQPNDITCVLDPVHSVSHTVISLPTFREFNKPEEIVFLRSVTPSHYPHMD------SPELIYDI-----QEGNIHNSFDIIK-RVEHGMIVGVVRQVKPLVGPASTVLKLAM-NYVMNGVVSH-RNIINVHV 639          

HSP 2 Score: 188.348 bits (477), Expect = 1.069e-49
Identity = 145/409 (35.45%), Postives = 204/409 (49.88%), Query Frame = 3
Query: 1296 CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKK---HQCVNTVGSYKCKC-FQGYRLSISGDTCEDIDECLLEPRKCLNG-ICVNVPGRYEC---KCPPGF 2492
            C  G+K  PD  +C D++EC      C PG +C+N  GS+RC+ +                C  G+    ++ SC+DIDEC  N       C +   C N PGS+ C P  +C+ G +    G +C DI+EC  +   C   ++C+NT  SY C        Q+   S G+     GY  N++   C D+DECA  G DN C   + CIN  GSY C    EC  G   +S+   C+D++EC    G+   +  C NV+GSYKC C  G+ L S+   C D+NEC      ES P     C N  GSY+C C +G++ SD     C DI+EC  A P G     ++C NT GS+ C C  +GY L+ +G +C+D+DEC+     C     C N+ G + C    CPP +
Sbjct:  142 CFAGYKLKPDGKNCEDINECLLGSHHCRPGERCINTMGSYRCQRE--------------VSCGTGYEL-TDSNSCKDIDECETNT----HNCPKDFECQNTPGSFRCHPSAQCQAGYIQDALG-SCIDINECLSVAGPCPSGQLCINTVGSYTC--------QRNSVSCGR-----GYHLNEEGTRCVDIDECA--GSDNACAG-HGCINLVGSYRC----ECRSGFTFNSITRVCEDINECRHFPGRLCAHK-CDNVLGSYKCSCTTGFKLASDGRNCDDLNEC------ESSP-CSQECANVYGSYQCYCRRGYQLSDVDGITCEDIDEC--ALPTGGHICSYRCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTCSETESCFNIQGGFRCLNFDCPPNY 500          

HSP 3 Score: 149.058 bits (375), Expect = 9.886e-37
Identity = 121/368 (32.88%), Postives = 168/368 (45.65%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCD----CQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV---------------------ASPCAPSQQFDYSVGKCMCRDGYR-QNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPP-GMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM 2087
            C DINEC   +      E C+NT+GS+RC     C  G++ +    C+DIDEC  N + C  D +C+N  GS++C  S  C  G+ +D     C+D++EC +    C  G  C+N  GS+ C+         RN+      C  G++  +E   C DIDEC  +     G       C NL GSY C    +CR G         C DI+EC+    R    + C N   SY C                      +SPC+      Y   +C CR GY+  + D I C D+DECA   G ++C   Y C N PGS+ C     CP  G   +    +CQDVDEC TG   C +   C N+ G ++C+
Sbjct:  155 CEDINECLLGSHHCRPGERCINTMGSYRCQREVSCGTGYELTDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPSAQCQAGYIQDA-LGSCIDINECLSVAGPCPSGQLCINTVGSYTCQ---------RNSVS----CGRGYHLNEEGTRCVDIDECAGSDNACAGH-----GCINLVGSYRC----ECRSGFTFNSITRVCEDINECRHFPGRLCAHK-CDNVLGSYKCSCTTGFKLASDGRNCDDLNECESSPCSQECANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICS--YRCHNTPGSFHCT----CPAKGYTLAPNGRSCQDVDECVTGTHTCSETESCFNIQGGFRCL 492          

HSP 4 Score: 145.976 bits (367), Expect = 8.879e-36
Identity = 108/303 (35.64%), Postives = 154/303 (50.83%), Query Frame = 3
Query: 1809 CMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC----MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQ-----CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF--AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
            C C  GY+   D   C D++EC    G + C     CIN  GSY C +   C  G +  +  ++C+D+DECET    CP++  C N  GS++C     C  GYI  +  +C D+NECL       CP  +  C+NT GSY CQ     C +G+  ++    +C DI+EC  ++     H C+N VGSY+C+C  G+  +     CEDI+EC   P +     C NV G Y+C C  GF  A+D +  C D++EC +S   CS+E        C N+ G Y+C    C  GY   +  +G  CE
Sbjct:  140 CACFAGYKLKPDGKNCEDINECLL--GSHHCRPGERCINTMGSYRCQREVSCGTG-YELTDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPSAQCQAGYIQDALGSCIDINECLSV--AGPCPSGQL-CINTVGSYTCQRNSVSCGRGYHLNEEG-TRCVDIDECAGSDNACAGHGCINLVGSYRCECRSGFTFNSITRVCEDINECRHFPGRLCAHKCDNVLGSYKCSCTTGFKLASDGRN-CDDLNECESSP--CSQE--------CANVYGSYQCY---CRRGYQLSDV-DGITCE 420          

HSP 5 Score: 83.5741 bits (205), Expect = 5.036e-16
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECET--ANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWK-EDPDTNDCVDVDECEAFP---EICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI 1619
            GF FN    +C DINEC       CA+K   C N +GS++C C  GFK +  G  C+D++EC + + CS  ++C N  GSY+C     C  G++  D D   C D+DEC A P    IC    +C N  GS  C    CP                G+      RSC+D+DEC          C ET+ CFN+ G + C+
Sbjct:  327 GFTFNSITRVCEDINECRHFPGRLCAHK---CDNVLGSYKCSCTTGFKLASDGRNCDDLNECES-SPCS--QECANVYGSYQCY----CRRGYQLSDVDGITCEDIDEC-ALPTGGHIC--SYRCHNTPGSFHC---TCP--------------AKGYTLAPNGRSCQDVDECVTGTHT----CSETESCFNIQGGFRCL 492          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbln1 (fibulin 1 [Source:NCBI gene;Acc:30240])

HSP 1 Score: 206.453 bits (524), Expect = 1.203e-55
Identity = 172/550 (31.27%), Postives = 262/550 (47.64%), Query Frame = 3
Query: 1479 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRA-ECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLS-ISGDTCEDIDECLLEPRKCLNGI-CVNVPGRYECKCPP-GFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESI-----CEPNDADCLNEKPYKISYEFIEISS--------DIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKM--INPPVEILLYLDVKKYHQEMFLGHSESFINLYL 3065
            C  G+  K + ++CEDI+EC +     +  C+  + C N  GSY C  +  C  G  L  +  +C DIDEC+     C  D  C NT  S+ C      PS Q         C+ GY Q+    C D++EC    G   C S  +CIN  GSY C + +  C  G   +   + C D+DEC   +  C  +  C+N+VGSY+C C  G+   S    C D+NEC  F P   C     +C N  GSYKC C  GF+ +    + C D+NEC  ++PC +  +C N  GSY+C C +GY+LS + G TCEDIDEC L     +    C N PG + C CP  G+  A     CQD+DEC T    CS          C N+ G ++C+N  CP  Y +       +   +S++I     C+PND  C+ +  + +S+  I + +        +I F R+++  +  HM       + ++ Y +     Q   + N F + K R + G I  +++++  +  P   +L L +  Y     + H  + IN+++
Sbjct:  161 CFAGYKLKPDGKNCEDINECLLG----SHHCRPGERCINTMGSYRCQREVSCGTGYELTDSN-SCKDIDECETNTHNCPKDFECQNTPGSFRC-----HPSAQ---------CQAGYIQDALGSCIDINECLSVAGP--CPSGQLCINTVGSYTCQRNSVSCGRGYHLNEEGTRCVDIDECAGSDNACAGHG-CINLVGSYRCECRSGFTFNSITRVCEDINECRHF-PGRLCAH---KCDNVLGSYKCSCTTGFKLAS-DGRNCDDLNEC-ESSPCSQ--ECANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICSYRCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTCSETES------CFNIQGGFRCLNFDCPPNYRRSSETRARV--DRSDTIRCIKSCQPNDITCVLDPVHSVSHTVISLPTFREFNKPEEIVFLRSVTPSHYPHMD------SPELIYDI-----QEGNIHNSFDIIK-RVEHGMIVGVVRQVKPLVGPASTVLKLAM-NYVMNGVVSH-RNIINVHV 658          

HSP 2 Score: 187.963 bits (476), Expect = 1.803e-49
Identity = 145/409 (35.45%), Postives = 204/409 (49.88%), Query Frame = 3
Query: 1296 CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKK---HQCVNTVGSYKCKC-FQGYRLSISGDTCEDIDECLLEPRKCLNG-ICVNVPGRYEC---KCPPGF 2492
            C  G+K  PD  +C D++EC      C PG +C+N  GS+RC+ +                C  G+    ++ SC+DIDEC  N       C +   C N PGS+ C P  +C+ G +    G +C DI+EC  +   C   ++C+NT  SY C        Q+   S G+     GY  N++   C D+DECA  G DN C   + CIN  GSY C    EC  G   +S+   C+D++EC    G+   +  C NV+GSYKC C  G+ L S+   C D+NEC      ES P     C N  GSY+C C +G++ SD     C DI+EC  A P G     ++C NT GS+ C C  +GY L+ +G +C+D+DEC+     C     C N+ G + C    CPP +
Sbjct:  161 CFAGYKLKPDGKNCEDINECLLGSHHCRPGERCINTMGSYRCQRE--------------VSCGTGYEL-TDSNSCKDIDECETNT----HNCPKDFECQNTPGSFRCHPSAQCQAGYIQDALG-SCIDINECLSVAGPCPSGQLCINTVGSYTC--------QRNSVSCGR-----GYHLNEEGTRCVDIDECA--GSDNACAG-HGCINLVGSYRC----ECRSGFTFNSITRVCEDINECRHFPGRLCAH-KCDNVLGSYKCSCTTGFKLASDGRNCDDLNEC------ESSP-CSQECANVYGSYQCYCRRGYQLSDVDGITCEDIDEC--ALPTGGHICSYRCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTCSETESCFNIQGGFRCLNFDCPPNY 519          

HSP 3 Score: 148.673 bits (374), Expect = 1.358e-36
Identity = 121/368 (32.88%), Postives = 168/368 (45.65%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCD----CQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV---------------------ASPCAPSQQFDYSVGKCMCRDGYR-QNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPP-GMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM 2087
            C DINEC   +      E C+NT+GS+RC     C  G++ +    C+DIDEC  N + C  D +C+N  GS++C  S  C  G+ +D     C+D++EC +    C  G  C+N  GS+ C+         RN+      C  G++  +E   C DIDEC  +     G       C NL GSY C    +CR G         C DI+EC+    R    + C N   SY C                      +SPC+      Y   +C CR GY+  + D I C D+DECA   G ++C   Y C N PGS+ C     CP  G   +    +CQDVDEC TG   C +   C N+ G ++C+
Sbjct:  174 CEDINECLLGSHHCRPGERCINTMGSYRCQREVSCGTGYELTDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPSAQCQAGYIQDA-LGSCIDINECLSVAGPCPSGQLCINTVGSYTCQ---------RNSVS----CGRGYHLNEEGTRCVDIDECAGSDNACAGH-----GCINLVGSYRC----ECRSGFTFNSITRVCEDINECRHFPGRLCAHK-CDNVLGSYKCSCTTGFKLASDGRNCDDLNECESSPCSQECANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICS--YRCHNTPGSFHCT----CPAKGYTLAPNGRSCQDVDECVTGTHTCSETESCFNIQGGFRCL 511          

HSP 4 Score: 145.206 bits (365), Expect = 1.640e-35
Identity = 108/303 (35.64%), Postives = 154/303 (50.83%), Query Frame = 3
Query: 1809 CMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC----MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQ-----CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF--AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
            C C  GY+   D   C D++EC    G + C     CIN  GSY C +   C  G +  +  ++C+D+DECET    CP++  C N  GS++C     C  GYI  +  +C D+NECL       CP  +  C+NT GSY CQ     C +G+  ++    +C DI+EC  ++     H C+N VGSY+C+C  G+  +     CEDI+EC   P +     C NV G Y+C C  GF  A+D +  C D++EC +S   CS+E        C N+ G Y+C    C  GY   +  +G  CE
Sbjct:  159 CACFAGYKLKPDGKNCEDINECLL--GSHHCRPGERCINTMGSYRCQREVSCGTG-YELTDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPSAQCQAGYIQDALGSCIDINECLSV--AGPCPSGQL-CINTVGSYTCQRNSVSCGRGYHLNEEG-TRCVDIDECAGSDNACAGHGCINLVGSYRCECRSGFTFNSITRVCEDINECRHFPGRLCAHKCDNVLGSYKCSCTTGFKLASDGRN-CDDLNECESSP--CSQE--------CANVYGSYQCY---CRRGYQLSDV-DGITCE 439          

HSP 5 Score: 83.5741 bits (205), Expect = 5.344e-16
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECET--ANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWK-EDPDTNDCVDVDECEAFP---EICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI 1619
            GF FN    +C DINEC       CA+K   C N +GS++C C  GFK +  G  C+D++EC + + CS  ++C N  GSY+C     C  G++  D D   C D+DEC A P    IC    +C N  GS  C    CP                G+      RSC+D+DEC          C ET+ CFN+ G + C+
Sbjct:  346 GFTFNSITRVCEDINECRHFPGRLCAHK---CDNVLGSYKCSCTTGFKLASDGRNCDDLNECES-SPCS--QECANVYGSYQCY----CRRGYQLSDVDGITCEDIDEC-ALPTGGHIC--SYRCHNTPGSFHC---TCP--------------AKGYTLAPNGRSCQDVDECVTGTHT----CSETESCFNIQGGFRCL 511          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbn2a (fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4])

HSP 1 Score: 211.846 bits (538), Expect = 2.469e-55
Identity = 206/629 (32.75%), Postives = 285/629 (45.31%), Query Frame = 3
Query: 1065 EICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHS-KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC----------------EDDECPINMK-------RNNKG--ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTD--INEC-LAANPCGK--------------KHQCVNTVG------------------SYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEF 2759
            + C D+NECE +A  C N    CVN  G++ C C  G++ +     C DIDEC   N    D  C N+ GSY C     CG  +   PD   C DVDECE  P+IC  G +C N+ G + C                + +EC +N          N KG  IC  C+ G+  KK +  C DIDEC ++       C     C N+PGS+ C     C  G +   NG+ C+D+DEC +   +C PD  CVNT  S+                  +C C +GY+ +  + C+D+DECA++   ++C +   C+N PGSY C    EC  G         CQD+DEC T +  C   + C N+ G+++C+CD GY L  S   C DV+ECL     +    +   CVNT GSY+C CP  FE +   I  C D  +  C L A P G+              +  C  ++G                  +  C   +G+R +      EDIDEC   P  C  G CVN  G ++C CP G+  +    IC+DIDEC  + G+C   +       C N LG Y CV   CP  Y +   GN  +   KS      N   C NE  + I++  
Sbjct: 1049 DACEDVNECELSATLCRNGE--CVNVAGTYHCSCSTGYQSTPDRKGCTDIDECTIENG-GCDLLCTNSEGSYTC----SCGQRYALMPDLRSCTDVDECEEEPDIC-DGGQCTNVPGEYHCLCYDGFTSSMTTKSCIDVNECELNSNICMFGECENTKGSFIC-HCEVGYSVKKGSSGCTDIDECQIDAH----NCDRNANCVNIPGSFSCT----CMEGWI--GNGVKCDDVDECIRGTHQCSPDGECVNTPGSF------------------RCACTEGYKGDGFT-CSDIDECADS--THMCENGQ-CLNIPGSYQC----ECEIGFISDPDSRTCQDIDEC-TFQVICVFGL-CENLPGAFRCVCDEGYELNRSGINCTDVDECL-----DPINCVNGHCVNTPGSYECNCPTDFELNPTGIG-CVDPRVGFCFLEAVPRGRGGLACSVEVGVGVSRSSCCCSLGRAWGNPCEGCPPVNTSDYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCVNTFGSFQCDCPGGYYLNADSRICEDIDECVVNPGICGPGT-------CYNTLGNYTCV---CPQEYMQVNGGNNCMDMRKSLCFRNYNGTACENELAFNITHRI 1614          

HSP 2 Score: 197.593 bits (501), Expect = 8.418e-51
Identity = 175/520 (33.65%), Postives = 244/520 (46.92%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETA-NACANKWEICVNTVGSFRCDCQKGFKHSKLGI--CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------ASPCAPSQQFDYSVGKCM--------------CRDGYR-QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI 2513
            GF  +     C DI+EC+ + + C +    CVNT GSF CDC  G++   + +  C DIDEC  N  +C     CKN  GSY+C+    C  G +   D + C DV+ECE    +C  G +CVN+ G++ C                   C  G+    + + C DIDECT+     NG C    +C N  GSY C     C     L  +  +C D+DEC++    C+  + C N    YHC+             C    + + +   CM              C  GY  +   S CTD+DEC  +  +  C     C+N PGS++C     C  G   + +   C DVDEC  G  +C  +  CVN  GS++C C  GY      TC+D++EC        C +   +C+N  GSY+C+C  GF  SD   + C DI+EC     C     C N  G+++C C +GY L+ SG  C D+DECL +P  C+NG CVN PG YEC CP  F  +   I
Sbjct:  956 GFALDAEERNCTDIDECKISPDLCGHG--ACVNTPGSFECDCLPGYESGFMMMKNCMDIDECERNPGLCRG-GSCKNTEGSYQCV----CPPGHQLSTDGDACEDVNECELSATLCRNG-ECVNVAGTYHCS------------------CSTGYQSTPDRKGCTDIDECTIE----NGGCDL--LCTNSEGSYTC----SCGQRYALMPDLRSCTDVDECEEEPDICDGGQ-CTNVPGEYHCLCYDGFTSSMTTKSCIDVNECELNSNICMFGECENTKGSFICHCEVGYSVKKGSSGCTDIDECQIDAHN--CDRNANCVNIPGSFSCT----CMEGWIGNGV--KCDDVDECIRGTHQCSPDGECVNTPGSFRCACTEGY-KGDGFTCSDIDECA--DSTHMCEN--GQCLNIPGSYQCECEIGF-ISDPDSRTCQDIDECTFQVIC-VFGLCENLPGAFRCVCDEGYELNRSGINCTDVDECL-DPINCVNGHCVNTPGSYECNCPTDFELNPTGI 1422          

HSP 3 Score: 195.282 bits (495), Expect = 4.242e-50
Identity = 179/530 (33.77%), Postives = 239/530 (45.09%), Query Frame = 3
Query: 1200 EDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECA-ENGGDNL------------CGSLYI-------------------------CINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-ILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL-AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            +DI+EC           C+N +GS++C     C  G+  D +  +C D+DEC+  P++CG G  CVN  GS  C+   C    +            GF   K   +C DIDEC  N G   G       C N  GSY C+    C PG  L+ +G AC D++EC+     C   E CVN   +YHC                   C  GY+   D   CTD+DEC  ENGG +L            CG  Y                          C N PG Y C+    C  G   S    +C DV+ECE     C     C N  GS+ C C+ GY +   ++ C D++EC +     +C D  A CVN  GS+ C C +G  W    +K C D++EC+   + C    +CVNT GS++C C +GY+    G TC DIDEC      C NG C+N+PG Y+C+C  GF +D     CQDIDEC T + +C          LC NL G ++CV   C  GY    +G
Sbjct:  925 KDINECKVFPSICAHGTCRNTIGSFRC----RCNGGFALDAEERNCTDIDECKISPDLCGHG-ACVNTPGSFECD---CLPGYE-----------SGFMMMK---NCMDIDECERNPGLCRG-----GSCKNTEGSYQCV----CPPGHQLSTDGDACEDVNECELSATLCRNGE-CVNVAGTYHC------------------SCSTGYQSTPDRKGCTDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSCTDVDECEEEPDICDGGQCTNVPGEYHCL----CYDGFTSSMTTKSCIDVNECELNSNIC-MFGECENTKGSFICHCEVGYSVKKGSSGCTDIDECQI--DAHNC-DRNANCVNIPGSFSCTCMEG--WIGNGVK-CDDVDECIRGTHQCSPDGECVNTPGSFRCACTEGYKGD--GFTCSDIDECADSTHMCENGQCLNIPGSYQCECEIGFISDPDSRTCQDIDEC-TFQVICVF-------GLCENLPGAFRCV---CDEGYELNRSG 1380          

HSP 4 Score: 192.2 bits (487), Expect = 3.468e-49
Identity = 184/571 (32.22%), Postives = 256/571 (44.83%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQD--VDEC----ETGEGKCPQNMH------CVNVV----GSYKC-MCDR--------------GYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA-DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKK 2654
            GF +N  L IC DI+EC ++     +   C+N+ GS+RC+C +GFK S +G C D +EC+ N N+CS   KC +  G Y C     C  G+K  P+   C+D+DEC   P  C  G  C N  GS+ C                   C  GF      + C D+DEC+   G Y+  C+    C N  GS+ C+    C  G  L  +G  C D++EC  +   C P   C N   S+                  +C+C  GY   QD  C DV+EC E+    L GS   C N+PGS+ C+    C PG   S     C D  V  C    E G+   PQ  +      C + +      Y C +C +              G I   ++T  DVNEC+    E         C+NT GS++C+CP G+   +Y    C D++EC   NPCG    C N +G ++C C +G+        CEDI+EC   P  C    C+N  G YEC CP G+   +   +CQD+DEC      C        G  C NL+G + C+   CP G  ++
Sbjct: 1692 GFSYNDVLLICEDIDECSSSEILCQRNADCINSPGSYRCECSEGFKLSPIGACIDRNECLENPNLCS-HGKCVDMPGGYICT----CNTGFKATPNRKMCMDIDECVRQP--CKNG-TCKNTVGSYNC------------------LCNAGFELTLNNQ-CTDVDECS---GPYSQLCRNGQ-CMNSVGSFQCL----CDEGYELTLDGKNCIDVNECLILPGTCAPG-TCQNLDGSF------------------RCLCPKGYTV-QDDHCVDVNECEEDPNICLFGS---CFNNPGSFECV----CKPGFVLSDNGRRCYDTRVSFCFTRFENGKCSIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEHEAGFRDLCPFGVGIIPGIDDTSVDVNECV----ENPGICHNGHCINTDGSFRCECPMGYTL-NYTGVHCVDVDECAVGNPCGNG-TCTNVIGGFECNCEEGFEPGPM-MACEDINECGQNPLLCAF-RCINTFGGYECSCPSGYTLREDGRMCQDLDECVEGLHDCDTR-----GMTCKNLIGTFMCI---CPPGMVRR 2184          

HSP 5 Score: 177.563 bits (449), Expect = 1.310e-44
Identity = 195/583 (33.45%), Postives = 261/583 (44.77%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICED---------IDEC---MNVNICSDDKKCKNNVGSYKCIRSIPC--------GFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKG-ICSRCK-DGFYFKKETRSCED-------IDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN------DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS-SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNG 2669
            G+ + Q  E C D+NECE++  C N   +C N  GSF C+C  G K    G IC D         I E    +N+N  +   +C   +G+       PC        GF     P    C DV+ECE FP +C P  +CVN RGS +C+   C   +  ++ G IC   + +  Y   +   C         +D C   VG   G  KE + C   PG+ +   +  C  G   A  G          DI+ECK     C     C NT  S+                  +C C  G+  + ++  CTD+DEC  +   +LCG    C+N PGS+ C    +C PG      M  NC D+DECE   G C +   C N  GSY+C+C  G+ L T  + C DVNEC L      C + E  CVN AG+Y C C  G++ S    K CTDI+EC   N  G    C N+ GSY C C Q Y L     +C D+DEC  EP  C  G C NVPG Y C C  GF +    + C D++EC  +  +C           C N  G + C    C VGY+ K+  +G
Sbjct:  693 GYSYRQDSETCEDVNECESS-PCING--LCKNNAGSFACECSPGSKVDPTGLICIDSLKGTCWLTIQEGRCEVNINGGTLRSECCATLGAAWGSPCEPCEIDPVCQRGFAR---PRGTICEDVNECEVFPGVC-PNGRCVNTRGSFKCQ---CSEGLTLDSTGRICVDIRLEHCYLTYDEDECVQPVSGRFRMDACCCTVGAAWG--KECEACPE-PGTRE--YEALCPRGPGFANRGDVLTGRPVYKDINECKVFPSICA-HGTCRNTIGSF------------------RCRCNGGFALDAEERNCTDIDECKIS--PDLCGH-GACVNTPGSFEC----DCLPGYESGFMMMKNCMDIDECERNPGLC-RGGSCKNTEGSYQCVCPPGHQLSTDGDACEDVNECEL--SATLCRNGE--CVNVAGTYHCSCSTGYQ-STPDRKGCTDIDECTIENG-GCDLLCTNSEGSYTCSCGQRYALMPDLRSCTDVDECEEEPDICDGGQCTNVPGEYHCLCYDGFTSSMTTKSCIDVNECELNSNICMFGE-------CENTKGSFIC---HCEVGYSVKKGSSG 1217          

HSP 6 Score: 177.563 bits (449), Expect = 1.332e-44
Identity = 176/582 (30.24%), Postives = 263/582 (45.19%), Query Frame = 3
Query: 1077 DINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC-----VASPCAPSQQFDYSVGKC-------MCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKH----QCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNE-KPYKISYE 2756
            D+NEC E    C N    C+NT GSFRC+C  G+  +  G+ C D+DEC   N C +   C N +G ++C     C  G++  P    C D++EC   P +C    +C+N  G + C                   C  G+  +++ R C+D+DEC   +   + R      C NL G++ CI    C PG V   +   C D +EC+     CE +  CVNT  SY C            +Q  DY  G C       MC+     +         +C  +GG        +C   PG+     +  CP G       ++  D+DEC+     C +N  C+N +GSY+C C+ GY  + +   C D++EC +     S       C NT GSY C CP+G+   +   + C D++EC       K+H     CVNT+G + CKC  G+    +   C D +EC  EP  C   G+C N PG + C+C  GF+ D   + C+D++EC         +S+ +    C N+LG Y+C   +CP GYT+    N  + E +  +      A C N    +K +YE
Sbjct: 2025 DVNECVENPGICHNGH--CINTDGSFRCECPMGYTLNYTGVHCVDVDECAVGNPCGN-GTCTNVIGGFEC----NCEEGFEPGP-MMACEDINECGQNPLLCA--FRCINTFGGYECS------------------CPSGYTLREDGRMCQDLDECVEGLHDCDTR---GMTCKNLIGTFMCI----CPPGMVRRMDDELCQDENECRTKPGICE-NGRCVNTIGSYMCECGEGFQPDPTHTQCLDYRQGFCFTEVLQTMCQ---MSSSSRTAITKSQCCCDGGHGWGNQCELC-PLPGTAK--YKKLCPHG---HGYATDGTDIDECKVIPDVC-KNGRCINTMGSYRCHCNSGYTASIAGTACVDLDECAM-----SPKPCNFICKNTEGSYACSCPRGYILQE-DSRSCKDLDECQV-----KRHNCQFMCVNTIGGFTCKCPPGFTQHHT--ACIDHNECAAEPSLCGAKGLCQNSPGSFSCECQRGFSLDTSGLHCEDVNEC---------DSNHRCQFGCENMLGGYRC---NCPQGYTQHYQWNQCVDENECSTPGTCGSASCYNTLGSFKCAYE 2535          

HSP 7 Score: 174.481 bits (441), Expect = 1.398e-43
Identity = 182/629 (28.93%), Postives = 266/629 (42.29%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CED--IDEC-----------------MNVNI------CSDDKKCKN--------NVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFR------CEPD-------EICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICT----DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLL------------------------FRP---EESCPDLE---------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAA-NPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            G+  N+    C D++EC     C N    CVNT GS+ C+C   F+ +  GI C D  +  C                 + V +      CS  +   N        N   Y  +   P G G++ +P T    D+DEC+  P +C  G  CVN  GS +C+                  C  G+Y   ++R CEDIDEC +N G           C+N  G+Y C+    C    +    G  C D+   K + FR      CE +        IC   Y+       PC    +      + +C +     +  I T    D+DEC E  G  +C S  +CIN  GS+    R ECP G   + +   C+D+DEC + E  C +N  C+N  GSY+C C  G+ L+    C D NECL                         F+     + C D++           C NT GSY C C  GFE +     +CTD++EC    +   +  QC+N+VGS++C C +GY L++ G  C D++ECL+ P  C  G C N+ G + C CP G+   + + C D++EC     +C   S       C N  G ++CV   C  G+   + G
Sbjct: 1373 GYELNRSGINCTDVDECLDPINCVNGH--CVNTPGSYECNCPTDFELNPTGIGCVDPRVGFCFLEAVPRGRGGLACSVEVGVGVSRSSCCCSLGRAWGNPCEGCPPVNTSDYNTL--CPGGEGFRPNPITIILEDIDECQELPGLC-QGGNCVNTFGSFQCD------------------CPGGYYLNADSRICEDIDECVVNPGICG-----PGTCYNTLGNYTCV----CPQEYMQVNGGNNCMDMR--KSLCFRNYNGTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETGKPVDIDECNEIPG--ICAS-GVCINQIGSF----RCECPRGFSYNDVLLICEDIDECSSSEILCQRNADCINSPGSYRCECSEGFKLSPIGACIDRNECLENPNLCSHGKCVDMPGGYICTCNTGFKATPNRKMCMDIDECVRQPCKNGTCKNTVGSYNCLCNAGFELTLN--NQCTDVDECSGPYSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNCIDVNECLILPGTCAPGTCQNLDGSFRCLCPKGYTV-QDDHCVDVNECEEDPNICLFGS-------CFNNPGSFECV---CKPGFVLSDNG 1947          

HSP 8 Score: 173.326 bits (438), Expect = 3.361e-43
Identity = 185/594 (31.14%), Postives = 251/594 (42.26%), Query Frame = 3
Query: 1071 CGDINECET-ANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICS---DDKKCK-----NNVGSYKCIRSIP----------------------CGFGWKEDPDTNDC-VDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYI-CINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSY------KCQCPKGFEWSDY----PI-------KKC----------TDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            C D+NECE   N C   +  C N  GSF C C+ GF  S  G  C D      V+ C    ++ KC      N   +  C  ++P                      C FG    P  +D  VDV+EC   P IC  G  C+N  GS RCE   CP+    N  G+                C D+DEC +     NG C       N+ G ++C  ++   PG ++A     C DI+EC Q    C     C+NT+  Y                  +C C  GY   +D  +C D+DEC E  G + C +  + C N  G++ CI    CPPGM R      CQD +EC T  G C +N  CVN +GSY C C  G+     +T C D  +   F        L+  C  ++ S       +C C  G  W +     P+       K C          TDI+EC       K  +C+NT+GSY+C C  GY  SI+G  C D+DEC + P+ C N IC N  G Y C CP G+   +    C+D+DEC      C          +C+N +G + C    CP G+T+  T
Sbjct: 1908 CVDVNECEEDPNICL--FGSCFNNPGSFECVCKPGFVLSDNGRRCYDT----RVSFCFTRFENGKCSIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEHEAGFRDLCPFGVGIIPGIDDTSVDVNECVENPGICHNG-HCINTDGSFRCE---CPMGYTLNYTGV---------------HCVDVDECAVGNPCGNGTCT------NVIGGFECNCEEGFEPGPMMA-----CEDINECGQNPLLCAFR--CINTFGGY------------------ECSCPSGYTLREDGRMCQDLDECVE--GLHDCDTRGMTCKNLIGTFMCI----CPPGMVRRMDDELCQDENECRTKPGIC-ENGRCVNTIGSYMCECGEGFQPDPTHTQCLDYRQGFCFTEV-----LQTMCQMSSSSRTAITKSQCCCDGGHGWGNQCELCPLPGTAKYKKLCPHGHGYATDGTDIDECKVIPDVCKNGRCINTMGSYRCHCNSGYTASIAGTACVDLDECAMSPKPC-NFICKNTEGSYACSCPRGYILQEDSRSCKDLDECQVKRHNCQ--------FMCVNTIGGFTC---KCPPGFTQHHT 2421          

HSP 9 Score: 162.54 bits (410), Expect = 6.351e-40
Identity = 176/546 (32.23%), Postives = 246/546 (45.05%), Query Frame = 3
Query: 1077 DINECET-ANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKG-ICSRCKDG--FYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQN-----GIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECP-PGMF-------RSSMYSN----------CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDL--EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA--DRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            DINEC    + C N    C N  G +RC C  G++  + G    +DEC    +  D+  C+N  GSY C  + P G+ +++D +T  C DV+ECE+ P I G    C N  GS  CE   C    K +  G IC     G  +   +E R       C +N+   NG    ++ C  L  ++   P + C    V  +      G  C D++EC+     C P+  CVNT  S+ C    C+     D S G+ +C D  R     +  D DEC +         +  C    G+    +   CP PG         R   ++N           +D++EC+     C     C N +GS++C C+ G+ L +    C D++EC +       PDL     CVNT GS++C C  G+E     +K C DI+EC       +   C NT GSY+C C  G++LS  GD CED++EC L    C NG CVNV G Y C C  G+ +  DRK  C DIDEC+   G C          LC N  G Y C
Sbjct:  623 DINECAMDPDICPNG--ACENLRGGYRCICNIGYETDQSGR-SYVDECFVNRLLCDNGLCRNVPGSYTC--TCPKGYSYRQDSET--CEDVNECESSPCING---LCKNNAGSFACE---CSPGSKVDPTGLICIDSLKGTCWLTIQEGR-------CEVNI---NGGTLRSECCATLGAAWG-SPCEPCEIDPVCQRGFARPRGTICEDVNECEVFPGVC-PNGRCVNTRGSFKC---QCSEGLTLD-STGR-ICVD-IRLEHCYLTYDEDECVQPVSGRF--RMDACCCTVGAAWGKECEACPEPGTREYEALCPRGPGFANRGDVLTGRPVYKDINECKVFPSICAHGT-CRNTIGSFRCRCNGGFALDAEERNCTDIDECKIS------PDLCGHGACVNTPGSFECDCLPGYESGFMMMKNCMDIDECERNPGLCRGGSCKNTEGSYQCVCPPGHQLSTDGDACEDVNECELSATLCRNGECVNVAGTYHCSCSTGYQSTPDRKG-CTDIDECTIENGGCD--------LLCTNSEGSYTC 1119          

HSP 10 Score: 152.91 bits (385), Expect = 5.751e-37
Identity = 168/562 (29.89%), Postives = 229/562 (40.75%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDEC-EAFPEICGPGMKCVNIRGSHRC----------EDDECPI-NMKRNNKGICS-------------RCKDGFYFKKETRSCEDIDE----------------------------CTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC-------------LLEPRKCL----------NGICVNVPGRYECKCPPGF 2492
            G+  N     C D++EC   N C N    C N +G F C+C++GF+   +  CEDI+EC  N  +C+   +C N  G Y+C  S P G+  +ED     C D+DEC E   +    GM C N+ G+  C          +D+ C   N  R   GIC               C +GF        C D  +                            C    GW N    + ++C  LPG+     KK C  G   A +G    DIDECK +   C+ +  C+NT  SY                  +C C  GY  +   + C D+DECA +     C   +IC N  GSYAC     CP G        +C+D+DEC+     C     CVN +G + C C  G+    +  C D NEC     E S    +  C N+ GS+ C+C +GF   D     C D+NEC + + C  +  C N +G Y+C C QGY      + C D +EC              L   KC           N  C N  G Y C CPPG+
Sbjct: 2055 GYTLNYTGVHCVDVDECAVGNPCGNG--TCTNVIGGFECNCEEGFEPGPMMACEDINECGQNPLLCA--FRCINTFGGYEC--SCPSGYTLREDGRM--CQDLDECVEGLHDCDTRGMTCKNLIGTFMCICPPGMVRRMDDELCQDENECRTKPGICENGRCVNTIGSYMCECGEGFQPDPTHTQCLDYRQGFCFTEVLQTMCQMSSSSRTAITKSQCCCDGGHGWGN----QCELC-PLPGTAK--YKKLCPHGHGYATDGT---DIDECKVIPDVCK-NGRCINTMGSY------------------RCHCNSGYTASIAGTACVDLDECAMS--PKPCN--FICKNTEGSYAC----SCPRGYILQEDSRSCKDLDECQVKRHNC--QFMCVNTIGGFTCKCPPGFT-QHHTACIDHNECAA---EPSLCGAKGLCQNSPGSFSCECQRGFSL-DTSGLHCEDVNECDSNHRC--QFGCENMLGGYRCNCPQGYTQHYQWNQCVDENECSTPGTCGSASCYNTLGSFKCAYECTSFKNPCNYGCSNTQGGYLCGCPPGY 2562          

HSP 11 Score: 147.902 bits (372), Expect = 2.145e-35
Identity = 180/605 (29.75%), Postives = 247/605 (40.83%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECM-----NVNICSDDKK---------CKNNVGSY------KCIRSIPCGF---------GWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQD-SICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCED--IDECL--LEPRKC----------LNGICVNVPGR---YECK-CPPGFAADRKEICQ--------------DIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            G+  N    IC DI+EC   N        C NT+G++ C C + +     G  C D+ + +     N   C ++           C  N+G         C R    GF         G++ D +T   VD+DEC   P IC  G+ C+N  GS RCE                  C  GF +      CEDIDEC+ +       C+    C N PGSY C    +C  G  L+  G AC D +EC +    C   + CV+    Y                   C C  G++   +  +C D+DEC      N       C N  GSY C+  A      F  ++ + C DVDEC     +  +N  C+N VGS++C+CD GY LT +   C DVNECL+  P    P     C N  GS++C CPKG+   D     C D+NEC           C N  GS++C C  G+ LS +G  C D  +  C    E  KC              C  +P     Y C+ CP    A  +++C               D++EC  + G+C       NG  CIN  G ++C    CP+GYT   TG
Sbjct: 1533 GYYLNADSRICEDIDEC-VVNPGICGPGTCYNTLGNYTCVCPQEYMQVNGGNNCMDMRKSLCFRNYNGTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETGKPVDIDECNEIPGICASGV-CINQIGSFRCE------------------CPRGFSYNDVLLICEDIDECSSS----EILCQRNADCINSPGSYRC----ECSEGFKLSPIG-ACIDRNECLENPNLCSHGK-CVDMPGGY------------------ICTCNTGFKATPNRKMCMDIDECVRQPCKN-----GTCKNTVGSYNCLCNAG-----FELTLNNQCTDVDECSGPYSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNCIDVNECLIL-PGTCAP---GTCQNLDGSFRCLCPKGYTVQD---DHCVDVNECEEDPNICLFGSCFNNPGSFECVCKPGFVLSDNGRRCYDTRVSFCFTRFENGKCSIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEHEAGFRDLCPFGVGIIPGIDDTSVDVNECVENPGIC------HNGH-CINTDGSFRC---ECPMGYTLNYTG 2062          

HSP 12 Score: 117.087 bits (292), Expect = 6.770e-26
Identity = 155/532 (29.14%), Postives = 213/532 (40.04%), Query Frame = 3
Query: 1092 ETANACANKWEICVN----TVGS-FRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGW----YNGRCKETDVCF-----NLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTY------------SSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCP----------------KGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSY---KCK-------CFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDI 2525
            ET N C     +C+N     VGS  RC+C  GF+   LG C DIDEC++    + D  C N  GS+ C     C  G+   P    C D DEC +   +C  GM C+N  GS +C                   CK GF     T + +   EC M+  W    Y   C    +C      N  GSY C    +C  G  +  +G +C D    +   +      +CV  +            S+ +    PC P    D +    +C  G     D   TD++ECA +   ++C +   C N  G Y CI        +   +  S    VDEC      C  N  C NV GSY C C +GY    ++ TC DVNEC      ES P +   C N AGS+ C+C                 KG  W      +C      +  N    + +C  T+G+     C+       C +G+     G  CED++EC + P  C NG CVN  G ++C+C  G   D    IC DI
Sbjct:  380 ETINKCLLIPNLCLNGRCILVGSSHRCECNAGFRVDSLGECSDIDECVSDPCTNGD--CVNTAGSFYC----KCHTGFHRPPGKQACFDHDECTS-TNMCLNGM-CINEEGSFKC------------------VCKHGF-----TLASKKCFECYMSAIWLFFVYIDECLTPGICLHGRCINTEGSYRC----ECLAGLAVGPDGRSCVDTHM-RSTCYGAIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLDSAEFNALCPSGTGYAIDG--TDINECAMD--PDICPN-GACENLRGGYRCICN------IGYETDQSGRSYVDECFVNRLLC-DNGLCRNVPGSYTCTCPKGYSYRQDSETCEDVNEC------ESSPCINGLCKNNAGSFACECSPGSKVDPTGLICIDSLKGTCWLTIQEGRCE-----VNINGGTLRSECCATLGAAWGSPCEPCEIDPVCQRGFARP-RGTICEDVNECEVFPGVCPNGRCVNTRGSFKCQCSEGLTLDSTGRICVDI 851          

HSP 13 Score: 113.62 bits (283), Expect = 7.921e-25
Identity = 169/614 (27.52%), Postives = 232/614 (37.79%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICE-----------DIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEIC-GPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETD-----------------VCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDE----CETGEGKCPQNMH--------CVNVVGSYKC---------MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDI-----------NECLAANPCGKKHQ---CVNTVGS----------------YKCKCFQGYRLSISGDTC------EDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            GF      + C D +EC + N C N   +C+N  GSF+C C+ GF  +     E            IDEC+   IC    +C N  GSY+C     C  G    PD   CVD          C G   K V +R          P          C      + F +  + C  +D    N    +G     D                  C NL G Y CI    C  G    Q+G +   +DEC   +  C+ + +C N   SY                   C C  GY   QDS  C DV+EC  +   N      +C N+ GS+AC    EC PG         C D  +        EG+C  N++        C  +  ++           +C RG+       C DVNEC +F     CP+   RCVNT GS+KCQC +G    D   + C DI           +EC+   P   + +   C  TVG+                Y+  C +G   +  GD        +DI+EC + P  C +G C N  G + C+C  GFA D +E  C DIDEC  S  +C   +       C+N  G ++C
Sbjct:  450 GFHRPPGKQACFDHDECTSTNMCLNG--MCINEEGSFKCVCKHGFTLASKKCFECYMSAIWLFFVYIDECLTPGICL-HGRCINTEGSYRC----ECLAGLAVGPDGRSCVDTH----MRSTCYGAIKKGVCVR----------PFQAAVTRSACCCA-SASYSFGEPCQPCPTLDSAEFNALCPSGTGYAIDGTDINECAMDPDICPNGACENLRGGYRCI----CNIGYETDQSGRS--YVDECFVNRLLCD-NGLCRNVPGSY------------------TCTCPKGYSYRQDSETCEDVNECESSPCIN-----GLCKNNAGSFAC----ECSPGSKVDPTGLICIDSLKGTCWLTIQEGRCEVNINGGTLRSECCATLGAAWGSPCEPCEIDPVCQRGFARPRGTICEDVNECEVF--PGVCPN--GRCVNTRGSFKCQCSEGLTL-DSTGRICVDIRLEHCYLTYDEDECV--QPVSGRFRMDACCCTVGAAWGKECEACPEPGTREYEALCPRGPGFANRGDVLTGRPVYKDINECKVFPSICAHGTCRNTIGSFRCRCNGGFALDAEERNCTDIDECKISPDLCGHGA-------CVNTPGSFEC 993          

HSP 14 Score: 88.9669 bits (219), Expect = 2.497e-17
Identity = 117/426 (27.46%), Postives = 162/426 (38.03%), Query Frame = 3
Query: 1344 VDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            +++C   P +C  G +C+ +  SHRCE                  C  GF        C DIDEC  +       C   D C N  GS+ C    KC  G        AC D DEC         + +C+N   S+ CV        +  +++    C + Y          +DEC   G   +C     CIN  GSY    R EC  G+       +C D                C   +    C+      +T +  C          P + CP L++        +   CP G   + Y I   TDINEC           C N  G Y+C C  GY    SG +   +DEC +    C NG+C NVPG Y C CP G++  +  E C+D++EC +S  +        NG LC N  G + C
Sbjct:  382 INKCLLIPNLCLNG-RCILVGSSHRCE------------------CNAGFRVDS-LGECSDIDECVSD------PCTNGD-CVNTAGSFYC----KCHTGFHRPPGKQACFDHDECTSTNMC--LNGMCINEEGSFKCVC-------KHGFTLASKKCFECYMSAIWLFFVYIDECLTPG---ICLHGR-CINTEGSY----RCECLAGLAVGPDGRSCVDTH----------MRSTCYGAIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLDS------AEFNALCPSG---TGYAIDG-TDINECAMDPDICPNGACENLRGGYRCICNIGYETDQSGRS--YVDECFVNRLLCDNGLCRNVPGSYTCTCPKGYSYRQDSETCEDVNECESSPCI--------NG-LCKNNAGSFAC 728          

HSP 15 Score: 66.6254 bits (161), Expect = 1.526e-10
Identity = 37/91 (40.66%), Postives = 49/91 (53.85%), Query Frame = 3
Query: 2223 CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFA 2495
            C +GF   +     C D++EC A     +   CVNTVGSY+CKC  G+RL+   + CED+DEC      C  G C N  G + C CP G+ 
Sbjct:  172 CRRGF-IPNIRTGACQDVDECQAVPGLCQGGNCVNTVGSYECKCPAGHRLNEVTNKCEDVDECSTVQHVCEGGQCTNSVGSFSCVCPSGYV 261          

HSP 16 Score: 53.5286 bits (127), Expect = 1.564e-6
Identity = 33/94 (35.11%), Postives = 49/94 (52.13%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKL-GICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKED 1319
            GF+ N     C D++EC+           CVNTVGS+ C C  G + +++   CED+DEC  V    +  +C N+VGS+ C+   P G+    D
Sbjct:  175 GFIPNIRTGACQDVDECQAVPGLCQGGN-CVNTVGSYECKCPAGHRLNEVTNKCEDVDECSTVQHVCEGGQCTNSVGSFSCV--CPSGYVLSAD 265          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002704.1 (pep scaffold:Pmarinus_7.0:GL476354:513769:588114:-1 gene:ENSPMAG00000002318.1 transcript:ENSPMAT00000002704.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 1.147e-55
Identity = 179/549 (32.60%), Postives = 256/549 (46.63%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI--CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQD-SICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFI 2675
            GF+ +   + C DI+EC+ ++        CVNT GSF C+C +GF+   + +  C DIDEC    +      C N  GS+KC+    C  G   + D   C+DVDEC     +C  G +CVN+ GS++C                   C  G+    + + C DIDECT+  G  +  C  +D      GSY+C     C  G  L  +  +C+DIDEC+   + C+  + C N    Y                  +C+C DG+  + D   C+DV+EC  N   N+C     C N  GS+ C     C  G       + C DVDECE G   C  +  C NV GS+KC C  GY       C DV+EC       +C   EA+CVN  G++ C C  GF       + C D++EC       +  QC+N+ G Y+C+C  G+  ++ G +C+DIDEC+ +   C+ G C NVPG + C C PG+  D     C D DEC+         S+  NG +C N  G + C   +CP  Y    +G G +
Sbjct:  998 GFVLDAEGKNCTDIDECKISHDICGMG-TCVNTPGSFDCECMEGFESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFKCL----CPPGHDLNEDGTVCLDVDECSLSGNLCRNG-RCVNMIGSYQCS------------------CNTGYSATPDRQGCVDIDECTIMNGGCDTHCSNSD------GSYEC----SCERGYALLPDTRSCSDIDECEDNPYLCDGGQ-CTNVPGEY------------------RCLCYDGFISSVDMKTCSDVNECELN--PNIC-IHGKCENTRGSFIC----HCKVGFTVKKGSTGCTDVDECEIGAHNCDMHATCANVQGSFKCTCIEGY-FGDGVKCQDVDECA--NGTHNCIP-EAKCVNIPGTFTCVCRDGFSGDG---QTCVDMDECAENVNLCEFGQCLNSAGGYRCECEMGFVPTVDGRSCKDIDECMFD-NICVFGKCENVPGMFRCVCDPGYEIDETGGNCTDKDECADP-------SNCFNG-ICTNTQGSFLC---TCPADYQMSPSGQGCV 1467          

HSP 2 Score: 192.2 bits (487), Expect = 8.851e-50
Identity = 185/574 (32.23%), Postives = 252/574 (43.90%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC---------------EDDECPINMKR--------NNKG-ICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC---------------------------VASPCAPSQQFDYSVGKCMCR----DGY--------RQNQDS----ICT--------------DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEA-RCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAA--NPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKE 2510
            GFL+N    IC DINEC +A     +   C+N+VGS+RC+C  G+  +  G+C D DEC          +C++  GSY+C+    C  G+K   D N C+DVDECE  P  CG G  C N  GS  C               + DEC              NN G     C +GF    + ++C DI+EC      + G C     C NL GS+ C+    C PG  + +   AC DIDEC   +  C     C+NT+ S+ C                               C+  + F+ S   C C     DG+        +QN++     +C               D+DEC  N G  +C +   CIN  GS+    R +CP G    +    C D +EC  G   C  N  C+NV G ++C CD G+      TC D+NEC L       P L A RCVN  GSY+C CP G+   +   + C D +EC     N   +   C N +G+Y C C  GY     G+ C D +EC L+P  C NG C+N  G Y+C C  GF  ++ E
Sbjct: 1736 GFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRCECSPGYTQTPFGLCIDRDECSEKPEICSPGRCQDTEGSYRCM----CPNGYKATEDQNMCMDVDECERQP--CGNGT-CRNTVGSFNCLCFPGFEISANNDCMDKDECVSLAAHVCKFGSCINNVGSFKCLCNEGFELTADKKNCRDINECQQ----FRGMCA-PGTCQNLEGSFRCM----CPPGYEVKEE--ACTDIDECSSEEDLCMMGS-CLNTFGSFECRCPSGFILSETGRKCYDVRVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPG--ICANGR-CINTDGSF----RCDCPMGYNLEAAGFKCVDANECSIGN-PC-GNGTCLNVPGGFECTCDDGFEPGPMMTCEDLNECSLN------PLLCAFRCVNNFGSYECMCPTGYVLRE-DRRMCKDQDECEEGLDNCASRNMICKNLIGTYMCICPPGYTRRPDGEGCIDENECRLKPGICENGRCINNVGSYKCVCNEGFTLNQDE 2274          

HSP 3 Score: 186.422 bits (472), Expect = 5.326e-48
Identity = 174/559 (31.13%), Postives = 250/559 (44.72%), Query Frame = 3
Query: 1077 DINECETANA-CANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCAD--VNECLLFRPEESCPDLEARCVNTAG-------------------------SYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKE 2657
            DI+EC      C N   +CVN  GSFRC+C  GF ++ +  ICEDI+EC +   +C  + +C N+VGSY+C     C  G+ + P    C+D DEC   PEIC PG +C +  GS+RC                   C +G+   ++   C D+DEC       NG C+      N  GS++C+    C PG  ++ N   C D DEC  +         C+N   S+                  KC+C +G+    D   C D++EC +  G    G+   C N  GS+ C+    CPPG         C D+DEC + E  C     C+N  GS++C C  G+IL+ +   C D  VN C     +  C   +    + AG                         +Y+  CP G            D++ECLA        +C+NT GS++C C  GY L  +G  C D +EC +    C NG C+NVPG +EC C  GF       C+D++ECS +  +C+          C+N  G Y+C+   CP GY  +E
Sbjct: 1706 DIDECSKIQGICTNG--MCVNLPGSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRC----ECSPGYTQTP-FGLCIDRDECSEKPEICSPG-RCQDTEGSYRC------------------MCPNGYKATEDQNMCMDVDECERQP-CGNGTCR------NTVGSFNCL----CFPGFEISANN-DCMDKDECVSLAAHVCKFGSCINNVGSF------------------KCLCNEGFELTADKKNCRDINECQQFRGMCAPGT---CQNLEGSFRCM----CPPGY--EVKEEACTDIDECSSEEDLCMMG-SCLNTFGSFECRCPSGFILSETGRKCYDVRVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANGRCINTDGSFRCDCPMGYNLEAAGFKCVDANECSIG-NPCGNGTCLNVPGGFECTCDDGFEPGPMMTCEDLNECSLNPLLCAFR--------CVNNFGSYECM---CPTGYVLRE 2186          

HSP 4 Score: 181.415 bits (459), Expect = 1.702e-46
Identity = 183/634 (28.86%), Postives = 263/634 (41.48%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHS-----------KLGIC-----EDIDECMNVNI------------CSDDKKCKN--------NVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDEC------------KQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICT----DVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-----------------------------------------LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            G+  ++    C D +EC   + C N   IC NT GSF C C   ++ S           ++G C     E  D  ++ N+            CS  +            N   Y+ +   P G G++ +P T    D+DEC   P +C  G  C N  GS +C                   C+ GF F ++ R CEDIDEC  N     G       C+N+ G+Y C+    C P  +    G  C D+ +              ++ F     E C  +Y+       PC P           +C       +  I T    D+DEC++  G    G   +C+N PGS+    R ECP G   + +   C+D++EC + E  C +N  C+N VGSY+C C  GY  T    C D +EC   +PE   P    RC +T GSY+C CP G++ ++     C D++EC                                         LAA+ C K   C+N VGS+KC C +G+ L+     C DI+EC      C  G C N+ G + C CPPG+   ++E C DIDECS+ E +C   S       C+N  G ++C    CP G+   ETG
Sbjct: 1415 GYEIDETGGNCTDKDECADPSNCFNG--ICTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRIL--CPGGEGFRPNPYTVILEDIDECTELPGLC-QGGNCQNTFGSFKC------------------VCQPGFRFNEDNRQCEDIDECA-NFPTVCG----PGTCYNIVGNYTCV----CPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCC-SYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQGICTNG---MCVNLPGSF----RCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRCECSPGYTQTPFGLCIDRDECSE-KPEICSP---GRCQDTEGSYRCMCPNGYKATE-DQNMCMDVDECERQPCGNGTCRNTVGSFNCLCFPGFEISANNDCMDKDECVSLAAHVC-KFGSCINNVGSFKCLCNEGFELTADKKNCRDINECQQFRGMCAPGTCQNLEGSFRCMCPPGYEV-KEEACTDIDECSSEEDLCMMGS-------CLNTFGSFEC---RCPSGFILSETG 1991          

HSP 5 Score: 176.407 bits (446), Expect = 7.555e-45
Identity = 174/582 (29.90%), Postives = 252/582 (43.30%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKED------------------------------------------PDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRS-CEDIDE-----------CTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSEGVCSRE-SDFQNGRLCINLLGYYKCVNSSCPVG 2642
            C D NEC   N C N    C+N  G F C C  GF+   +  CED++EC +N  +C+   +C NN GSY+C+   P G+  +ED                                          PD   C+D +EC   P IC  G +C+N  GS++C  +E        ++  C   + GF F +  +S C+ +             C    GW     ++ D+C  LPG+     KK C  G     +G    DIDEC  M   C   + C+N+  SYHC                  MC +GY  +   + C D+DECA++     C   +IC N  GSY C     CP G         C+D+DEC + +  C     CVN +G + C C  G+    +  C D NEC+    +      +  C N+ GS+ C+C KGF   D     C D++EC   + C  +H C N +G Y+C C  GY      + C D +EC   P+ C +  C N  G ++C CP G+  D+    C D++ECS S+  C+   S+ + G LC    GY++     C  G
Sbjct: 2110 CVDANECSIGNPCGNG--TCLNVPGGFECTCDDGFEPGPMMTCEDLNECSLNPLLCA--FRCVNNFGSYECM--CPTGYVLREDRRMCKDQDECEEGLDNCASRNMICKNLIGTYMCICPPGYTRRPDGEGCIDENECRLKPGICENG-RCINNVGSYKCVCNE--GFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWG----QQCDIC-PLPGTAQ--YKKLCPHGPGYTTDG---RDIDECTVMPGMCHHGQ-CINSEGSYHC------------------MCNNGYTTDITRTGCVDLDECAQS--PKPCN--FICKNTEGSYQCA----CPRGYIMQEDGRTCRDLDECASKQHNC--QFLCVNTIGGFTCKCPPGFT-QHHTACIDNNECV---SQPGTCGSKGVCQNSPGSFSCECQKGFSL-DNSGSNCEDMDECSGNHRC--QHGCQNMLGGYRCGCPSGYLQHFQWNQCVDENECT-NPQVCGSASCYNTLGSFKCACPNGYNFDQFSGGCNDVNECSHSKAPCNFGCSNTEGGYLCGCPPGYFRAGQGHCVSG 2635          

HSP 6 Score: 171.785 bits (434), Expect = 1.730e-43
Identity = 181/590 (30.68%), Postives = 243/590 (41.19%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNVNICSDD---KKCKN----NVGSYKCIRSIPCGFGWKED----PDTND-------CV--------------DVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPE-ESCPDLEARCVNTAGSYKCQCPKGFEWSDY----PI-------KKCT----------DINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            E C DI+EC +          C+NT GSF C C  GF  S+ G  C D+     VN C  +    KC      N     C  S+  G GW +     P  N+       C               D+DEC A P IC  G +C+N  GS RC+   CP+               G+  +     C D +EC++     NG       C N+PG ++C       PG ++      C D++EC      C     CVN + SY                  +CMC  GY   +D  +C D DEC E G DN      IC N  G+Y CI    CPPG  R      C D +EC    G C +N  C+N VGSYKC+C+ G+ L  + T C D      F    +S   + +   N     +C C  G  W       P+       K C           DI+EC          QC+N+ GSY C C  GY   I+   C D+DEC   P+ C N IC N  G Y+C CP G+   +    C+D+DEC++ +  C          LC+N +G + C    CP G+T+  T
Sbjct: 1950 EACTDIDECSSEEDLCMMGS-CLNTFGSFECRCPSGFILSETGRKCYDV----RVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANG-RCINTDGSFRCD---CPM---------------GYNLEAAGFKCVDANECSIGNPCGNG------TCLNVPGGFECTCDDGFEPGPMMT-----CEDLNECSLNPLLCA--FRCVNNFGSY------------------ECMCPTGYVLREDRRMCKDQDEC-EEGLDNCASRNMICKNLIGTYMCI----CPPGYTRRPDGEGCIDENECRLKPGIC-ENGRCINNVGSYKCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRDIDECTVMPGMCHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDECAQSPKPC-NFICKNTEGSYQCACPRGYIMQEDGRTCRDLDECASKQHNCQ--------FLCVNTIGGFTC---KCPPGFTQHHT 2466          

HSP 7 Score: 166.777 bits (421), Expect = 6.052e-42
Identity = 181/586 (30.89%), Postives = 237/586 (40.44%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE-TANACANKWEICVNTVGSFRCDCQKGFKHS--KLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC----------------EDDECPINMKRNNKGICS--------RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYAC----------------------------IQRAECPPGMFR---------SSMYSNCQDVDECETGEGKCPQNMH---CVNVVGSYKCMCDRGYILT-SNNTCAD----VNECLLFRPEESCPDLE-----------------------ARC-----VNTAGSYKCQCP--KGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF 2492
            G   N+   +C D++EC  + N C N    CVN +GS++C C  G+  +  + G C DIDEC  +N    D  C N+ GSY+C     C  G+   PDT  C D+DECE  P +C  G +C N+ G +RC                + +EC +N      G C          CK GF  KK +  C D+DEC   +G +N  C     C N+ GS+ C     C  G     +G+ C D+DEC      C P+  CVN   ++ CV                  CRDG+  +  + C D+DECAEN   NLC     C+N  G Y C                              + E  PGMFR              NC D DEC       P N     C N  GS+ C C   Y ++ S   C      V +C L   E     L                        A C     VNT   Y+  CP  +GF  + Y +    DI+EC       +   C NT GS+KC C  G+R +     CEDIDEC   P  C  G C N+ G Y C CPP +
Sbjct: 1083 GHDLNEDGTVCLDVDECSLSGNLCRNGR--CVNMIGSYQCSCNTGYSATPDRQG-CVDIDECTIMNG-GCDTHCSNSDGSYEC----SCERGYALLPDTRSCSDIDECEDNPYLC-DGGQCTNVPGEYRCLCYDGFISSVDMKTCSDVNECELNPNICIHGKCENTRGSFICHCKVGFTVKKGSTGCTDVDEC--EIGAHN--CDMHATCANVQGSFKCT----CIEGYF--GDGVKCQDVDECANGTHNCIPEAKCVNIPGTFTCV------------------CRDGFSGDGQT-CVDMDECAEN--VNLC-EFGQCLNSAGGYRCECEMGFVPTVDGRSCKDIDECMFDNICVFGKCENVPGMFRCVCDPGYEIDETGGNCTDKDECAD-----PSNCFNGICTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTT-EYRILCPGGEGFRPNPYTVIL-EDIDECTELPGLCQGGNCQNTFGSFKCVCQPGFRFNEDNRQCEDIDECANFPTVCGPGTCYNIVGNYTCVCPPDY 1620          

HSP 8 Score: 160.614 bits (405), Expect = 4.585e-40
Identity = 174/560 (31.07%), Postives = 246/560 (43.93%), Query Frame = 3
Query: 1077 DINECE-TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQN-----GIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCM------CRDGY-----------RQNQDSICTDVDE--------CAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDL--EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            DINEC      C N    C N +G++RC C  G++    G  C D+DECM      D+  C+N  GSY C  + P G+ +K +  T  C DVDECE+ P I G    C N  GS  C     P +     K IC     G  +          + C +NV   NG   +++ C  L  ++   P + C   T+  +      G  C D++EC+     C  +  C+NT  S+ C    C P    + +   C+      C   Y           R   D  C  + +        C E G        ++C   PG Y+   R + P G          +D++EC+     C  N  C N +GS+KC C+ G++L +    C D++EC +        D+     CVNT GS+ C+C +GFE     +K C DI+EC       +   CVNT GS+KC C  G+ L+  G  C D+DEC L    C NG CVN+ G Y+C C  G++A   ++ C DIDEC+   G C           C N  G Y+C   SC  GY 
Sbjct:  664 DINECALNPEICTNGQ--CENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCRNTPGSYTC--ACPAGYLFKHE--TEMCEDVDECESNPCING---NCQNTVGSFTCVC--LPTSKLDQTKTICIESTKGTCWLNIID-----NRCEVNV---NGATLKSECCSTLGAAWG-SPCEPCELDTICPKGFSRAKGTQCEDVNECEVFAGICV-NSRCINTAGSFKC---ECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEY---AFLCPRGPG-YS--NRGD-PVGRHFF------KDINECKVFPQMC-SNGKCRNTIGSFKCNCENGFVLDAEGKNCTDIDECKISH------DICGMGTCVNTPGSFDCECMEGFESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFKCLCPPGHDLNEDGTVCLDVDECSLSGNLCRNGRCVNMIGSYQCSCNTGYSATPDRQGCVDIDECTIMNGGCDTH--------CSNSDGSYEC---SCERGYA 1168          

HSP 9 Score: 157.918 bits (398), Expect = 3.171e-39
Identity = 186/593 (31.37%), Postives = 257/593 (43.34%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFK--HSKLGICEDIDECMNVNICSDDKKCKNNVGSY----KCIRSIPCGFGWKEDP---DT-----------NDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCED--IDECTMNVGWYNG------RCKETDVCFNLPGSY----DCIPKKKCRPGTVLAQNGIACN------------DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSS--MYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKK-CTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNG 2669
            G+LF    E+C D++ECE+ N C N    C NTVGSF C C    K   +K    E       +NI   D +C+ NV       +C  ++   +G   +P   DT             C DV+ECE F  IC    +C+N  GS +CE                  C  G   +   R+C D  ++ C ++            R +    C +L  ++    +  P+K       L   G   +            DI+ECK     C  +  C NT  S+                  KC C +G+  + +   CTD+DEC  +   ++CG +  C+N PGS+ C    EC  G F S   M  NC D+DECE     C +   CVN  GS+KC+C  G+ L  + T C DV+EC L      C +   RCVN  GSY+C C  G  +S  P ++ C DI+EC   N  G    C N+ GSY+C C +GY L     +C DIDEC   P  C  G C NVPG Y C C  GF +    + C D++EC  +  +C           C N  G + C    C VG+T K+   G
Sbjct:  736 GYLFKHETEMCEDVDECES-NPCINGN--CQNTVGSFTCVCLPTSKLDQTKTICIESTKGTCWLNI--IDNRCEVNVNGATLKSECCSTLGAAWGSPCEPCELDTICPKGFSRAKGTQCEDVNECEVFAGIC-VNSRCINTAGSFKCE------------------CPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINECKVFPQMCS-NGKCRNTIGSF------------------KCNCENGFVLDAEGKNCTDIDECKIS--HDICG-MGTCVNTPGSFDC----ECMEG-FESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEGSFKCLCPPGHDLNEDGTVCLDVDECSL--SGNLCRN--GRCVNMIGSYQCSCNTG--YSATPDRQGCVDIDECTIMNG-GCDTHCSNSDGSYECSCERGYALLPDTRSCSDIDECEDNPYLCDGGQCTNVPGEYRCLCYDGFISSVDMKTCSDVNECELNPNICIHGK-------CENTRGSFIC---HCKVGFTVKKGSTG 1259          

HSP 10 Score: 151.754 bits (382), Expect = 2.629e-37
Identity = 167/547 (30.53%), Postives = 232/547 (42.41%), Query Frame = 3
Query: 1071 CGDINECET-ANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDI--DEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGW-YNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI--CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
            C D+NECE  A  C N    C+NT GSF+C+C  G      G  C D+  + C ++      ++     + S  C  S+  G  W             ECE  PE           +GS       CP     +N+G       G +F K      DI+EC +      NG+C+      N  GS+ C     C  G VL   G  C DIDECK     C     CVNT  S+                   C C +G+      +  C D+DEC  N    L      C+N  GS+ C+    CPPG   +   + C DVDEC      C +N  CVN++GSY+C C+ GY  T +   C D++EC +          +  C N+ GSY+C C +G+       + C+DI+EC          QC N  G Y+C C+ G+  S+   TC D++EC L P  C++G C N  G + C C  GF   +    C D+DEC      C   +       C N+ G +KC   +C  GY     G+G  C+
Sbjct:  849 CEDVNECEVFAGICVNSR--CINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSL--GKAWGP-----------ECEGCPE-----------KGSSE-YAFLCPRGPGYSNRGD----PVGRHFFK------DINECKVFPQMCSNGKCR------NTIGSFKC----NCENGFVLDAEGKNCTDIDECKISHDICGMG-TCVNTPGSF------------------DCECMEGFESGFMMMKNCMDIDECERN---PLLCRGGTCVNTEGSFKCL----CPPGHDLNEDGTVCLDVDECSLSGNLC-RNGRCVNMIGSYQCSCNTGYSATPDRQGCVDIDECTIMNG-----GCDTHCSNSDGSYECSCERGYALLP-DTRSCSDIDECEDNPYLCDGGQCTNVPGEYRCLCYDGFISSVDMKTCSDVNECELNPNICIHGKCENTRGSFICHCKVGFTVKKGSTGCTDVDECEIGAHNCDMHA------TCANVQGSFKC---TCIEGY----FGDGVKCQ 1302          

HSP 11 Score: 146.362 bits (368), Expect = 1.265e-35
Identity = 185/627 (29.51%), Postives = 250/627 (39.87%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDV-------------------------DEC------EAFPEICGP---------GMKCVNIRGSHRCED-DECPINMKRNNKGICSR--------CKDGFYFKKETRSCEDIDECTMNVGWY-NGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGG---DNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVN--ECLL--------------FRPEESC--------PDLEARCVNTAGSYKCQCPKGFEWSDY--PIKK--CTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI--CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            GF        C D +EC T N C N   +C+N  GSF+C C+ GF     G  C DIDEC    IC  + +C N  GS+KC     C  G     D   C+D                           EC       AF E C P          M C      +  +D +EC +N +    G C          C  G+      + C D+DEC +      NG C+      N PGSY C     C  G +       C D+DEC+        +  C NT  S+ CV   C P+ + D +  K +C +  +     +I  +  E   NG       C +L      P    C     CP G  R+   + C+DV+ECE   G C  N  C+N  GS+KC C  G+ L S   TC D+    C L               R +  C        P+ E      +  Y   CP+G  +S+   P+ +    DINEC          +C NT+GS+KC C  G+ L   G  C DIDEC +    C  G CVN PG ++C+C  GF +    +  C DIDEC  +  +C        G  C+N  G +KC+   CP G+   E G
Sbjct:  502 GFELTADGRNCLDHDECSTTNMCLNG--MCINEDGSFKCICKPGFYLVPSGRYCLDIDECQTHGICM-NGRCINTEGSFKC----ECPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGGKDINECALNPEICTNGQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCR------NTPGSYTC----ACPAGYLFKHETEMCEDVDECESNPCI---NGNCQNTVGSFTCV---CLPTSKLDQT--KTICIESTKGTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSP-CEPCELDTICPKGFSRAKG-TQCEDVNECEVFAGIC-VNSRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINECKVFPQMCSNGKCRNTIGSFKCNCENGFVLDAEGKNCTDIDECKISHDICGMGTCVNTPGSFDCECMEGFESGFMMMKNCMDIDECERNPLLC-------RGGTCVNTEGSFKCL---CPPGHDLNEDG 1090          

HSP 12 Score: 119.013 bits (297), Expect = 3.412e-27
Identity = 138/475 (29.05%), Postives = 190/475 (40.00%), Query Frame = 3
Query: 1203 DIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEIC---------VNTYSSYHCV------ASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQC----------------PKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGS----------YKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD 2501
            DIDEC+       + +C N  GS++CI    C  G++   D  +C+D DEC     +C  GM C+N  GS +C                   CK GFY     R C DIDEC  +    NGR      C N  GS+ C    +C PG +++ +G  C D      M+  C  D +           NT S   C         PC P    +    K +C      N      D++ECA N    +C +   C N  G+Y C+    C  G         C DVDEC      C  N  C N  GSY C C  GY+       C DV+EC      ES P +   C NT GS+ C C                 KG  W +    +C      +  N    K +C +T+G+              C +G+  +  G  CED++EC +    C+N  C+N  G ++C+CPPG   +
Sbjct:  472 DIDECVYNGQVCKNGRCVNTEGSFQCI----CNAGFELTADGRNCLDHDECST-TNMCLNGM-CINEDGSFKC------------------ICKPGFYLVPSGRYCLDIDECQTHGICMNGR------CINTEGSFKC----ECPPGMIVSMDGRLCIDT----HMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGGK---DINECALN--PEICTNGQ-CENQLGTYRCV----CNIGYESDITGKKCVDVDECMLRAHLC-DNGSCRNTPGSYTCACPAGYLFKHETEMCEDVDEC------ESNPCINGNCQNTVGSFTCVCLPTSKLDQTKTICIESTKGTCWLNIIDNRCE-----VNVNGATLKSECCSTLGAAWGSPCEPCELDTICPKGFSRA-KGTQCEDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLE 885          

HSP 13 Score: 115.161 bits (287), Expect = 5.464e-26
Identity = 114/346 (32.95%), Postives = 152/346 (43.93%), Query Frame = 3
Query: 1677 DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCAD------------VNECLLFRP-----EESC----------PDLEARCVNTAGSYKCQCPK-GFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK-EICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            DIDEC      C+ +  CVNT  S+ C+                  C  G+    D   C D DEC+     N+C +  +CIN  GS+ CI    C PG +       C D+DEC+T  G C  N  C+N  GS+KC C  G I++ +   C D            + +CL   P      E C          P L    VN+   YK  CP  GF+          DINEC          QC N +G+Y+C C  GY   I+G  C D+DEC+L    C NG C N PG Y C CP G+    + E+C+D+DEC ++  +        NG  C N +G + CV
Sbjct:  472 DIDECVYNGQVCK-NGRCVNTEGSFQCI------------------CNAGFELTADGRNCLDHDECSTT---NMCLN-GMCINEDGSFKCI----CKPGFYLVPSGRYCLDIDECQT-HGIC-MNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSD-DYKMLCPTPGFDNGG------KDINECALNPEICTNGQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCRNTPGSYTCACPAGYLFKHETEMCEDVDECESNPCI--------NGN-CQNTVGSFTCV 772          

HSP 14 Score: 108.227 bits (269), Expect = 6.911e-24
Identity = 142/470 (30.21%), Postives = 193/470 (41.06%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWY-NGRCKETDVCFNLPGSYDCIPKKKC---RPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASP--CAPSQ-QFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTC---ADVNECLLFRPEESC------PDLEARCVNTAGSY---KCQ-------CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDI 2402
            DI+EC   N    K   CVNT GSF+C C  GF+ +  G  C D DEC   N+C  +  C N  GS+KCI    C  G+   P    C+D+DEC+    IC  G +C+N  GS +CE                  C  G     + R C D    +   G Y  G+C         PG+     K +C    P     +  + C  ++     K  C              C  +P  C   Q +      +C+C  GY  +     C DVDEC      +LC +   C N PGSY C     CP G         C+DVDECE+       N +C N VGS+ C+C     L    T    +    C L   +  C        L++ C +T G+     C+       CPKGF  S     +C D+NEC          +C+NT GS+KC+C  G+ L  +G TC D+
Sbjct:  472 DIDEC-VYNGQVCKNGRCVNTEGSFQCICNAGFELTADGRNCLDHDECSTTNMCL-NGMCINEDGSFKCI----CKPGFYLVPSGRYCLDIDECQTH-GICMNG-RCINTEGSFKCE------------------CPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTP-----FPGANT---KSECCCANPNFAFGEPCLPCPAVNS-DDYKMLCPTPGFDNGGKDINECALNPEICTNGQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRA--HLCDNGS-CRNTPGSYTCA----CPAGYLFKHETEMCEDVDECESNPCI---NGNCQNTVGSFTCVCLPTSKLDQTKTICIESTKGTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSPCEPCELDTICPKGF--SRAKGTQCEDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLESTGRTCIDL 894          

HSP 15 Score: 103.99 bits (258), Expect = 1.296e-22
Identity = 126/460 (27.39%), Postives = 178/460 (38.70%), Query Frame = 3
Query: 1065 EICGDINECET-ANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNV-----------NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPD--------------------TNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECL-------------LFRPEESCPD-----------------------LEARCVNTAGSYKCQCPKGF 2237
            E C D NEC      C N    C+N VGS++C C +GF  +     +D  EC++            ++C      +N V   +C      G GW +  D                    T D  D+DEC   P +C  G +C+N  GS+ C                   C +G+        C D+DEC  +    N  CK T+      GSY C     C  G ++ ++G  C D+DEC   +  C+   +CVNT   + C   P                  G+ Q+  + C D +EC    G   CGS  +C N PGS++C    EC  G    +  SNC+D+DEC +G  +C     C N++G Y+C C  GY+     N C D NEC              L   + +CP+                           C NT G Y C CP G+
Sbjct: 2233 EGCIDENECRLKPGICENGR--CINNVGSYKCVCNEGFTLN-----QDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDG--GRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRDIDECTVMPGMCHHG-QCINSEGSYHC------------------MCNNGYTTDITRTGCVDLDECAQSPKPCNFICKNTE------GSYQC----ACPRGYIMQEDGRTCRDLDECASKQHNCQ--FLCVNTIGGFTCKCPP------------------GFTQHH-TACIDNNECVSQPG--TCGSKGVCQNSPGSFSC----ECQKGFSLDNSGSNCEDMDEC-SGNHRCQHG--CQNMLGGYRCGCPSGYLQHFQWNQCVDENECTNPQVCGSASCYNTLGSFKCACPNGYNFDQFSGGCNDVNECSHSKAPCNFGCSNTEGGYLCGCPPGY 2624          

HSP 16 Score: 82.0333 bits (201), Expect = 6.980e-16
Identity = 91/316 (28.80%), Postives = 129/316 (40.82%), Query Frame = 3
Query: 1893 LCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNC---------------------------QDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDE--------------------------CLLEPRKCLNGICVNVPG----RYECKCP-PGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            LC +L +C+  PG    + +  C  G F+S     C                            D+DEC    G+  +N  CVN  GS++C+C+ G+ LT++   C D +EC        C  L   C+N  GS+KC C  GF +     + C DI+EC     C    +C+NT GS+KC+C  G  +S+ G  C D                             C   P       C+  P      Y+  CP PGF    K    DI+EC+ +  +C+      NG+ C N LG Y+CV   C +GY    TG
Sbjct:  409 LCANLILCVVSPGGIGALNQTHCGRG-FKSDFRGGCVAPDSHQVCVFNINVRIHFAAFTMFEFADIDEC-VYNGQVCKNGRCVNTEGSFQCICNAGFELTADGRNCLDHDEC---STTNMC--LNGMCINEDGSFKCICKPGF-YLVPSGRYCLDIDECQTHGIC-MNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGGK----DINECALNPEICT------NGQ-CENQLGTYRCV---CNIGYESDITG 701          

HSP 17 Score: 74.7146 bits (182), Expect = 9.790e-14
Identity = 65/206 (31.55%), Postives = 89/206 (43.20%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNG 1664
            F Q    C D NEC +         +C N+ GSF C+CQKGF     G  CED+DEC   + C     C+N +G Y+C     C  G+ +    N CVD +EC   P++CG    C N  GS +C                   C +G+ F + +  C D++EC+ +    N  C  T+      G Y C     C PG   A  G
Sbjct: 2461 FTQHHTACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCEDMDECSGNHRCQ--HGCQNMLGGYRC----GCPSGYLQHFQWNQCVDENECTN-PQVCG-SASCYNTLGSFKCA------------------CPNGYNFDQFSGGCNDVNECSHSKAPCNFGCSNTE------GGYLC----GCPPGYFRAGQG 2630          

HSP 18 Score: 68.1662 bits (165), Expect = 9.689e-12
Identity = 41/92 (44.57%), Postives = 49/92 (53.26%), Query Frame = 3
Query: 2223 CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAA 2498
            C +GF   +     C D++EC A     K   CVNTVGSY+CKC  G++ S     CEDIDEC   P  C  G C N  G Y C CP GF+ 
Sbjct:  176 CRRGF-IPNIRTGACQDVDECQAIPGMCKGGTCVNTVGSYECKCPLGHKQSELSQQCEDIDECETIPGICNGGECKNTIGSYFCNCPAGFST 266          

HSP 19 Score: 62.003 bits (149), Expect = 8.291e-10
Identity = 41/102 (40.20%), Postives = 53/102 (51.96%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVD 1343
            GF+ N     C D++EC+       K   CVNTVGS+ C C  G K S+L   CEDIDEC  +    +  +CKN +GSY C     C  G+   PD + C D
Sbjct:  179 GFIPNIRTGACQDVDECQAIPG-MCKGGTCVNTVGSYECKCPLGHKQSELSQQCEDIDECETIPGICNGGECKNTIGSYFC----NCPAGFSTPPDRSSCFD 275          

HSP 20 Score: 55.8398 bits (133), Expect = 5.736e-8
Identity = 44/139 (31.65%), Postives = 58/139 (41.73%), Query Frame = 3
Query: 1161 CQKGF-KHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCK 1574
            C++GF  + + G C+D+DEC  +        C N VGSY+C     C  G K+   +  C D+DECE  P IC  G +C N  GS+ C                   C  GF    +  SC D           NGRC 
Sbjct:  176 CRRGFIPNIRTGACQDVDECQAIPGMCKGGTCVNTVGSYEC----KCPLGHKQSELSQQCEDIDECETIPGICN-GGECKNTIGSYFC------------------NCPAGFSTPPDRSSCFDQRTGACYASLANGRCS 291          

HSP 21 Score: 49.2914 bits (116), Expect = 5.991e-6
Identity = 85/317 (26.81%), Postives = 114/317 (35.96%), Query Frame = 3
Query: 1305 GWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICS---RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDL--EARCVNTAGSYKCQCPKGF 2237
            GWK  P  N C+ V  C      CG G         + C      I+    +K I     RC +G        SC D D C+   G+    C +  VC                      QNG  C   + C            CV  ++  HC         + DY  G C  +   +  Q  +   V  C +      C ++     HP      Q   C  G   +     CQDVDEC+   G C +   CVN VGSY+C C  G+  +  +  C D++EC      E+ P +     C NT GSY C CP GF
Sbjct:   15 GWKTLPGGNQCI-VPICR---HSCGDGF----CSRPNMCTCSSGQISSTCGSKSISQCNIRCMNG-------GSCAD-DHCSCGKGYTGTHCGQP-VC------------------DTGCQNGGRCIGPNRCA-----------CVYGFTGPHC---------ERDYRTGPCFTQVSNQMCQGQVSGIV--CTKG---LCCATIGRAWGHPCEVCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMC-KGGTCVNTVGSYECKCPLGHKQSELSQQCEDIDEC------ETIPGICNGGECKNTIGSYFCNCPAGF 264          

HSP 22 Score: 48.521 bits (114), Expect = 9.855e-6
Identity = 40/116 (34.48%), Postives = 51/116 (43.97%), Query Frame = 3
Query: 1479 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC-----VASPCAPSQQFDYSVGKC 1811
            C+ GF     T +C+D+DEC    G   G       C N  GSY+C    KC  G   ++    C DIDEC+ +   C   E C NT  SY C      ++P   S  FD   G C
Sbjct:  176 CRRGFIPNIRTGACQDVDECQAIPGMCKG-----GTCVNTVGSYEC----KCPLGHKQSELSQQCEDIDECETIPGICNGGE-CKNTIGSYFCNCPAGFSTPPDRSSCFDQRTGAC 281          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006555.1 (pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-1 gene:ENSPMAG00000005922.1 transcript:ENSPMAT00000006555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.068 bits (523), Expect = 8.033e-55
Identity = 170/516 (32.95%), Postives = 232/516 (44.96%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI---CEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------------------ASPCAPSQQFDYSVGK--CMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECET-GEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPI----KKCTDINECLAAN--PCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAAD 2501
              C D++EC++      ++  C N  G++ C C  G+  ++  +   C D+DEC      +C     C N +GSY C     C  G+  +     C+DVDEC      C     C N  GS++C+ D                      F+K    C D+DEC   + + +  C +   C N  GSY+C     C  G +   NG  C D+DEC      C  +  C NT  S+ C                       ++ C P      +VG   C C  GY  N  ++C DVDEC      N C +   C N PGS+ C    +C  G  ++     C DV+EC+T G   C    +CVN VGSY C+C  GYI  +   C DV+ECLL  P  +C    + C NT GS++CQC  GF+    P     +KC D+NEC  +    CG    CVNTVGSY C C  GY    +G  C D+DECLL    C  N  C N PG ++C+C  GF +D
Sbjct:   26 RTCQDVDECQSGIYNCTQYSTCHNLDGNYTCICNSGYYLNEFPMQRTCIDVDECEKAGSALCGHGAYCANTLGSYAC----RCLVGYVGNGTV--CLDVDECLLPSNNCSANSTCTNTPGSYQCQCDA--------------------GFQKTGEMCTDVDEC---LKFGSAACGQGAYCVNTVGSYNC----PCLAGYI--GNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGN-GTVCLDVDECLLP--SNNCSANSTCKNTPGSFQC----QCDAGFQKTG--EKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYI-GNGTVCLDVDECLL--PSNNC-SANSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSD 491          

HSP 2 Score: 176.022 bits (445), Expect = 2.624e-45
Identity = 162/481 (33.68%), Postives = 214/481 (44.49%), Query Frame = 3
Query: 1197 CEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQM-KFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECET-GEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKC 2618
            C D++EC       C     C N VGSY C+    C  G+  +     C+DVDEC      C     C N  GS +C+ D         +K I        Y   E      +     N  +  G+ K T    N P     I          +++ G  C D++EC+      C P   CVNT  SY+C                   C  GY  N  ++C DVDEC      N C +   C N PGS+ C    +C  G  ++     C DV+EC T G   C    +CVN VGSY C C  GYI  +   C DV+ECLL  P  +C    + C NT GS++CQC  GF+ +    +KC D+NEC    +  CG    CVNTVGSY C C  GY  +  G  C D+DECLL    C  N  C N PG ++C+C  GF ++   +C+DI+EC     VC        G +C N +G Y+C
Sbjct:  555 CVDVNECQTFGSAACGPGAYCVNTVGSYNCL----CLAGYIGNGTV--CLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQIQSSIHKSILGMMVSVVYIYIEFILQLFLARDYPNYSYELGKNKNTAHQKN-PTCPLLIFHFYGLKFIWISETGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNC------------------PCLAGYIGN-GTLCLDVDECLLP--SNNCSANSTCKNTPGSFQC----QCDAGFQKTG--EKCVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGYI-GNGTLCLDVDECLL--PSNNC-SANSTCKNTPGSFQCQCDAGFQKTG---EKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIGN--GTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSNAT-VCEDINECGRVPAVCGL------GTVCENTVGSYRC 985          

HSP 3 Score: 174.866 bits (442), Expect = 6.991e-45
Identity = 166/539 (30.80%), Postives = 231/539 (42.86%), Query Frame = 3
Query: 1050 FNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECE-AFPEICGPGMKCVNIRGSHRC--------------EDDECPINMKRNNKGICSRCKD--GFY-------FKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYR------QNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYI-----------------------LTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC--LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGF 2492
            F +  E+C D++EC +  +A   +   CVNTVGS+ C C  G+  +   +C D+DEC+   N CS +  CKN  GS++C     C  G+++  +   CVDV+EC+ +    CGPG  CVN  GS+ C              + DEC   +  NN    S CK+  G +       F+K    C D++EC  +    +  C     C N  GSY+C+    C  G +   NG  C D+DEC      C  +  C NT  S+                  +C C  G++            C DV+EC    G   CG    C+N  GSY C+    C  G   +     C DVDEC      C  N  C N  GS++C CD G+                        ++    C  +   +L++       L   CV  + +Y    P   E  +    KC D+NEC    +  CG    CVNTVGSY C C  GY    +G  C D+DECLL    C  N  C N PG ++C+C  GF
Sbjct:  149 FQKTGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIGNGT-VCLDVDECLLPSNNCSANSTCKNTPGSFQC----QCDAGFQKTGE--KCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDECL--LPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSG---SAACGPGAYCVNTVGSYNCL----CLAGYI--GNGTVCLDVDECLLPSNNCSANSTCKNTPGSF------------------QCQCDAGFQNVFPPPSETGEKCVDVNEC-HTSGSAACGPGAYCVNTVGSYNCL----CLAGYIGNGTV--CLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSDFHGFGMRQCNLGSSYKLSIHKISLVMNCQSILGMMLYK-------LSKCCVLGSSAYSNVFPPPSETGE----KCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGF 631          

HSP 4 Score: 167.162 bits (422), Expect = 1.667e-42
Identity = 168/553 (30.38%), Postives = 232/553 (41.95%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------------------ASPCAPSQQFDYSVGK--CMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYAC-----IQRAECPPGMFRSSMYSNCQDVDECET-GEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFE--WSDYPIKKCT-DINECLAANPCGKKHQCVNTVGSYKCK----CFQGYRL--------SISGDTCEDIDEC-LLEPRKCLNGI-CVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQN 2579
            +C D++EC   +   +    C NT GS++C C  GF+ +   +C D+DEC+      C     C N VGSY C    PC  G+  +     C+DVDEC      C     C N  GS +C+ D                      F+K    C D++EC  +    +  C     C N  GSY+C     C  G +   NG  C D+DEC      C  +  C NT  S+ C                       ++ C P      +VG   C+C  GY  N  ++C DVDEC      N C +   C N PGS+ C      Q    PP    S     C DV+EC T G   C    +CVN VGSY C+C  GYI  +   C DV+ECLL  P  +C    + C NT GS++CQC  GF+  +  + +++C    +  L+ +       C + +G    K    C  G           S +G+ C D++EC       C  G  CVN  G Y C C  G+  +   +C D+DEC      CS  S  +N
Sbjct:  114 VCLDVDECLLPSNNCSANSTCTNTPGSYQCQCDAGFQKTGE-MCTDVDECLKFGSAACGQGAYCVNTVGSYNC----PCLAGYIGNGTV--CLDVDECLLPSNNCSANSTCKNTPGSFQCQCDA--------------------GFQKTGEKCVDVNECQTSG---SAACGPGAYCVNTVGSYNC----PCLAGYI--GNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYIGN-GTVCLDVDECLLP--SNNCSANSTCKNTPGSFQCQCDAGFQNVFPPP----SETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGYI-GNGTVCLDVDECLL--PSNNC-SANSTCKNTPGSFQCQCDAGFQSDFHGFGMRQCNLGSSYKLSIHKISLVMNCQSILGMMLYKLSKCCVLGSSAYSNVFPPPSETGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIGNGT-VCLDVDECLLPSNNCSANSTCKN 618          

HSP 5 Score: 145.976 bits (367), Expect = 8.046e-36
Identity = 151/460 (32.83%), Postives = 198/460 (43.04%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFK------HSKLGICED-----IDECMNVNICSDDKKCKNNVGSYK---------CIRSIPCGFGWKE---DPDTNDCVDVDECE-AFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQM-KFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECET-GEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGY 2366
            +C D++EC   +   +    C NT GSF+C C  GF+       S LG+        I+  + + +  D       +G  K         C   I   +G K          CVDV+EC+ +    CGPG  CVN  GS+ C                   C  G Y    T  C D+DEC +     +  C     C N PGS+ C    +C  G    + G  C D++EC       C P   CVNT  SY+C                   C  GY  N  ++C DVDEC      N C +   C N PGS+ C    +C  G  ++     C DV+EC+T G   C    +CVN VGSY C+C  GYI  +   C DV+ECLL  P  +C    + C NT GS++CQC  GF+ +      C DINEC      CG    C NTVGSY+C C  GY
Sbjct:  596 VCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQIQSSIHKSILGMMVSVVYIYIEFILQLFLARDYPNYSYELGKNKNTAHQKNPTCPLLIFHFYGLKFIWISETGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCP------------------CLAG-YIGNGTL-CLDVDECLLP----SNNCSANSTCKNTPGSFQC----QCDAG--FQKTGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNC------------------PCLAGYIGN-GTLCLDVDECLLP--SNNCSANSTCKNTPGSFQC----QCDAGFQKTG--EKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYI-GNGTVCLDVDECLL--PSNNC-SANSTCKNTPGSFQCQCDAGFQSN---ATVCEDINECGRVPAVCGLGTVCENTVGSYRCPCAPGY 991          

HSP 6 Score: 138.658 bits (348), Expect = 1.502e-33
Identity = 115/337 (34.12%), Postives = 151/337 (44.81%), Query Frame = 3
Query: 1491 FYFKKET-RSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGF 2492
            F +  ET   C D++EC  +    +  C     C N  GSY+C     C  G +   NG  C D+DEC      C  +  C NT  S+                  +C C  G+++  +  C DV+EC    G   CG    C+N  GSY C     C  G   +     C DVDEC      C  N  C N  GS++C CD G+  T    C DVNEC  F      P   A CVNT GSY C C  G+  +      C D++ECL  +N C     C NT GS++C+C  G++ + +   CEDI+EC   P  C L  +C N  G Y C C PG+
Sbjct:  698 FIWISETGEKCVDVNECQTSG---SAACGPGAYCVNTVGSYNC----PCLAGYI--GNGTLCLDVDECLLPSNNCSANSTCKNTPGSF------------------QCQCDAGFQKTGEK-CVDVNEC-HTSGSAACGPGAYCVNTVGSYNC----PCLAGYIGNGTL--CLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK-CVDVNECQTFGSAACGPG--AYCVNTVGSYNCLCLAGYIGNG---TVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSNAT--VCEDINECGRVPAVCGLGTVCENTVGSYRCPCAPGY 991          

HSP 7 Score: 137.502 bits (345), Expect = 3.495e-33
Identity = 175/615 (28.46%), Postives = 242/615 (39.35%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKH-----SKLG-ICEDIDECMNVN--ICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSR-CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQM-KFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYAC-------IQRA--ECPPGMFRSSMYSNCQDVDEC-----------ETGEGKCP---QNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSY-----------------------------------------KCQCPKGFEWSDYPIKKCTDINECLAAN--PCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECST-SEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFIC 2678
            +C D++EC   +   +    C NT GSF+C C  GF++     S+ G  C D++EC       C     C N VGSY C+    C  G+  +     C+DVDEC      C     C N  GS +C   +C    + +  G   R C  G  +K        +  C   +G      K +  C     +Y  +           ++ G  C D++EC+      C P   CVNT  SY+                  C+C  GY  N  ++C DVDEC      N C +   C N PGS+ C       IQ +  +   GM  S +Y   + + +            E G+ K     +N  C  ++  +  +    +I  +   C DVNEC         P   A CVNT GSY                                         +CQC  GF+ +    +KC D+NEC  +    CG    CVNTVGSY C C  GY    +G  C D+DECLL    C  N  C N PG ++C+C  GF     E C D++EC T     C        G  C+N +G Y C+   C  GY     GNG +C
Sbjct:  363 VCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCL----CLAGYIGNGTV--CLDVDECLLPSNNCSANSTCKNTPGSFQC---QCDAGFQSDFHGFGMRQCNLGSSYKLSIHKISLVMNCQSILGMM--LYKLSKCCVLGSSAYSNVFPPP-------SETGEKCVDVNECQTFGSAACGPGAYCVNTVGSYN------------------CLCLAGYIGN-GTVCLDVDECLLP--SNNCSANSTCKNTPGSFQCQCDAGFQIQSSIHKSILGMMVSVVYIYIEFILQLFLARDYPNYSYELGKNKNTAHQKNPTCPLLIFHFYGL-KFIWISETGEKCVDVNECQTSGSAACGPG--AYCVNTVGSYNCPCLAGYIGNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTG---EKCVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGYIG--NGTLCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGF-QKTGEKCVDVNECQTFGSAACGP------GAYCVNTVGSYNCL---CLAGY----IGNGTVC 916          

HSP 8 Score: 131.724 bits (330), Expect = 2.105e-31
Identity = 111/342 (32.46%), Postives = 148/342 (43.27%), Query Frame = 3
Query: 1914 CINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT---------------------------------------------SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL--AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRT 2795
            C +  GS+ C     C  G    S    CQDVDEC++G   C Q   C N+ G+Y C+C+ GY L                                              +   C DV+ECLL  P  +C    + C NT GSY+CQC  GF+ +    + CTD++ECL   +  CG+   CVNTVGSY C C  GY    +G  C D+DECLL    C  N  C N PG ++C+C  GF     E C D++EC T     S  +    G  C+N +G Y C    C  GY     GNG +C    E +   N  +C      K +    +   D  F++T
Sbjct:    4 CTDTIGSFKC----GCVAGYAAVSDSRTCQDVDECQSGIYNCTQYSTCHNLDGNYTCICNSGYYLNEFPMQRTCIDVDECEKAGSALCGHGAYCANTLGSYACRCLVGYVGNGTVCLDVDECLL--PSNNC-SANSTCTNTPGSYQCQCDAGFQKTG---EMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGF-QKTGEKCVDVNECQT-----SGSAACGPGAYCVNTVGSYNC---PCLAGY----IGNGTVCLDVDECLLPSN--NCSANSTCKNTPGSFQCQCDAGFQKT 318          

HSP 9 Score: 130.183 bits (326), Expect = 7.261e-31
Identity = 119/350 (34.00%), Postives = 162/350 (46.29%), Query Frame = 3
Query: 1065 EICGDINECETANACA-NKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECE-AFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQM-KFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY 2102
            E C D+NEC+T+ + A      CVNTVGS+ C C  G+  +   +C D+DEC +  N CS +  CKN  GS++C     C  G+++  +   CVDV+EC  +    CGPG  CVN  GS+ C                   C  G Y    T  C D+DEC +     +  C     C N PGS+ C    +C  G    + G  C D++EC+      C P   CVNT  SY+                  C+C  GY  N  ++C DVDEC      N C +   C N PGS+ C    +C  G F+S+  + C+D++EC      C     C N VGSY+C C  GY
Sbjct:  706 EKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGT-LCLDVDECLLPSNNCSANSTCKNTPGSFQC----QCDAGFQKTGE--KCVDVNECHTSGSAACGPGAYCVNTVGSYNCP------------------CLAG-YIGNGTL-CLDVDECLLP----SNNCSANSTCKNTPGSFQC----QCDAG--FQKTGEKCVDVNECQTFGSAACGPGAYCVNTVGSYN------------------CLCLAGYIGN-GTVCLDVDECLLP--SNNCSANSTCKNTPGSFQC----QCDAG-FQSNA-TVCEDINECGRVPAVCGLGTVCENTVGSYRCPCAPGY 991          

HSP 10 Score: 107.842 bits (268), Expect = 5.674e-24
Identity = 85/246 (34.55%), Postives = 115/246 (46.75%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACA-NKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAF-PEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAP 1778
            F +  E C D+NEC T+ + A      CVNTVGS+ C C  G+  +   +C D+DEC +  N CS +  CKN  GS++C     C  G+++  +   CVDV+EC+ F    CGPG  CVN  GS+ C                   C  G+        C D+DEC +     +  C     C N PGS+ C    +C  G     N   C DI+EC ++   C    +C NT  SY C   PCAP
Sbjct:  784 FQKTGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGT-LCLDVDECLLPSNNCSANSTCKNTPGSFQC----QCDAGFQKTGE--KCVDVNECQTFGSAACGPGAYCVNTVGSYNC------------------LCLAGYIGNGTV--CLDVDECLLP----SNNCSANSTCKNTPGSFQC----QCDAG--FQSNATVCEDINECGRVPAVCGLGTVCENTVGSYRC---PCAP 989          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010139.1 (pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 gene:ENSPMAG00000009155.1 transcript:ENSPMAT00000010139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 9.137e-49
Identity = 173/487 (35.52%), Postives = 228/487 (46.82%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETA-NACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT-SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC--QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL-NGICVNVPGRYECKC 2480
            G+ +N+ L  C DI+EC T    CAN    C N +GSFRC C+ GF     G  C+DI+EC+ VN C   + C N  GSY+C     C  G   +     C DV+EC   P  C P  KCVN  GS+ C                  RC  GF  +     C D+DEC       +G      +C N  GSY C P   C  G  L  NG AC DIDEC Q    C   + CVNT  S+                  +C C+ GY  +     C D++EC     +++C     C+N  GS+ C+    C  G   S+    C+DVDEC  G+ +CP    CVN  GS+ C C+ G  L    +TC D++EC  F   +S      RC NT GSY+C   C +G+  S     +C DI+ECL    CG+   C NT GS++C C QGY     G  C D++EC +    C  + +C NV G + C C
Sbjct:  733 GYQYNEQLGRCDDIDECSTVPRLCANGR--CENVIGSFRCICRPGFIFDDSGAECQDINECLKVNKCIGGR-CINLPGSYRCEF---CDAGHVMN-TRGQCEDVNECRN-PNTC-PTAKCVNTPGSYEC-----------------VRCPSGF--EGRNGHCIDVDECA------DGNVCSNGICANTEGSYSCTP---CGTGFRLTSNGKACEDIDEC-QNGIVCGGGD-CVNTRGSF------------------QCECQPGYHLSSGGDQCEDINECLS---ESVCEPHGDCLNTDGSFYCV----CHHGYKSSANGRFCKDVDECSEGQ-QCPGG-QCVNTEGSFTCECEPGLRLNPGTHTCVDIDECAEF---DSSRCGSWRCENTHGSYRCVQACDRGYRLSS--TAECQDIDECLDDTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECIDVNECEMFSSVCGDDALCENVEGSFLCIC 1148          

HSP 2 Score: 188.348 bits (477), Expect = 9.625e-49
Identity = 155/446 (34.75%), Postives = 213/446 (47.76%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD-CQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM--CDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGF-EWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQ 2360
            GF+F+     C DINEC   N C      C+N  GS+RC+ C  G   +  G CED++EC N N C    KC N  GSY+C+R  P GF  +       C+DVDEC A   +C  G+ C N  GS+                  C+ C  GF      ++CEDIDEC   +    G       C N  GS+ C    +C+PG  L+  G  C DI+EC      CEP   C+NT  S++CV                  C  GY+ + +   C DVDEC+E  G    G    C+N  GS+ C    EC PG+  +     C D+DEC   +     +  C N  GSY+C+  CDRGY L+S   C D++ECL    +++       C NT GS++C C +G+ +  D   ++C D+NEC + ++ CG    C N  GS+ C C Q
Sbjct:  775 GFIFDDSGAECQDINECLKVNKCIGGR--CINLPGSYRCEFCDAGHVMNTRGQCEDVNECRNPNTCP-TAKCVNTPGSYECVR-CPSGFEGR----NGHCIDVDEC-ADGNVCSNGI-CANTEGSYS-----------------CTPCGTGFRLTSNGKACEDIDECQNGIVCGGGD------CVNTRGSFQC----ECQPGYHLSSGGDQCEDINECLSESV-CEPHGDCLNTDGSFYCV------------------CHHGYKSSANGRFCKDVDECSE--GQQCPGGQ--CVNTEGSFTC----ECEPGLRLNPGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRCVQACDRGYRLSSTAECQDIDECL----DDTVCGRNGFCENTEGSFRCLCDQGYHDLQDG--QECIDVNECEMFSSVCGDDALCENVEGSFLCICQQ 1150          

HSP 3 Score: 172.94 bits (437), Expect = 5.915e-44
Identity = 152/445 (34.16%), Postives = 208/445 (46.74%), Query Frame = 3
Query: 1341 DVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDEC-TMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM-CDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAAD-RKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG 2663
            + D C   P ICGPG +C N+   + C                   C  G+ + ++   C+DIDEC T+     NGRC+      N+ GS+ CI    CRPG +   +G  C DI+EC ++  +C     C+N   SY C                   C  G+  N    C DV+EC      N C +   C+N PGSY C++   CP G        +C DVDEC   +G    N  C N  GSY C  C  G+ LTSN   C D++EC     +         CVNT GS++C+C  G+  S     +C DINECL+ + C     C+NT GS+ C C  GY+ S +G  C+D+DEC  E ++C  G CVN  G + C+C PG   +     C DIDEC+  +   SR   ++    C N  G Y+CV  +C  GY    T 
Sbjct:  703 ESDICLLRPNICGPG-QCYNLDVGYTCT------------------CHFGYQYNEQLGRCDDIDECSTVPRLCANGRCE------NVIGSFRCI----CRPGFIFDDSGAECQDINECLKVN-KCIGGR-CINLPGSYRCE-----------------FCDAGHVMNTRGQCEDVNECRN---PNTCPTAK-CVNTPGSYECVR---CPSGF--EGRNGHCIDVDEC--ADGNVCSNGICANTEGSYSCTPCGTGFRLTSNGKACEDIDEC-----QNGIVCGGGDCVNTRGSFQCECQPGYHLSSGG-DQCEDINECLSESVCEPHGDCLNTDGSFYCVCHHGYKSSANGRFCKDVDEC-SEGQQCPGGQCVNTEGSFTCECEPGLRLNPGTHTCVDIDECAEFDS--SRCGSWR----CENTHGSYRCVQ-ACDRGYRLSSTA 1074          

HSP 4 Score: 72.4034 bits (176), Expect = 5.216e-13
Identity = 127/498 (25.50%), Postives = 180/498 (36.14%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKE-DPDTNDCVDVDECEAFPEICGPGMK-------------CVNIRGSH----------------RCEDDECPINMKRNNKGICSRCK-----DGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGY--RQNQDSICTDVDECAEN-GGDNLCGSLYICINHPGSYACIQRAE--------CP------------------PGM--------------------------FRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYIL-TSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYP 2255
            G+  +   E C DI+EC     C      C NT GSFRC C +G+   + G  C D++EC M  ++C DD  C+N  GS+ CI    C    KE D  +  CVD     +  +   PG++             C N+   +                 CE   CP+      K +C   K     +   +    +  +D DEC +    +     +   C N    Y C     C+ G    +  + C D+DEC   ++ CE    CVNT  S+ C    C P    D +  +C+   G   R  ++     +  C    G D +C  L +      +  C Q  E        CP                  P M                          F S ++ + + +   E G     +N  CV V   Y C C  GY L  S   C DVNEC     E       A+C+NT GSY+C C  GF  S  P
Sbjct: 1067 GYRLSSTAE-CQDIDECLDDTVCGRNG-FCENTEGSFRCLCDQGYHDLQDGQECIDVNECEMFSSVCGDDALCENVEGSFLCI----CQQHNKEFDTMSGKCVDR---HSIVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDTIPQDFKDADECIL----FGQEICKRGTCHNTEHGYKCF----CKSGFYYDRQKLECLDVDECTD-EWSCEGGS-CVNTDGSFDCF---CRPPLILDSNGKRCVNSSGLLERHEEEDAEMLMSMCWRAMGNDFMCSQLILGKETTYTECCCQYGEAWGPDCALCPERNTDDFAQLCNIPRGGDPDMRRVSGQRGTIVSDVSMHFVKHTEQITFSSGLFDSFEGLQAQECGILNGCENGRCVRVPEGYTCDCYDGYQLDLSRMVCTDVNECEELN-ERMSLCRNAKCMNTQGSYRCACLPGFVPSQQP 1541          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008854.1 (pep scaffold:Pmarinus_7.0:GL476328:1008604:1022137:1 gene:ENSPMAG00000008009.1 transcript:ENSPMAT00000008854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.415 bits (459), Expect = 9.196e-48
Identity = 187/591 (31.64%), Postives = 247/591 (41.79%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNI-CSDDKKCKNNVGSYKCIRSIPCGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD----------YPIKK-------------------------------CTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC-LLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFIC 2678
            GF  N     C D+NEC     C      CVNT GSF C C  GF  +    C+DI+EC+  N  CSD   C N  G Y C     C  G+  DP +   C D++EC      C     C N  GS  C                   C  G+     T++C DI+EC       N  C  +  C N+ GSY C     C  G  L    I C +I+EC  +   C P+ IC +   S+                   C C+ GY  N  ++C D++ECA N    +C  +  C N PGSY    R  CP G   ++  + C+DV+EC      C  N  C N  G Y C+C  G+   S   C D+NECL   P  +     A C+NTAG ++C CP  ++ +            P +K                               CTD++EC+   PC     C+NT GSY C+C  GY      +TC D++EC  +    C  N  CVN  G Y C+C PG+  D K  CQD+DEC    G C          LC N +G Y+C    C  GY      NG++C
Sbjct:   36 GFAKNPTTGECEDVNECLLPQQCQTSAH-CVNTFGSFTCACNAGFTGNGYN-CQDINECLTNNGNCSD--ICVNEQGGYHCA----CPVGYTLDPINHAACFDINECMVNKGNC--SQNCQNTEGSFAC------------------TCWSGYTMNTTTKTCVDINEC------LNNPCGSSGSCSNIDGSYIC----NCLRGYQLNSARI-CENINEC--LTSACGPNAICTDLIGSF------------------TCQCQPGYSSN-GTMCLDINECA-NTASPMC-PIGTCENLPGSY----RCHCPSGY--TAANNTCRDVNECLIIPSPCGSNSICQNTPGFYTCLCSSGFTSVS-GVCQDINECLA-NPCAA----PASCINTAGGFQCNCPLDYQLNGNICEAVNQCTVPGQKLCSENAVCISTLGTSAYTCQCKAGYTGNGTVCTDVDECVKK-PCPVNTVCLNTFGSYTCQCAAGYIY--LNNTCTDLNECSSVNLFSCPPNSKCVNAIGSYSCQCVPGY-QDVKGACQDVDECLRDNGGCQ--------HLCFNNVGSYRC---GCRPGYLSAGL-NGYMC 536          

HSP 2 Score: 169.859 bits (429), Expect = 5.190e-44
Identity = 165/504 (32.74%), Postives = 227/504 (45.04%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECL---LFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGY-RLSISGDTCEDIDECLLEP-RKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDEC 2534
            G+  N   + C DINEC   N C +    C N  GS+ C+C +G++ +   ICE+I+EC+  + C  +  C + +GS+ C     C  G+  +     C+D++EC        P   C N+ GS+RC                   C  G+     T  C D++EC +        C    +C N PG Y C+    C  G   + +G+ C DI+EC  +   C     C+NT   + C       +   DY            Q   +IC  V++C    G  LC    +CI+  G+ A     +C  G   +     C DVDEC   +  CP N  C+N  GSY C C  GYI   NNTC D+NEC    LF    SCP   ++CVN  GSY CQC  G++        C D++ECL  N  G +H C N VGSY+C C  GY    ++G  C DIDEC       C  N +C N  G ++C C P F  D   I  DI  C
Sbjct:  159 GYTMNTTTKTCVDINECLN-NPCGSSGS-CSNIDGSYICNCLRGYQLNSARICENINECL-TSACGPNAICTDLIGSFTC----QCQPGYSSNGTM--CLDINECANTASPMCPIGTCENLPGSYRC------------------HCPSGYTAANNT--CRDVNECLI----IPSPCGSNSICQNTPGFYTCL----CSSG-FTSVSGV-CQDINEC--LANPCAAPASCINTAGGFQC-------NCPLDY------------QLNGNICEAVNQCTV-PGQKLCSENAVCISTLGTSA--YTCQCKAGYTGNGTV--CTDVDECV--KKPCPVNTVCLNTFGSYTCQCAAGYIYL-NNTCTDLNECSSVNLF----SCPP-NSKCVNAIGSYSCQCVPGYQDVK---GACQDVDECLRDNG-GCQHLCFNNVGSYRCGCRPGYLSAGLNGYMCIDIDECQNPTLNNCNQNAVCTNTRGSFKCACKPYFKGDG--ITCDIGRC 583          

HSP 3 Score: 152.91 bits (385), Expect = 1.522e-38
Identity = 161/509 (31.63%), Postives = 215/509 (42.24%), Query Frame = 3
Query: 1296 CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVL-AQNGIACNDIDECKQMKFRCEPDEICVNTYSSY---------------------HCVASPCAPSQQFDYSVGK--CMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECE-TGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLF-RPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL--NGICVNVPGR--YECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNE 2732
            C  G+ ++P T +C DV+EC   P+ C     CVN  GS  C                   C  GF       +C+DI+EC  N    NG C  +D+C N  G Y C     C  G  L   N  AC DI+EC   K  C  +  C NT  S+                      C+ +PC  S       G   C C  GY+ N   IC +++EC  +     CG   IC +  GS+ C    +C PG   SS  + C D++EC  T    CP    C N+ GSY+C C  GY   +NNTC DVNECL+   P  S     + C NT G Y C C  GF         C DINECLA NPC     C+NT G ++C C   Y+L+  G+ CE +++C +  +K    N +C++  G   Y C+C  G+  +   +C D+DEC                            V   CPV      T   + C+  +  I   N    LNE
Sbjct:   33 CKPGFAKNPTTGECEDVNEC-LLPQQCQTSAHCVNTFGSFTCA------------------CNAGF--TGNGYNCQDINECLTN----NGNC--SDICVNEQGGYHC----ACPVGYTLDPINHAACFDINECMVNKGNCSQN--CQNTEGSFACTCWSGYTMNTTTKTCVDINECLNNPCGSSGSCSNIDGSYICNCLRGYQLNSARICENINECLTSA----CGPNAICTDLIGSFTC----QCQPGY--SSNGTMCLDINECANTASPMCPIGT-CENLPGSYRCHCPSGYT-AANNTCRDVNECLIIPSPCGS----NSICQNTPGFYTCLCSSGFTSVS---GVCQDINECLA-NPCAAPASCINTAGGFQCNCPLDYQLN--GNICEAVNQCTVPGQKLCSENAVCISTLGTSAYTCQCKAGYTGN-GTVCTDVDEC----------------------------VKKPCPVNTVCLNTFGSYTCQCAAGYIYLNNTCTDLNE 457          

HSP 4 Score: 136.732 bits (343), Expect = 2.533e-33
Identity = 143/470 (30.43%), Postives = 196/470 (41.70%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNN-------------KGICS----------------RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMK-FRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN-CQDVDECETGE-GKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARC-VNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLS 2375
            +C DINEC    +       C N  GS+RC C  G+  +    C D++EC+ + + C  +  C+N  G Y C+    C  G+        C D++EC A P  C     C+N  G  +C    CP++ + N              + +CS                +CK G+        C D+DEC          C    VC N  GSY C    +C  G +   N   C D++EC  +  F C P+  CVN   SY                   C C  GY Q+    C DVDEC  + G    G  ++C N+ GSY    R  C PG   + +    C D+DEC+      C QN  C N  GS+KC C + Y      TC D+  C    P  SC D  A C ++   S +C CP G+  +    KKC D+NECL    C     C++  G +KC C  GY  S
Sbjct:  247 MCLDINECANTASPMCPIGTCENLPGSYRCHCPSGYTAAN-NTCRDVNECLIIPSPCGSNSICQNTPGFYTCL----CSSGFTSVSGV--CQDINECLANP--CAAPASCINTAGGFQCN---CPLDYQLNGNICEAVNQCTVPGQKLCSENAVCISTLGTSAYTCQCKAGY--TGNGTVCTDVDECVKK------PCPVNTVCLNTFGSYTC----QCAAGYIYLNN--TCTDLNECSSVNLFSCPPNSKCVNAIGSY------------------SCQCVPGY-QDVKGACQDVDECLRDNG----GCQHLCFNNVGSY----RCGCRPGYLSAGLNGYMCIDIDECQNPTLNNCNQNAVCTNTRGSFKCAC-KPYFKGDGITC-DIGRCGY--PINSC-DPNAICDISNPQSPRCVCPSGWVGTG---KKCYDVNECLNPCTCPASTTCMDLDGGFKCICPPGYIFS 655          

HSP 5 Score: 125.561 bits (314), Expect = 8.569e-30
Identity = 88/252 (34.92%), Postives = 126/252 (50.00%), Query Frame = 3
Query: 1905 LYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
            +Y  +N+ G Y      +C PG  ++     C+DV+EC   + +C  + HCVN  GS+ C C+ G+     N C D+NECL      +C D+   CVN  G Y C CP G+         C DINEC+  N       C NT GS+ C C+ GY ++ +  TC DI+ECL  P    +G C N+ G Y C C  G+  +   IC++I+EC TS   C   +      +C +L+G + C    C  GY+   T
Sbjct:   20 VYNTLNNSGFYC-----QCKPGFAKNPTTGECEDVNECLLPQ-QCQTSAHCVNTFGSFTCACNAGFTGNGYN-CQDINECL--TNNGNCSDI---CVNEQGGYHCACPVGYTLDPINHAACFDINECMV-NKGNCSQNCQNTEGSFACTCWSGYTMNTTTKTCVDINECLNNPCG-SSGSCSNIDGSYICNCLRGYQLNSARICENINECLTS--ACGPNA------ICTDLIGSFTC---QCQPGYSSNGT 246          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000017.1 (pep scaffold:Pmarinus_7.0:GL477746:39241:65692:1 gene:ENSPMAG00000000015.1 transcript:ENSPMAT00000000017.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 3.026e-47
Identity = 191/620 (30.81%), Postives = 263/620 (42.42%), Query Frame = 3
Query: 1131 VNTVGSFRCDCQKGFKH-SKLGICEDIDECMN-VNICSDDKKCKNNVGSYKCI--------RSIPC----GFGWK--------EDPDTND-CVDVDECE-AFPEICGPGMKCVNIRGSHRC--------------EDDECPINMKRNNKGICSRCKD--GFY-------FKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCV----------------------ASPCAPSQQFDYSVGK--CMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLF-------------RPE----ESCPDLEA----------RCVNTAGSYKCQCPKGFEWSDYPI-------KKCTDINECL--AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFA--ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKET 2660
             +T+GSF+C C  G+   S    C+D+DEC + +  C+    C+N  G+Y CI         SIP      F +K        + P++ + C+DVDEC+ A   +CG G  C N  GS+ C              + DEC   +  NN    S C +  GFY       F+K    C D+DEC   + + +  C +   C N+ GSY+C     C  G +   NG  C D+DEC+     C  +  C NT  S+ C                       ++ C P      +VG   C C  GY  N  ++C DVDEC      N C +   C N PGS+ C    +C  G F+S+  + C+D+DEC      C     C N VGSY+C C  GY   +N+T  + +    F             RP     E C  +             C NTA          F +S+ P        + CTD++ECL   +  CG+   CVNTVGSY C C  GY    +G  C D+DECLL    C  N  C N PG Y+C+C  GF        +C D+DEC      CS  S       C N+ G ++C    C  G+    T
Sbjct:  435 TDTIGSFKCGCVAGYAVVSDSRTCQDVDECQSGIYNCTQYSTCRNLEGNYTCICNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGYVGNGTVCLDVDECL--LPSNNCSANSTCTNTPGFYQCQCDAGFQKTGEMCTDVDEC---LKFGSAVCGQGAYCVNMVGSYNC----PCLAGYI--GNGTVCLDVDECQLPSNNCSANSTCKNTPGSFQCQCDAGFQKTAEICVDVNECQTSGSAACGPGAYCVNTVGSYNCQCLAGYIGN-GTVCLDVDECLLP--SNNCSANSTCKNTPGSFQC----QCDAG-FQSNA-TVCEDIDECGRVPTVCGLGTVCENTVGSYRCPCAPGYQRNTNHTILETSFLYTFTNVPYHRASVIFGRPMTEAFECCTLIHYVEYNKVERCNVCSNTA-------ENAFSYSNLPPSHPPETGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIG--NGTVCLDVDECLLPSNNCSANSTCTNTPGSYQCQCDAGFQRYIGNGTVCLDVDECLLPSNNCSANS------TCKNMPGSFQC---QCDAGFQSNAT 1016          

HSP 2 Score: 178.718 bits (452), Expect = 4.831e-46
Identity = 167/541 (30.87%), Postives = 238/541 (43.99%), Query Frame = 3
Query: 1050 FNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECE-AFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGE-GKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQCVNTVGSYKCKCFQGYRLSI-SGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTK 2651
            F +  E+C D++EC +  +A   +   CVN VGS+ C C  G+  +   +C D+DEC +  N CS +  CKN  GS++C     C  G+++  +   CVDV+EC+ +    CGPG  CVN  GS+ C+                  C  G+        C D+DEC +     +  C     C N PGS+ C    +C  G     N   C DIDEC ++   C    +C NT  SY C   PCAP               GY++N +    +               LY   N P       RA    G   +  +  C  +   E  +  +C    +      SY  +    +   +   C DV+ECL F          A CVNT GSY C C  G+  +      C D++ECL  +N C     C NT GSY+C+C  G++  I +G  C D+DECLL    C  N  C N+PG ++C+C  GF ++   +C+DIDEC     VC        G +C N +G Y+C    C  GY +
Sbjct:  602 FQKTGEMCTDVDECLKFGSAVCGQGAYCVNMVGSYNCPCLAGYIGNGT-VCLDVDECQLPSNNCSANSTCKNTPGSFQC----QCDAGFQKTAEI--CVDVNECQTSGSAACGPGAYCVNTVGSYNCQ------------------CLAGYIGNGTV--CLDVDECLLP----SNNCSANSTCKNTPGSFQC----QCDAG--FQSNATVCEDIDECGRVPTVCGLGTVCENTVGSYRC---PCAP---------------GYQRNTNHTILETS------------FLYTFTNVP-----YHRASVIFGRPMTEAFECCTLIHYVEYNKVERCNVCSNTAENAFSYSNL-PPSHPPETGEMCTDVDECLKFGSAAC--GQGAYCVNTVGSYNCPCLAGYIGNG---TVCLDVDECLLPSNNCSANSTCTNTPGSYQCQCDAGFQRYIGNGTVCLDVDECLLPSNNCSANSTCKNMPGSFQCQCDAGFQSNAT-VCEDIDECGRVPTVCGL------GTVCENTVGSYRC---PCAPGYQR 1054          

HSP 3 Score: 159.458 bits (402), Expect = 5.831e-40
Identity = 182/643 (28.30%), Postives = 253/643 (39.35%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACN--------DIDECKQMKFRCEP--------DEICVNTYSSYHCVASPCAP----SQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHC----------------VNVVGSYKCMCDRGYILTSNN-TCADVNECL--LFRPEESCPDLEARCVNTAGSYKCQCPKGFEWS-DYPIK-----------------------KCTDINECLAANP--CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDEC-STSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRT 2795
            C DI+EC T N C +    C+NT GS+ C C  GF  +    C DI+EC  N  +C D ++C N +GSYKC   +P   G+  +     C DVDEC+         M C N  GS+ C                   CK G+ F    R C D DEC   V   N   + T +C N  GS+ C    +C+ G     +G+ C          + +C+     C          D   +  Y         C P    +Q     VG    RD    +   +C DVDEC                   G + C Q      G F  S ++    V+      G C +  H                  + +GS+KC C  GY + S++ TC DV+EC   ++   +      + C N  G+Y C C  G+E +   P +                        C D++EC  A    CG    C NT+GSY C+C  GY    +G  C D+DECLL    C  N  C N PG Y+C+C  GF     E+C D+DEC      VC +      G  C+N++G Y C    C  GY     GNG +C    E  C+    +C      K +    +   D  F++T
Sbjct:  129 CKDIDECMTGNHCNSNGSECMNTDGSYYCTCALGFTGNGT-YCADINECTANPYLCQDTEECMNGIGSYKC-ECLP---GYIRNGTI--CTDVDECKKSQPCDANTMVCSNTIGSYTC------------------LCKAGYQFDSTARICTDTDECV--VSSLNNCSRTTGLCQNFDGSFTC----QCKAG--YTGDGVTCTGKLCFHVVGVPQCRGAVILCNLAVGVVLLCDFTPIKLYKKKVFDVDECNPPENATQPCKGPVGDLYGRD----DAHCVCPDVDECIR-----------------GLHNCTQNCTNIEGGFTCSCFARFSSVN------GTCKRKFHLSTSFVHVAYVYTLWPSTDTIGSFKCGCVAGYAVVSDSRTCQDVDECQSGIYNCTQ-----YSTCRNLEGNYTCICNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGYVG--NGTVCLDVDECLLPSNNCSANSTCTNTPGFYQCQCDAGF-QKTGEMCTDVDECLKFGSAVCGQ------GAYCVNMVGSYNC---PCLAGY----IGNGTVCLDVDE--CQLPSNNCSANSTCKNTPGSFQCQCDAGFQKT 688          

HSP 4 Score: 132.88 bits (333), Expect = 9.722e-32
Identity = 121/346 (34.97%), Postives = 153/346 (44.22%), Query Frame = 3
Query: 1680 IDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-----QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP--CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC-LLEPRKCLNGICVNVPGRYECKCPPGFAADR-KEICQDIDECSTSE-GVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELK 2687
            IDEC      C  +  CVNT   Y                   C C  G+R N     Q+S C   DEC+      L  +   C N  GSY+CI    C  G   ++      D++EC +G+  CP N +C N +GSY C C  GY     N C D++EC+       C    + C+NT GSY C C  GF  +      C DINEC  ANP  C    +C+N +GSYKC+C  GY    +G  C D+DEC   +P      +C N  G Y C C  G+  D    IC D DEC  S    CSR +      LC N  G + C    C  GY    TG+G  C  K
Sbjct:    1 IDECALNSSLCVKNAHCVNTPGHY------------------DCSCNAGFRGNGFIDCQESTCLHEDECSVKNNPCLSVNNSFCNNSIGSYSCI----CTSGYNGTTC--EVTDINECISGQNNCPVNANCTNTIGSYTCACKLGYEGNGWN-CKDIDECMT---GNHCNSNGSECMNTDGSYYCTCALGFTGNG---TYCADINEC-TANPYLCQDTEECMNGIGSYKCECLPGYIR--NGTICTDVDECKKSQPCDANTMVCSNTIGSYTCLCKAGYQFDSTARICTDTDECVVSSLNNCSRTTG-----LCQNFDGSFTC---QCKAGY----TGDGVTCTGK 300          

HSP 5 Score: 126.331 bits (316), Expect = 1.208e-29
Identity = 174/666 (26.13%), Postives = 248/666 (37.24%), Query Frame = 3
Query: 1041 GFLFNQFLE----ICGDINECETAN--ACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMN-VNICSDDKKCKNNVGSYKCIRSIPC-GFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC---------------MCDRGYILTSNNTCADVNEC----------------LLFRPEESC--PDLE----------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKC--------------------------PPGFAADRKEICQDIDECS-TSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRT 2795
            GF  N F++     C   +EC   N    +     C N++GS+ C C  G+  +   +  DI+EC++  N C  +  C N +GSY C   +   G GW       +C D+DEC         G +C+N  GS+ C    C +    N          G Y       C DI+ECT N       C++T+ C N  GSY C    +C PG +  +NG  C D+DECK+ +       +C NT  SY                   C+C+ GY+ +  + ICTD DEC  +  +N   +  +C N  GS+ C    +C  G                 TG+G       C +VVG  +C               +CD   I        DV+EC                L  R +  C  PD++            C N  G + C C   F   +   K+   ++                +T+GS+KC C  GY +     TC+D+DEC      C     C N+ G Y C C                          PP    +  E C D+DEC      +C        G  C N LG Y C    C VGY     GNG +C    E +   N  +C        +  F +   D  F++T
Sbjct:   31 GFRGNGFIDCQESTCLHEDECSVKNNPCLSVNNSFCNNSIGSYSCICTSGYNGTTCEV-TDINECISGQNNCPVNANCTNTIGSYTCACKLGYEGNGW-------NCKDIDECMTGNHCNSNGSECMNTDGSYYCT---CALGFTGN----------GTY-------CADINECTANPYL----CQDTEECMNGIGSYKC----ECLPGYI--RNGTICTDVDECKKSQPCDANTMVCSNTIGSY------------------TCLCKAGYQFDSTARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTC----QCKAGY----------------TGDGVTCTGKLCFHVVGVPQCRGAVILCNLAVGVVLLCDFTPIKLYKKKVFDVDECNPPENATQPCKGPVGDLYGRDDAHCVCPDVDECIRGLHNCTQNCTNIEGGFTCSCFARFSSVNGTCKRKFHLSTSFVHVAYVYTLWPSTDTIGSFKCGCVAGYAVVSDSRTCQDVDECQSGIYNCTQYSTCRNLEGNYTCICNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGH------GAYCANTLGSYAC---RCLVGY----VGNGTVCLDVDECLLPSN--NCSANSTCTNTPGFYQCQCDAGFQKT 605          

HSP 6 Score: 113.62 bits (283), Expect = 9.786e-26
Identity = 103/328 (31.40%), Postives = 135/328 (41.16%), Query Frame = 3
Query: 1902 SLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-----ILT---------------------SNNTCADVNECL----------------------------------------LFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECL--AANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFIC 2678
            +L+   +  GS+ C     C  G    S    CQDVDEC++G   C Q   C N+ G+Y C+C+ GY     I T                     S  TC DV+EC                                            P  +C    + C NT G Y+CQC  GF+ +    + CTD++ECL   +  CG+   CVN VGSY C C  GY    +G  C D+DEC L    C  N  C N PG ++C+C  GF     EIC D++EC T     S  +    G  C+N +G Y C    C  GY     GNG +C
Sbjct:  430 TLWPSTDTIGSFKC----GCVAGYAVVSDSRTCQDVDECQSGIYNCTQYSTCRNLEGNYTCICNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGYVGNGTVCLDVDECLLPSNNC-SANSTCTNTPGFYQCQCDAGFQKTG---EMCTDVDECLKFGSAVCGQGAYCVNMVGSYNCPCLAGYIG--NGTVCLDVDECQLPSNNCSANSTCKNTPGSFQCQCDAGF-QKTAEICVDVNECQT-----SGSAACGPGAYCVNTVGSYNC---QCLAGY----IGNGTVC 734          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO27742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8E5])

HSP 1 Score: 225.328 bits (573), Expect = 1.285e-63
Identity = 200/558 (35.84%), Postives = 260/558 (46.59%), Query Frame = 3
Query: 1050 FNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGF--KHSK--------LGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCE-PDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPC--GKKHQCVNTVGSYKCKCFQGYRLSIS---GD------TCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            +    + C D+NEC ET   C+ +  IC NT GSF+C C+ G+  K SK        L  C+DIDEC +N++ C  ++ C NN GSY C     C  G+      N C D++EC      C     CVN  GS+ C                  RCK GF     T  C+DIDEC + V      C  +  C N  GSY C    +C+ G  L      C D++EC +  + C   + IC NT  S+ C   P   + +F  +VG             + C D DECA   G   C +   C+N+ GSY C     C  G   + +   C+D+DEC  G   CP +  CVN  GSY C C RG+ L  NNTC D++EC L     +CP   A CVN  GSY C+C +G+   +   K CTD+NEC        G+   C NT GS+KC C  GY    S   GD      +C+DIDEC L    C  N  CVN  G Y CKC PG+       C+DIDEC+     C   +D      C+N  G Y C    C  G+T
Sbjct:   41 YTLVNKTCTDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTC----KCKPGYTL--VNNTCEDINECALGVANCPASADCVNNNGSYTC------------------RCKPGFTLVNNT--CKDIDECALGV----ATCPASADCVNNDGSYTC----RCKRGYTLVNK--TCTDVNECTETPYICSGENSICENTDGSFKCSCKP-GYTPKFSKAVGD-------APANLTSCDDTDECAL--GVATCPASADCVNNDGSYTC----RCKRGY--TLVNKTCKDIDECALGVATCPASADCVNNNGSYTCRCKRGFTLV-NNTCKDIDECALGV--ATCP-ASADCVNNDGSYTCRCKRGYTLVN---KTCTDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTL-VNNTCEDIDECALGVANCPASAD------CVNNDGSYTC---RCKRGFT 529          

HSP 2 Score: 190.66 bits (483), Expect = 1.138e-51
Identity = 182/538 (33.83%), Postives = 226/538 (42.01%), Query Frame = 3
Query: 1200 EDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEIC-GPGMKCVNIRGSHRC-------------------------EDDECPINMK---------RNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLC-GSLYICINHPGSYACIQRAECPPGMFRS-----SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL--NGICVNVPGRYECKCPPGF----------AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
             DIDEC + V  C     C NN GSY C     C  G+     T  C DV+EC   P +C G    C N  GS +C                         + DEC +N+           N+     +CK G+     T  CEDI+EC + V      C  +  C N  GSY C    +C+PG  L  N   C DIDEC      C     CVN   SY                   C C+ GY    +  CTDV+EC E     +C G   IC N  GS+ C  +    P   ++     +  ++C D DEC  G   CP +  CVN  GSY C C RGY L  N TC D++EC L     +CP   A CVN  GSY C+C +GF   +     C DI+EC L    C     CVN  GSY C+C +GY L     TC D++EC   P  C   N IC N  G ++C C PG+          A      C DIDEC  +   C         R C+N  G Y C    C  GYT
Sbjct:    8 SDIDECALGVATCPASADCVNNDGSYTC----RCKRGYTLVNKT--CTDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNT--CEDINECALGV----ANCPASADCVNNNGSYTC----RCKPGFTLVNN--TCKDIDECALGVATCPASADCVNNDGSY------------------TCRCKRGYTL-VNKTCTDVNECTET--PYICSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDTDECALGVATCPASADCVNNDGSYTCRCKRGYTLV-NKTCKDIDECALGV--ATCP-ASADCVNNNGSYTCRCKRGFTLVN---NTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTL--VNKTCTDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECKLNISTCPAN------RYCVNNDGSYTC---KCKPGYT 488          

HSP 3 Score: 145.206 bits (365), Expect = 1.991e-36
Identity = 130/370 (35.14%), Postives = 160/370 (43.24%), Query Frame = 3
Query: 1677 DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLC-GSLYICINHPGSYACIQRAECPPGMFRS-----SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL--NGICVNVPGRYECKCPPGF----------AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLN 2729
            DIDEC      C     CVN   SY                   C C+ GY    +  CTDV+EC E     +C G   IC N  GS+ C  +    P   ++     +  ++C D+DEC+     CP N +CVN  GSY C C  GY L  NNTC D+NEC L     +CP   A CVN  GSY C+C  GF   +     C DI+EC L    C     CVN  GSY C+C +GY L     TC D++EC   P  C   N IC N  G ++C C PG+          A      C D DEC+     C   +D      C+N  G Y C    C  GYT        I E        P  ADC+N
Sbjct:    9 DIDECALGVATCPASADCVNNDGSY------------------TCRCKRGYTL-VNKTCTDVNECTET--PYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLV-NNTCEDINECALGV--ANCP-ASADCVNNNGSYTCRCKPGFTLVN---NTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTL--VNKTCTDVNECTETPYICSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDTDECALGVATCPASAD------CVNNDGSYTC---RCKRGYTLVNKTCKDIDECALGVATCPASADCVN 339          

HSP 4 Score: 142.895 bits (359), Expect = 1.244e-35
Identity = 128/372 (34.41%), Postives = 169/372 (45.43%), Query Frame = 3
Query: 1050 FNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGF--KHSK--------LGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCE-PDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTC 2126
            +    + C D+NEC ET   C+ +  IC NT GSF+C C+ G+  K SK        L  C+D DEC + V  C     C NN GSY C     C  G+     T  C D+DEC      C     CVN  GS+ C                  RCK GF     T  C+DIDEC + V      C  +  C N  GSY C    +C+ G  L      C D++EC +  + C   + IC NT  S+ C   P   + +F  +VG             + C D+DEC  N   + C +   C+N+ GSY C    +C PG   + + + C+D+DEC  G   CP +  CVN  GSY C C RG+ L  NNTC
Sbjct:  217 YTLVNKTCTDVNECTETPYICSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDTDECALGVATCPASADCVNNDGSYTC----RCKRGYTLVNKT--CKDIDECALGVATCPASADCVNNNGSYTC------------------RCKRGFTLVNNT--CKDIDECALGVA----TCPASADCVNNDGSYTC----RCKRGYTLVNK--TCTDVNECTETPYVCSGENSICENTDGSFKCSCKP-GYTPKFSKAVGD-------APANLTSCDDIDECKLN--ISTCPANRYCVNNDGSYTC----KCKPGY--TLVNNTCEDIDECALGVANCPASADCVNNDGSYTCRCKRGFTLV-NNTC 535          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO44417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN4])

HSP 1 Score: 221.476 bits (563), Expect = 4.270e-62
Identity = 191/634 (30.13%), Postives = 275/634 (43.38%), Query Frame = 3
Query: 1335 CVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM-----CDRGYILTSNNTCADVNECL--LFR--PEESCPDLEA--------------------------------RCVNTAGSYKCQCPKGFEWSDYPIKK-CTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGI------CVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLG-----HSESFINLYLTRYP 3077
            C+D++EC      CG G  C+N +GS+RC               IC R      +K E   C D+DEC   + +    C   +VC NLPG+Y C     C  G    + G  C DIDEC   + RC P   CVN   SY CV  P                    R+ +++ C D+DEC  NG  N+CGS   C+N  GSY C+Q + C PG       + C D+DEC  G   C  +  C NV GSY+C      C RGY   +     D++EC   + R   E+ C ++E                                  C NT GS+ C C +GF+    P K+ C DI+EC   NP   +H+C N  GSY+C C  GY L+    +C+DIDEC  +    +         C+N PG Y C CP G+       C DIDEC+ +  +C+R        +C N  GYY+C+   CP  Y KKE  NG  C+L  ++  E  D   + EK  +  Y F    S  K   +   F+ S    G     + ++Y   S   +        H +  R +   +E+  +  +    E +L     +++ E+ +G        S + ++++RYP
Sbjct:    8 CLDINECATGQVTCGDGQICLNTKGSYRC---------------ICKR-----GYKAEGPKCVDVDECATGIAF----CPPGNVCRNLPGTYICSSPNTCPAGK--EKRGSDCVDIDECATGQARCPPTTRCVNADGSYRCVPCPAG------------------RKLENNQCVDIDECV-NG--NICGSGSRCVNTEGSYKCVQMS-CGPGKTLQPG-TGCVDIDECTEGSYPCAADQTCQNVFGSYRCQASAIKCSRGYEPQNGRCVVDIDECASGIARCGREQFCENVEGAYRCVTCRTGYRFTNGRCVDRDECRIGVVCAHECTNTPGSFICSCRRGFKLE--PDKRSCRDIDECSLPNP-PCQHECRNRYGSYQCYCKDGYTLAADKRSCDDIDECRGQQYSSVGLYSPCQYQCLNSPGSYRCTCPAGYKLSGGRNCYDIDECTETPNICTRPDT-----VCRNAFGYYRCIPFVCPPKYYKKEGDNG--CKL-IDTCSEIPDCASIREKGLRF-YTF----SLRKGEESKKLFDYSLWTRGYQE-TVTIQYRFASGNEKG-------HFEIRRLNQNQVEIWTRITMTEEAEYVL-----QFYGEVIVGGKLESRYRSTLYVFVSRYP 563          

HSP 2 Score: 208.379 bits (529), Expect = 1.561e-57
Identity = 176/507 (34.71%), Postives = 235/507 (46.35%), Query Frame = 3
Query: 1068 ICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGR-CKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAA--------NPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCL--NGICVNVPGRYEC---KCPPGFAADRKE-ICQDIDECS 2537
            +C DINEC T        +IC+NT GS+RC C++G+K ++   C D+DEC   +  C     C+N  G+Y C     C  G  ++   +DCVD+DEC      C P  +CVN  GS+RC    CP   K  N                   C DIDEC       NG  C     C N  GSY C+ +  C PG  L Q G  C DIDEC +  + C  D+ C N + SY C AS    S+ ++   G+C+              D+DECA   G   CG    C N  G+Y C+    C  G   ++    C D DEC  G   C     C N  GS+ C C RG+ L  +  +C D++EC L  P       +  C N  GSY+C C  G+  +    + C DI+EC           +PC  ++QC+N+ GSY+C C  GY+LS  G  C DIDEC   P  C   + +C N  G Y C    CPP +     +  C+ ID CS
Sbjct:    7 VCLDINECATGQVTCGDGQICLNTKGSYRCICKRGYK-AEGPKCVDVDECATGIAFCPPGNVCRNLPGTYICSSPNTCPAG--KEKRGSDCVDIDECATGQARCPPTTRCVNADGSYRCV--PCPAGRKLENN-----------------QCVDIDECV------NGNICGSGSRCVNTEGSYKCV-QMSCGPGKTL-QPGTGCVDIDECTEGSYPCAADQTCQNVFGSYRCQASAIKCSRGYEPQNGRCV-------------VDIDECAS--GIARCGREQFCENVEGAYRCVT---CRTGYRFTN--GRCVDRDECRIGV-VCAH--ECTNTPGSFICSCRRGFKLEPDKRSCRDIDECSLPNPP-----CQHECRNRYGSYQCYCKDGYTLAA-DKRSCDDIDECRGQQYSSVGLYSPC--QYQCLNSPGSYRCTCPAGYKLS-GGRNCYDIDECTETPNICTRPDTVCRNAFGYYRCIPFVCPPKYYKKEGDNGCKLIDTCS 451          

HSP 3 Score: 72.0182 bits (175), Expect = 7.274e-13
Identity = 66/186 (35.48%), Postives = 86/186 (46.24%), Query Frame = 3
Query: 2112 SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCK----CFQGYRLSISGDTCEDIDECLLEPRKCLNGI-CVNVPGRYEC-KCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            +N  C D+NEC     + +C D +  C+NT GSY+C C +G++       KC D++EC      C   + C N  G+Y C     C  G      G  C DIDEC     +C     CVN  G Y C  CP G   +  + C DIDEC     +C       +G  C+N  G YKCV  SC  G T
Sbjct:    4 TNGVCLDINECAT--GQVTCGDGQI-CLNTKGSYRCICKRGYKAEG---PKCVDVDECATGIAFCPPGNVCRNLPGTYICSSPNTCPAG--KEKRGSDCVDIDECATGQARCPPTTRCVNADGSYRCVPCPAGRKLENNQ-CVDIDECVNGN-ICG------SGSRCVNTEGSYKCVQMSCGPGKT 173          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO29764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2Q1])

HSP 1 Score: 224.172 bits (570), Expect = 7.985e-62
Identity = 201/589 (34.13%), Postives = 262/589 (44.48%), Query Frame = 3
Query: 1050 FNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGF----------KHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCE-PDEICVNTYSSYHCVASPCAPSQQFDYSVG-----------------------------------KCMCRDGYRQNQDSICTDVDECAENGGDNLC-GSLYICINHPGSYACIQRAECPPGMFRS-----SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            +    + C D+NEC ET   C+ K  IC NT GSF+C C+ G+            + L  C+DIDEC +N++ C  ++ C NN GSY C     C  G+      N C D+DEC      C     CVN  GS+ C                  RCK G+     T  C+DIDEC + V      C  +  C N  GSY C    +C+ G  L      C D++EC +  + C   + IC NT  S+ C   P   + +F  +VG                                    C C+ GY    +  CTDV+EC E     +C G   IC N  GS+ C  +    P   ++     +  ++C D+DEC+     CP N +CVN  GSY C C  GY L  NNTC D++EC L     +CP   A CVN  GSY C+C +GF   +     C DI+EC L    C     CVN  GSY C+C +GY L     TC DIDEC L    C  N  CVN  G Y CKC PG+       C+DIDEC+     C   +D      C+N  G Y C    C  G+T
Sbjct:  176 YTLVNKTCTDVNECTETPYVCSGKNSICENTNGSFKCSCKPGYTPKFSEAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTC----KCKPGYTHV--NNTCEDIDECAHGVANCPASADCVNNDGSYTC------------------RCKRGYTLVNNT--CKDIDECALGVAT----CPASADCVNNDGSYTC----RCKRGYTLVNK--TCTDVNECTETPYVCSGENSICENTDGSFKCSCKP-GYTPKFSKAVGDAPANLTSCDDIDECALGVATCPASADCVNNDGSYTCRCKRGYTL-VNKTCTDVNECTET--PYVCSGENSICENTDGSFKCYCKPGYTPKFSKAVNDALANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLV-NNTCEDIDECALGV--ANCP-ASADCVNNDGSYTCRCKRGFTLVN---NTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTLV--NKTCTDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTL-VNNTCEDIDECALGVANCPASAD------CVNNDGSYTC---RCKPGFT 705          

HSP 2 Score: 204.142 bits (518), Expect = 5.142e-55
Identity = 190/548 (34.67%), Postives = 253/548 (46.17%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNV-NICS-DDKKCKNNVGSYKCIRSIPCGFGWKEDPDTND-------CVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCE-PDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPC--GKKHQCVNTVGSYKCKCFQGYRLSIS---GD------TCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKK 2654
            DI+EC    A       CVN  GS+ C C++G+       C D++EC     +CS ++  C+N  GS+KC  S   G+  K      D       C D+DEC      C     CVN  GS+ C                  RCK G+     T  C DIDEC + V      C     C N  GSY C    +C+ G  L      C D++EC +  + C   + IC NT  S+ C   P   + +F  +VG             + C D+DEC  N   + C +   C+N+ GSY C    +C PG   + + + C+D+DEC  G   CP +  CVN  GSY C C RGY L  NNTC D++EC L     +CP   A CVN  GSY C+C +G+   +   K CTD+NEC        G+   C NT GS+KC C  GY    S   GD      +C+DIDEC L    C  +  CVN  G Y C+C  G+    K  C D++EC+ +  VCS E+      +C N  G +KC    C  GYT K
Sbjct:    9 DIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNK-TCTDVNECTETPYVCSGENSICENTDGSFKC--SCKPGYTPKFSKAVGDAPANLTSCDDIDECAHGVANCPASADCVNNDGSYTC------------------RCKPGYTLVNNT--CIDIDECALGVAT----CPARADCVNNDGSYTC----RCKRGYTLVNK--TCTDVNECTETPYVCSGKNSICENTNGSFKCSCKP-GYTPKFSEAVGD-------APANLTSCDDIDECKLN--ISTCPANRYCVNNDGSYTC----KCKPGY--THVNNTCEDIDECAHGVANCPASADCVNNDGSYTCRCKRGYTLV-NNTCKDIDECALGV--ATCP-ASADCVNNDGSYTCRCKRGYTLVN---KTCTDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNK-TCTDVNECTETPYVCSGEN-----SICENTDGSFKCY---CKPGYTPK 491          

HSP 3 Score: 202.216 bits (513), Expect = 2.218e-54
Identity = 200/579 (34.54%), Postives = 244/579 (42.14%), Query Frame = 3
Query: 1062 LEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEIC-GPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFK---------KETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC--------VASPCAPSQQFDYSVG---------------KCMCRDGYRQNQDSICTDVDECAENGGDNLC-GSLYICINHPGSYACIQRAECPPGMFRS-----SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGF--EWSDYP------IKKCTDINEC-LAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYT 2648
            L  C DI+EC    A       CVN  GS+ C C+ G+       C DIDEC + V  C     C NN GSY C     C  G+     T  C DV+EC   P +C G    C N  GS +C                   CK G+  K             SC+DIDEC +N+      C     C N  GSY C    KC+PG     N   C DIDEC      C     CVN   SY C        V + C    +    V                 C C+ GY    +  CTDV+EC E     +C G   IC N  GS+ C  +    P   ++     +  ++C D+DEC  G   CP +  CVN  GSY C C RGY L  N TC DVNEC        C    + C NT GS+KC C  G+  ++S         +  C DI+EC L  + C     CVN  GSY CKC  GY L    +TCEDIDEC L    C  +  CVN  G Y C+C  GF       C+DIDEC+     C   +D      C+N  G Y C    C  GYT
Sbjct:   98 LTSCDDIDECAHGVANCPASADCVNNDGSYTCRCKPGYTLVN-NTCIDIDECALGVATCPARADCVNNDGSYTC----RCKRGYTLVNKT--CTDVNECTETPYVCSGKNSICENTNGSFKCS------------------CKPGYTPKFSEAVGDAPANLTSCDDIDECKLNIST----CPANRYCVNNDGSYTC----KCKPGYTHVNN--TCEDIDECAHGVANCPASADCVNNDGSYTCRCKRGYTLVNNTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTL-VNKTCTDVNECTET--PYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECALGVATCPASADCVNNDGSYTCRCKRGYTLV-NKTCTDVNECT--ETPYVCSGENSICENTDGSFKCYCKPGYTPKFSKAVNDALANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTL--VNNTCEDIDECALGVANCPASADCVNNDGSYTCRCKRGFTL-VNNTCKDIDECALGVATCPASAD------CVNNDGSYTC---RCKRGYT 623          

HSP 4 Score: 148.673 bits (374), Expect = 8.204e-37
Identity = 135/369 (36.59%), Postives = 165/369 (44.72%), Query Frame = 3
Query: 1677 DIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLC-GSLYICINHPGSYACIQRAECPPGMFRS-----SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPC--GKKHQCVNTVGSYKCKCFQGYRLSIS---GD------TCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLN 2729
            DIDEC      C     CVN   SY                   C C+ GY    +  CTDV+EC E     +C G   IC N  GS+ C  +    P   ++     +  ++C D+DEC  G   CP +  CVN  GSY C C  GY L  NNTC D++EC L     +CP   A CVN  GSY C+C +G+   +   K CTD+NEC        GK   C NT GS+KC C  GY    S   GD      +C+DIDEC L    C  N  CVN  G Y CKC PG+       C+DIDEC+     C   +D      C+N  G Y C    C  GYT        I E        P  ADC+N
Sbjct:    9 DIDECALGVATCPASADCVNNDGSY------------------TCRCKRGYTL-VNKTCTDVNECTET--PYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECAHGVANCPASADCVNNDGSYTCRCKPGYTLV-NNTCIDIDECALGV--ATCP-ARADCVNNDGSYTCRCKRGYTLVN---KTCTDVNECTETPYVCSGKNSICENTNGSFKCSCKPGYTPKFSEAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGY-THVNNTCEDIDECAHGVANCPASAD------CVNNDGSYTC---RCKRGYTLVNNTCKDIDECALGVATCPASADCVN 339          

HSP 5 Score: 138.658 bits (348), Expect = 1.118e-33
Identity = 135/401 (33.67%), Postives = 171/401 (42.64%), Query Frame = 3
Query: 1050 FNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGF--KHSK--------LGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEIC-GPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFY--FKKETR-------SCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC--------VASPCAPSQQFDYSVGKC---------------MCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN 2117
            +    + C D+NEC ET   C+ +  IC NT GSF+C C+ G+  K SK        L  C+DIDEC + V  C     C NN GSY C     C  G+     T  C DV+EC   P +C G    C N  GS +C                   CK G+   F K          SC+DIDEC +N+      C     C N  GSY C    KC+PG  L  N   C DIDEC      C     CVN   SY C        V + C    +    V  C                C+ GY    +  CTD+DEC  N   + C +   C+N+ GSY C    +C PG   + + + C+D+DEC  G   CP +  CVN  GSY C C  G+ L  N
Sbjct:  352 YTLVNKTCTDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECALGVATCPASADCVNNDGSYTC----RCKRGYTLVNKT--CTDVNECTETPYVCSGENSICENTDGSFKC------------------YCKPGYTPKFSKAVNDALANLTSCDDIDECKLNIST----CPANRYCVNNDGSYTC----KCKPGYTLVNN--TCEDIDECALGVANCPASADCVNNDGSYTCRCKRGFTLVNNTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTL-VNKTCTDIDECKLN--ISTCPANRYCVNNDGSYTC----KCKPGY--TLVNNTCEDIDECALGVANCPASADCVNNDGSYTCRCKPGFTLVYN 709          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO33295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL3])

HSP 1 Score: 223.016 bits (567), Expect = 3.149e-61
Identity = 214/712 (30.06%), Postives = 308/712 (43.26%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCDCQKGFK-HSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPD----------------TND----CVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPD-------EICVNTYSSYHCV-----ASPCAPSQQFDYSVG--------------KCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGY-ILTSNNTCADVNECLLFRPEESCPDL-EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAAN-PCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGF-AADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGF-ICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMP--MGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMK-----------KMINPPVEILLYLDVKKY 3014
            +I+EC    AC++   IC N  G+FRC C+ GF        CED+DEC +    C D ++C N  G+Y+C    PCG G+ +  D                 ND    C+D+DEC+ FP  C     C N  G+ RC                   C+ GFY   + R+CED+DEC++     + +C +   C N PG+Y C  +  C  G   A +G AC D+DEC +  FR  P          C NT  SY C      A         D  VG              +C C  GY       C D+DEC  N   ++CG    C N  G Y C+    C  G F+ ++   C DV+EC  G   C     C+N  GS+ C C RG+   T    C DVNEC+ F      P L + +C NT GS+KC CP G       +  C  I+ C+  N  C ++  C  +   Y C+C +GYRL+I   +C DIDEC           C+N  G Y+CKCPPG+  +     C D DEC+ S+GVC R+        C N  G Y+CV +SCP  Y   + G GF +     +  C P            + Y    +   +   + + R  + H+P  + +  I    +Y+ +++T+     +N          P ++  + +            M+    E  +Y+DV +Y
Sbjct:   98 NIDECLFPGACSH---ICQNGYGTFRCICRPGFYLLDDERTCEDLDECSLPSTKCPDGQRCVNTPGNYRC--ESPCGAGYSKAADGACVGPQPTECPQGLMKNDKGTYCIDIDECQ-FPGAC--SHICQNGYGTFRC------------------ICRPGFYLLDDERTCEDLDECSLP----STKCPDGQRCVNTPGNYRC--ESPCGAGYSKAADG-ACVDVDECAE--FRSRPSRGTHPCTHSCQNTLGSYSCTCDKGFALKDGKCLDIDECVGVVCNHGCRNTDGSYECYCFSGYELIAGGQCRDIDECRVNA--SVCGPKQ-CANTMGGYKCLD--SCSLG-FKRTLEGACVDVNECVEGGHDCKFTHFCMNTHGSFYCTCPRGFKSKTPGGPCQDVNECVDF------PGLCQYKCQNTRGSFKCLCPPGGYLKADGL-SCGGIDGCVLNNLKCDQR--CGFSEQGYSCECVKGYRLAIDRQSCVDIDECSSNQTNSCQYQCINTEGGYQCKCPPGYRTSPDGRTCMDDDECAGSDGVCQRDEQ------CFNTKGSYRCVQTSCPANY--NQLGPGFCVTPCSLQGYCTPQ----------ALRYYTTTLPYGVPANQDLLRL-IPHIPPHLLAQPIICDFRYSFSASTSPFGIRRNGIEAIVFSARPLDMIGMHELRVTANIHYRNGMLACRTEFKVYIDVSRY 740          

HSP 2 Score: 122.094 bits (305), Expect = 2.210e-28
Identity = 110/341 (32.26%), Postives = 148/341 (43.40%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQD-SICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM 2087
            C DI+EC     C +    C NT GS+ C C  G++    G C DIDEC +N ++C   K+C N +G YKC+ S  C  G+K   +   CVDV+EC      C     C+N  GS  C                   C  GF  K     C+D++EC    G    +C+ T       GS+ C+    C PG  L  +G++C  ID C     +C  D+ C  +   Y                   C C  GYR   D   C D+DEC+ N  ++     Y CIN  G Y C    +CPPG   S     C D DEC   +G C ++  C N  GSY+C+
Sbjct:  331 CLDIDEC-VGVVCNHG---CRNTDGSYECYCFSGYELIAGGQCRDIDECRVNASVCGP-KQCANTMGGYKCLDS--CSLGFKRTLE-GACVDVNECVEGGHDCKFTHFCMNTHGSFYCT------------------CPRGFKSKTPGGPCQDVNECVDFPGLCQYKCQNTR------GSFKCL----CPPGGYLKADGLSCGGIDGCVLNNLKC--DQRCGFSEQGY------------------SCECVKGYRLAIDRQSCVDIDECSSNQTNSC---QYQCINTEGGYQC----KCPPGYRTSPDGRTCMDDDECAGSDGVCQRDEQCFNTKGSYRCV 608          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO44398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVK5])

HSP 1 Score: 225.713 bits (574), Expect = 6.523e-61
Identity = 185/533 (34.71%), Postives = 247/533 (46.34%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDT-NDCVDVDEC-EAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI-ACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSN---CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            C D+NEC    +  +    CVNT GS+ C C +GF  S  G  C D++ECM   +   D+KC N  GSY+C     C  G+++  D    C+D+DEC E  P+      KC N  GS+ C                   C  G+        C+DIDEC  N    NG C +  +C N  GSY C    KC PG      G   C DIDEC     + + D  C NT  S+                  KC C  GY    D + C D+DECA + G    G    C+N PG+++C     C  G   +    +   C D+DEC +G  +C +   CVN  G+Y C+C +GY  +  N C D++EC     +  C   E  CVNT GSY C CP G++ +D   + C D++EC A + C +   C+NT GSY C+C  G+ L     TC D+DEC L    C N  CVN  G Y C C  G+    +  C DIDEC+   G C         ++C N  G Y C   SC  G+
Sbjct:  357 CIDVNECLLPKSFHHCDHSCVNTPGSYYCTCNEGFVLSANGRRCRDVNECMMGGV-KCDQKCVNTPGSYRC----ECYRGFRQSDDVLKKCIDIDECLEGLPDC----HKCTNTAGSYYCT------------------CDTGYKQVNNRTRCQDIDECMDN----NGGCGQ--LCVNTAGSYHC----KCEPGYNATDAGARTCVDIDECAGHFGKGDCDHKCNNTAGSF------------------KCSCHHGYALTDDGLTCQDIDECAVDNG----GCHQKCVNSPGNFSCA----CHDGYITAGRNGSDFICDDIDECASGIHQCEEGATCVNTPGNYSCLCPQGY-RSDWNKCVDIDEC----KQRMC---EKECVNTEGSYFCFCPPGYQLTD-DKRHCQDVDECTAGDVCDQT--CINTNGSYYCECKTGFELLGDRKTCRDLDECALNT-ACCNQACVNTEGSYNCTCNSGYELTSRCTCTDIDECAERNGGCQ--------QVCTNTAGSYSC---SCSPGF 803          

HSP 2 Score: 216.853 bits (551), Expect = 4.048e-58
Identity = 190/514 (36.96%), Postives = 240/514 (46.69%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANA-CANKWEICVNTVGSFRCDCQKGFKHSK--LGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKE-TRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGY----RQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNM---HCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRK--EICQDIDECST 2540
            GF+ +     C D+NEC      C  K   CVNT GS+RC+C +GF+ S   L  C DIDEC+      D  KC N  GSY C     C  G+K+  +   C D+DEC       G G  CVN  GS+ C                  +C+ G+       R+C DIDEC  + G   G C     C N  GS+ C     C  G  L  +G+ C DIDEC      C   + CVN+  ++                   C C DGY    R   D IC D+DECA   G + C     C+N PG+Y+C+    CP G +RS  ++ C D+DEC+       Q M    CVN  GSY C C  GY LT +   C DV+EC      + C   +  C+NT GSY C+C  GFE      K C D++EC     C  +  CVNT GSY C C  GY L+ S  TC DIDEC      C   +C N  G Y C C PGF  D +  + C+DIDEC T
Sbjct:  390 GFVLSANGRRCRDVNECMMGGVKCDQK---CVNTPGSYRCECYRGFRQSDDVLKKCIDIDECLEG--LPDCHKCTNTAGSYYCT----CDTGYKQVNNRTRCQDIDEC--MDNNGGCGQLCVNTAGSYHC------------------KCEPGYNATDAGARTCVDIDECAGHFG--KGDCDHK--CNNTAGSFKC----SCHHGYALTDDGLTCQDIDECAVDNGGCH--QKCVNSPGNF------------------SCACHDGYITAGRNGSDFICDDIDECAS--GIHQCEEGATCVNTPGNYSCL----CPQG-YRSD-WNKCVDIDECK-------QRMCEKECVNTEGSYFCFCPPGYQLTDDKRHCQDVDECT---AGDVC---DQTCINTNGSYYCECKTGFELLG-DRKTCRDLDECALNTACCNQ-ACVNTEGSYNCTCNSGYELT-SRCTCTDIDECAERNGGCQQ-VCTNTAGSYSCSCSPGFLIDSRYPKQCKDIDECKT 821          

HSP 3 Score: 174.866 bits (442), Expect = 1.258e-44
Identity = 137/397 (34.51%), Postives = 189/397 (47.61%), Query Frame = 3
Query: 1476 RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRS-SMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGK-KHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKE----ICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            +C+ G+    + ++C +++EC          C++TD      G Y C    +C  G  +  +G++C D++EC   K     D  CVNT  SY+C  +            G  +  +G R      C DV+EC   G          C+N PGSY C    EC  G  +S  +   C D+DEC  G   C +   C N  GSY C CD GY   +N T C D++EC+       C  L   CVNTAGSY C+C  G+  +D   + C DI+EC      G   H+C NT GS+KC C  GY L+  G TC+DIDEC ++   C +  CVN PG + C C  G+    +     IC DIDEC++    C      + G  C+N  G Y C+   CP GY
Sbjct:  302 QCRQGYVLANDNKTCINLNECATRKHRCEQLCRDTD------GGYYC----ECHKGYQVGPDGMSCIDVNECLLPKSFHHCDHSCVNTPGSYYCTCNE-----------GFVLSANGRR------CRDVNECMMGG----VKCDQKCVNTPGSYRC----ECYRGFRQSDDVLKKCIDIDECLEGLPDCHK---CTNTAGSYYCTCDTGYKQVNNRTRCQDIDECM--DNNGGCGQL---CVNTAGSYHCKCEPGYNATDAGARTCVDIDECAGHFGKGDCDHKCNNTAGSFKCSCHHGYALTDDGLTCQDIDECAVDNGGC-HQKCVNSPGNFSCACHDGYITAGRNGSDFICDDIDECASGIHQC------EEGATCVNTPGNYSCL---CPQGY 645          

HSP 4 Score: 148.288 bits (373), Expect = 3.106e-36
Identity = 122/345 (35.36%), Postives = 166/345 (48.12%), Query Frame = 3
Query: 1680 IDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGY-RQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMH-----CVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADR--KEICQDIDECST--SEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICE 2681
            +DEC+     C   ++C+NT  S+                   C CR GY   N +  C +++ECA     + C  L  C +  G Y C    EC  G        +C DV+EC       P++ H     CVN  GSY C C+ G++L++N   C DVNEC++   +      + +CVNT GSY+C+C +GF  SD  +KKC DI+ECL   P    H+C NT GSY C C  GY+   +   C+DIDEC+     C   +CVN  G Y CKC PG+ A       C DIDEC+    +G C  +        C N  G +KC   SC  GY    T +G  C+
Sbjct:  278 VDECQNNNGGCR--DLCINTPGSF------------------MCQCRQGYVLANDNKTCINLNECATR--KHRCEQL--CRDTDGGYYC----ECHKGYQVGPDGMSCIDVNECLL-----PKSFHHCDHSCVNTPGSYYCTCNEGFVLSANGRRCRDVNECMMGGVK-----CDQKCVNTPGSYRCECYRGFRQSDDVLKKCIDIDECLEGLP--DCHKCTNTAGSYYCTCDTGYKQVNNRTRCQDIDECMDNNGGC-GQLCVNTAGSYHCKCEPGYNATDAGARTCVDIDECAGHFGKGDCDHK--------CNNTAGSFKC---SCHHGYAL--TDDGLTCQ 568          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN1 (fibulin 1 [Source:NCBI gene;Acc:101160948])

HSP 1 Score: 248.825 bits (634), Expect = 1.148e-68
Identity = 221/781 (28.30%), Postives = 323/781 (41.36%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD--CQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC----MCDRGYILTSNNTCADVNECLLF----RPEES-----------------------------CPDLE-----------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEP--RKCLN-------------------GI-----------------CVNVPGRYECKCPPG---FAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG-----NGFICELKSESICEPNDADCLNEKPYKISYEFIEISS--------DIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLT 3068
            GF        C DI+EC T        ++C+NT GSF C   C  G+  +    CEDIDEC    + C  +  C N  GS++C R   C  G+ +D  T  CVD++EC    + C P   C+N  GS+ C             +     CK G+    +   CED++EC  +    +  C   ++C N  GS+ C  +  C PG         C DIDEC      CE + +CVNT  SY C                K  C +GY Q+    C D+DEC +    N+CGS   C+N  GSY C    EC  G   S +   C+D+DEC      C  N  CVN  GS++C     C  GYIL     C DVNEC+      RP ++                             C D++             CVN  GSY+C+C  GF ++    K C D+NEC   +     H+C NT GSY C C +G++L+ +G+ CED+DEC + P  ++C N                   GI                 C+N  G + C CP        D +  CQD+DEC+     CS   +      C N+ G ++C+   CP  + +  +G     + F+  +KS   C+ +D DC N     I+   + + +        DI   RT +      +P        +V + + +   Q  Y  +V    +     G I  +  K I  P E++L + V      +    +   IN+Y++
Sbjct:  187 GFQMKMDGVTCQDIDECLTGRHNCGPGQVCLNTDGSFDCKPRCGTGYVLTAENHCEDIDECAFESHNCEANFVCLNTAGSFRCERKNVCRDGYIQD-STGSCVDINECLTHTDACQPDQFCINSEGSYTC-------------RSTTDDCKQGYQLTADGLRCEDVNECLTS----SHNCAHGEICLNTEGSFYC--QAACAPGFHFTPEN-KCRDIDECALWTHNCEANFVCVNTAGSYRCQP--------------KTGCEEGYIQDSAGNCIDMDECLKG---NVCGS-RACVNTEGSYHC----ECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQACINTVGSFYCRSIVASCARGYHLNADGTHCEDVDECVLHNVCGSHGSCVNVEGSYRCECQNGFTFNSIS-KLCEDVNECRHYSGRLCAHKCENTEGSYHCSCIKGFKLAENGNNCEDVDECEINPCSQECANVYGSYQCYCRRGYELNDIDGITCEDIDECAIPNVCSYRCINTVGGFNCTCPSSGYTLGPDGRS-CQDVDECAAGTHTCSASEN------CFNIQGGFRCLYFDCPPNFRRATSGSEAETSAFVRCIKS---CKRHDTDCANNPVLVITSTVLSLPTLRKLEEPEDIAVLRTAAAAKPDLLPN-----EPQVYFDIQATDEQ--YSFDVVKRSQHGMILGVIRQV--KPIVGPRELVLEVTVNYVQSGVISQQNIVIINVYIS 904          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN1 (fibulin 1 [Source:NCBI gene;Acc:101160948])

HSP 1 Score: 244.973 bits (624), Expect = 1.081e-67
Identity = 218/769 (28.35%), Postives = 320/769 (41.61%), Query Frame = 3
Query: 1077 DINECETANACANKWEICVNTVGSFRCD--CQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKC----MCDRGYILTSNNTCADVNECLLF----RPEES-----------------------------CPDLE-----------ARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEP--RKCLN-------------------GI-----------------CVNVPGRYECKCPPG---FAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG-----NGFICELKSESICEPNDADCLNEKPYKISYEFIEISS--------DIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLT 3068
            DI+EC T        ++C+NT GSF C   C  G+  +    CEDIDEC    + C  +  C N  GS++C R   C  G+ +D  T  CVD++EC    + C P   C+N  GS+ C             +     CK G+    +   CED++EC  +    +  C   ++C N  GS+ C  +  C PG         C DIDEC      CE + +CVNT  SY C                K  C +GY Q+    C D+DEC +    N+CGS   C+N  GSY C    EC  G   S +   C+D+DEC      C  N  CVN  GS++C     C  GYIL     C DVNEC+      RP ++                             C D++             CVN  GSY+C+C  GF ++    K C D+NEC   +     H+C NT GSY C C +G++L+ +G+ CED+DEC + P  ++C N                   GI                 C+N  G + C CP        D +  CQD+DEC+     CS   +      C N+ G ++C+   CP  + +  +G     + F+  +KS   C+ +D DC N     I+   + + +        DI   RT +      +P        +V + + +   Q  Y  +V    +     G I  +  K I  P E++L + V      +    +   IN+Y++
Sbjct:  149 DIDECLTGRHNCGPGQVCLNTDGSFDCKPRCGTGYVLTAENHCEDIDECAFESHNCEANFVCLNTAGSFRCERKNVCRDGYIQDS-TGSCVDINECLTHTDACQPDQFCINSEGSYTC-------------RSTTDDCKQGYQLTADGLRCEDVNECLTS----SHNCAHGEICLNTEGSFYC--QAACAPGFHFTPEN-KCRDIDECALWTHNCEANFVCVNTAGSYRCQP--------------KTGCEEGYIQDSAGNCIDMDECLKG---NVCGS-RACVNTEGSYHC----ECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQACINTVGSFYCRSIVASCARGYHLNADGTHCEDVDECVLHNVCGSHGSCVNVEGSYRCECQNGFTFNSIS-KLCEDVNECRHYSGRLCAHKCENTEGSYHCSCIKGFKLAENGNNCEDVDECEINPCSQECANVYGSYQCYCRRGYELNDIDGITCEDIDECAIPNVCSYRCINTVGGFNCTCPSSGYTLGPDGRS-CQDVDECAAGTHTCSASEN------CFNIQGGFRCLYFDCPPNFRRATSGSEAETSAFVRCIKS---CKRHDTDCANNPVLVITSTVLSLPTLRKLEEPEDIAVLRTAAAAKPDLLPN-----EPQVYFDIQATDEQ--YSFDVVKRSQHGMILGVIRQV--KPIVGPRELVLEVTVNYVQSGVISQQNIVIINVYIS 854          

HSP 2 Score: 144.821 bits (364), Expect = 7.156e-35
Identity = 125/360 (34.72%), Postives = 168/360 (46.67%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD----CQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSI--PCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGR-CKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQ-DSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECP-PGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM 2087
            GF++++  + C DI+EC    +      +CVNT GSF+C     C  G+     G C D++EC+ + + C   + C N VGS+ C RSI   C  G+  + D   C DVDEC     +CG    CVN+ GS+RCE                  C++GF F   ++ CED++EC      Y+GR C     C N  GSY C     C  G  LA+NG  C D+DEC+      E    C N Y SY                  +C CR GY  N  D I C D+DECA     N+C   Y CIN  G + C     CP  G        +CQDVDEC  G   C  + +C N+ G ++C+
Sbjct:  406 GFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQACINTVGSFYC-RSIVASCARGYHLNADGTHCEDVDEC-VLHNVCGSHGSCVNVEGSYRCE------------------CQNGFTFNSISKLCEDVNECRH----YSGRLCAHK--CENTEGSYHC----SCIKGFKLAENGNNCEDVDECEINPCSQE----CANVYGSY------------------QCYCRRGYELNDIDGITCEDIDECAI---PNVCS--YRCINTVGGFNCT----CPSSGYTLGPDGRSCQDVDECAAGTHTCSASENCFNIQGGFRCL 704          

HSP 3 Score: 128.257 bits (321), Expect = 1.088e-29
Identity = 88/238 (36.97%), Postives = 124/238 (52.10%), Query Frame = 3
Query: 2001 QDVDECETGEGKCPQNMHCVNVVGSYKC--MCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQ----CPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQCVNTVGSYKCK-----CFQGYRLSISGDTCEDIDECLLEPRKCLNG-ICVNVPGRYECK--CPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV-NSSCPVGYTKKETGN 2666
            +D+DEC TG   C     C+N  GS+ C   C  GY+LT+ N C D++EC     E    +    C+NTAGS++C+    C  G+         C DINECL   + C     C+N+ GSY C+     C QGY+L+  G  CED++ECL     C +G IC+N  G + C+  C PGF    +  C+DIDEC+     C  E++F    +C+N  G Y+C   + C  GY +   GN
Sbjct:  148 KDIDECLTGRHNCGPGQVCLNTDGSFDCKPRCGTGYVLTAENHCEDIDECAF---ESHNCEANFVCLNTAGSFRCERKNVCRDGYIQD--STGSCVDINECLTHTDACQPDQFCINSEGSYTCRSTTDDCKQGYQLTADGLRCEDVNECLTSSHNCAHGEICLNTEGSFYCQAACAPGFHFTPENKCRDIDECALWTHNC--EANF----VCVNTAGSYRCQPKTGCEEGYIQDSAGN 374          

HSP 4 Score: 83.1889 bits (204), Expect = 8.579e-16
Identity = 66/183 (36.07%), Postives = 83/183 (45.36%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE--TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKC----------IRSIPC---------------------GF-------GWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKG 1466
            GF FN   ++C D+NEC   +   CA+K   C NT GS+ C C KGFK ++ G  CED+DEC  +N CS  ++C N  GSY+C          I  I C                     GF       G+   PD   C DVDEC A    C     C NI+G  RC   +CP N +R   G
Sbjct:  542 GFTFNSISKLCEDVNECRHYSGRLCAHK---CENTEGSYHCSCIKGFKLAENGNNCEDVDEC-EINPCS--QECANVYGSYQCYCRRGYELNDIDGITCEDIDECAIPNVCSYRCINTVGGFNCTCPSSGYTLGPDGRSCQDVDECAAGTHTCSASENCFNIQGGFRCLYFDCPPNFRRATSG 718          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN2 (fibulin-2 [Source:NCBI gene;Acc:101172410])

HSP 1 Score: 241.891 bits (616), Expect = 2.201e-65
Identity = 212/637 (33.28%), Postives = 284/637 (44.58%), Query Frame = 3
Query: 1200 EDIDECM--NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGS--------HRCEDDECPIN-MKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPP-GFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLT 3068
            ED+DEC+     IC    +C N  GSY+C    P G   +ED  T     VDE     EI    +K  +            + CE + C    +    +  CS C  GF  K + RSCED++EC       +  C   + C N  GSY C     C PG  +  N   C DIDEC Q    C  D  CVNT  S+ C  SP            K  C  G+ ++    C D+DEC        C     CIN  GSY C +R  C  G   S   S C DV+ECE+   +C +   CVN+ GSY+C C  GY   S    C DVNEC  + P   C      CVNT GSY+C C  GF  S    K C D+NECLA NPC +  +C N  GSY+C C QGY L   G TC+DIDEC           CVNVPG Y C CP  G+  +     C DIDEC+     CS          C N+ G Y+C++ SCP  Y K       + + + E I  PN  +C N  P +I+Y ++   S+I     I R   S    G    N+ V     +  N         +    + +     V +++ +  P + L+ +++K + Q  F    ++ I +++T
Sbjct:  607 EDMDECLIYKGRIC--HHRCVNTPGSYRC-ECYP-GHVLQEDAITCAQDSVDEENRLKEIDRTAVKNTSPPLPPTLPAVPINPCEGNICEQQCVLVAGRPQCS-CSLGFSLKADGRSCEDVNEC-----LSSNACLLNERCMNTQGSYVCQRLITCLPGQQI--NNDVCEDIDECAQRSHNCAVDSECVNTQGSFRC--SP------------KARCAGGFIKDTQGNCVDIDECGTL--TQTCNPRSSCINTVGSYICNRRIICSRGYHASPNGSRCVDVNECESSLHQCGEGQLCVNLPGSYRCECQAGYQYDSFRRMCTDVNECWRY-PGRLCAQT---CVNTPGSYECSCTSGFRLSG-DSKNCEDVNECLA-NPCSQ--ECANIYGSYQCYCRQGYYLREDGKTCDDIDECSRSIGPLCTYKCVNVPGSYRCACPEYGYTMSSNGRSCIDIDECAAGVHNCSLAD------TCYNIQGSYRCLSLSCPQNYRK-------VSDTRCERISCPNYLECQN-SPLRITYYYLSFQSNIVIPAQIFRIGPSPAYSGD---NVIVTITQGNEEN---------YFSTRKLNAYTGAVFLQRQVQGPRDFLITVEMKLWRQGAFTTF-QARIYVFIT 1180          

HSP 2 Score: 166.392 bits (420), Expect = 2.086e-41
Identity = 135/371 (36.39%), Postives = 178/371 (47.98%), Query Frame = 3
Query: 1065 EICGDINEC-ETANACANKWEICVNTVGSFRCD----CQKGFKHSKLGICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGW-YNGR-CKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPP-GMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTSNNTCADVN 2138
            ++C DI+EC + ++ CA   E CVNT GSFRC     C  GF     G C DIDEC  +   C+    C N VGSY C R I C  G+   P+ + CVDV+ECE+    CG G  CVN+ GS+RCE                  C+ G+ +    R C D++EC     W Y GR C +T  C N PGSY+C     C  G  L+ +   C D++EC  +   C  +  C N Y SY                  +C CR GY   +D   C D+DEC+ + G  LC   Y C+N PGSY C     CP  G   SS   +C D+DEC  G   C     C N+ GSY+C+   C + Y   S+  C  ++
Sbjct:  761 DVCEDIDECAQRSHNCAVDSE-CVNTQGSFRCSPKARCAGGFIKDTQGNCVDIDECGTLTQTCNPRSSCINTVGSYICNRRIICSRGYHASPNGSRCVDVNECESSLHQCGEGQLCVNLPGSYRCE------------------CQAGYQYDSFRRMCTDVNEC-----WRYPGRLCAQT--CVNTPGSYEC----SCTSGFRLSGDSKNCEDVNEC--LANPCSQE--CANIYGSY------------------QCYCRQGYYLREDGKTCDDIDECSRSIGP-LC--TYKCVNVPGSYRCA----CPEYGYTMSSNGRSCIDIDECAAGVHNCSLADTCYNIQGSYRCLSLSCPQNYRKVSDTRCERIS 1072          

HSP 3 Score: 92.4337 bits (228), Expect = 1.813e-18
Identity = 72/197 (36.55%), Postives = 98/197 (49.75%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC--ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDEC-EAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI 1619
            G+ ++ F  +C D+NEC       CA   + CVNT GS+ C C  GF+ S     CED++EC+  N CS  ++C N  GSY+C     C  G+    D   C D+DEC  +   +C    KCVN+ GS+RC    CP              + G+      RSC DIDEC    G +N  C   D C+N+ GSY C+
Sbjct:  889 GYQYDSFRRMCTDVNECWRYPGRLCA---QTCVNTPGSYECSCTSGFRLSGDSKNCEDVNECL-ANPCS--QECANIYGSYQCY----CRQGYYLREDGKTCDDIDECSRSIGPLC--TYKCVNVPGSYRC---ACP--------------EYGYTMSSNGRSCIDIDECA--AGVHN--CSLADTCYNIQGSYRCL 1052          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN2 (fibulin-2 [Source:NCBI gene;Acc:101172410])

HSP 1 Score: 241.891 bits (616), Expect = 2.201e-65
Identity = 212/637 (33.28%), Postives = 284/637 (44.58%), Query Frame = 3
Query: 1200 EDIDECM--NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGS--------HRCEDDECPIN-MKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTS-NNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPP-GFA-ADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLT 3068
            ED+DEC+     IC    +C N  GSY+C    P G   +ED  T     VDE     EI    +K  +            + CE + C    +    +  CS C  GF  K + RSCED++EC       +  C   + C N  GSY C     C PG  +  N   C DIDEC Q    C  D  CVNT  S+ C  SP            K  C  G+ ++    C D+DEC        C     CIN  GSY C +R  C  G   S   S C DV+ECE+   +C +   CVN+ GSY+C C  GY   S    C DVNEC  + P   C      CVNT GSY+C C  GF  S    K C D+NECLA NPC +  +C N  GSY+C C QGY L   G TC+DIDEC           CVNVPG Y C CP  G+  +     C DIDEC+     CS          C N+ G Y+C++ SCP  Y K       + + + E I  PN  +C N  P +I+Y ++   S+I     I R   S    G    N+ V     +  N         +    + +     V +++ +  P + L+ +++K + Q  F    ++ I +++T
Sbjct:  607 EDMDECLIYKGRIC--HHRCVNTPGSYRC-ECYP-GHVLQEDAITCAQDSVDEENRLKEIDRTAVKNTSPPLPPTLPAVPINPCEGNICEQQCVLVAGRPQCS-CSLGFSLKADGRSCEDVNEC-----LSSNACLLNERCMNTQGSYVCQRLITCLPGQQI--NNDVCEDIDECAQRSHNCAVDSECVNTQGSFRC--SP------------KARCAGGFIKDTQGNCVDIDECGTL--TQTCNPRSSCINTVGSYICNRRIICSRGYHASPNGSRCVDVNECESSLHQCGEGQLCVNLPGSYRCECQAGYQYDSFRRMCTDVNECWRY-PGRLCAQT---CVNTPGSYECSCTSGFRLSG-DSKNCEDVNECLA-NPCSQ--ECANIYGSYQCYCRQGYYLREDGKTCDDIDECSRSIGPLCTYKCVNVPGSYRCACPEYGYTMSSNGRSCIDIDECAAGVHNCSLAD------TCYNIQGSYRCLSLSCPQNYRK-------VSDTRCERISCPNYLECQN-SPLRITYYYLSFQSNIVIPAQIFRIGPSPAYSGD---NVIVTITQGNEEN---------YFSTRKLNAYTGAVFLQRQVQGPRDFLITVEMKLWRQGAFTTF-QARIYVFIT 1180          

HSP 2 Score: 166.392 bits (420), Expect = 2.086e-41
Identity = 135/371 (36.39%), Postives = 178/371 (47.98%), Query Frame = 3
Query: 1065 EICGDINEC-ETANACANKWEICVNTVGSFRCD----CQKGFKHSKLGICEDIDECMNV-NICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGW-YNGR-CKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPP-GMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGYILTSNNTCADVN 2138
            ++C DI+EC + ++ CA   E CVNT GSFRC     C  GF     G C DIDEC  +   C+    C N VGSY C R I C  G+   P+ + CVDV+ECE+    CG G  CVN+ GS+RCE                  C+ G+ +    R C D++EC     W Y GR C +T  C N PGSY+C     C  G  L+ +   C D++EC  +   C  +  C N Y SY                  +C CR GY   +D   C D+DEC+ + G  LC   Y C+N PGSY C     CP  G   SS   +C D+DEC  G   C     C N+ GSY+C+   C + Y   S+  C  ++
Sbjct:  761 DVCEDIDECAQRSHNCAVDSE-CVNTQGSFRCSPKARCAGGFIKDTQGNCVDIDECGTLTQTCNPRSSCINTVGSYICNRRIICSRGYHASPNGSRCVDVNECESSLHQCGEGQLCVNLPGSYRCE------------------CQAGYQYDSFRRMCTDVNEC-----WRYPGRLCAQT--CVNTPGSYEC----SCTSGFRLSGDSKNCEDVNEC--LANPCSQE--CANIYGSY------------------QCYCRQGYYLREDGKTCDDIDECSRSIGP-LC--TYKCVNVPGSYRCA----CPEYGYTMSSNGRSCIDIDECAAGVHNCSLADTCYNIQGSYRCLSLSCPQNYRKVSDTRCERIS 1072          

HSP 3 Score: 92.4337 bits (228), Expect = 1.813e-18
Identity = 72/197 (36.55%), Postives = 98/197 (49.75%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC--ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDEC-EAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI 1619
            G+ ++ F  +C D+NEC       CA   + CVNT GS+ C C  GF+ S     CED++EC+  N CS  ++C N  GSY+C     C  G+    D   C D+DEC  +   +C    KCVN+ GS+RC    CP              + G+      RSC DIDEC    G +N  C   D C+N+ GSY C+
Sbjct:  889 GYQYDSFRRMCTDVNECWRYPGRLCA---QTCVNTPGSYECSCTSGFRLSGDSKNCEDVNECL-ANPCS--QECANIYGSYQCY----CRQGYYLREDGKTCDDIDECSRSIGPLC--TYKCVNVPGSYRC---ACP--------------EYGYTMSSNGRSCIDIDECA--AGVHN--CSLADTCYNIQGSYRCL 1052          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN1 (fibulin 1 [Source:NCBI gene;Acc:101160948])

HSP 1 Score: 228.024 bits (580), Expect = 2.177e-62
Identity = 175/497 (35.21%), Postives = 234/497 (47.08%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCD--CQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC---VASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN-NTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKC-FQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYEC---KCPPGF 2492
            GF        C DI+EC T        ++C+NT GSF C   C  G+  +    CEDIDEC +  + C  +  C N  GSY+C     C  G+ +D   N C+D+DEC     +CG    CVN  GS+ CE                  C+ GF + + ++ CEDIDEC +    +   C    VC N  GS+ C P K C  G +L   G  C D++EC      C P + C+NT  S++C   VAS                C  GY  N D   C DVDEC  +   N+CGS   C+N  GSY C    EC  G   +S+   C+DV+EC    G+   +  C N  GSY C C +G+ L  N N C DV+EC +             C N  GSY+C C +G+E +D     C DI+EC   N C   ++C+NTVG + C C   GY L   G +C+D+DEC      C  +  C N+ G + C    CPP F
Sbjct:  187 GFQMKMDGVTCQDIDECLTGRHNCGPGQVCLNTDGSFDCKPRCGTGYVLTAENHCEDIDECALWTHNCEANFVCVNTAGSYRCQPKTGCEEGYIQDSAGN-CIDMDECLK-GNVCG-SRACVNTEGSYHCE------------------CQTGFMYSRVSKKCEDIDECAL----WTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAG-KCVDVNECVTHSHPCRPGQACINTVGSFYCRSIVAS----------------CARGYHLNADGTHCEDVDECVLH---NVCGSHGSCVNVEGSYRC----ECQNGFTFNSISKLCEDVNECRHYSGRLCAH-KCENTEGSYHCSCIKGFKLAENGNNCEDVDECEI-------NPCSQECANVYGSYQCYCRRGYELNDIDGITCEDIDECAIPNVC--SYRCINTVGGFNCTCPSSGYTLGPDGRSCQDVDECAAGTHTCSASENCFNIQGGFRCLYFDCPPNF 624          

HSP 2 Score: 207.994 bits (528), Expect = 1.244e-55
Identity = 195/673 (28.97%), Postives = 284/673 (42.20%), Query Frame = 3
Query: 1245 KKCKNNVGSYKCIRSIPC----GFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM-----CDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEP--RKCLN-------------------GI-----------------CVNVPGRYECKCPPG---FAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETG-----NGFICELKSESICEPNDADCLNEKPYKISYEFIEISS--------DIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLT 3068
            + C++   S  C+ +  C    GF  K D  T  C D+DEC      CGPG  C+N  GS  C+                 RC  G+    E   CEDIDEC +    +   C+   VC N  GSY C PK  C  G +    G  C D+DEC  +K        CVNT  SYHC                   C+ G+  ++ S  C D+DECA     + CG+ ++C+N  GS+ C     C  G         C DV+EC T    C     C+N VGS+ C      C RGY L ++ T C DV+EC+L     S       CVN  GSY+C+C  GF ++    K C D+NEC   +     H+C NT GSY C C +G++L+ +G+ CED+DEC + P  ++C N                   GI                 C+N  G + C CP        D +  CQD+DEC+     CS   +      C N+ G ++C+   CP  + +  +G     + F+  +KS   C+ +D DC N     I+   + + +        DI   RT +      +P        +V + + +   Q  Y  +V    +     G I  +  K I  P E++L + V      +    +   IN+Y++
Sbjct:  165 RSCQDANCSQLCLENAMCACREGFQMKMDGVT--CQDIDECLTGRHNCGPGQVCLNTDGSFDCK----------------PRCGTGYVLTAENH-CEDIDECAL----WTHNCEANFVCVNTAGSYRCQPKTGCEEGYIQDSAG-NCIDMDEC--LKGNVCGSRACVNTEGSYHC------------------ECQTGFMYSRVSKKCEDIDECAL--WTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPA-GKCVDVNECVTHSHPCRPGQACINTVGSFYCRSIVASCARGYHLNADGTHCEDVDECVLHNVCGS----HGSCVNVEGSYRCECQNGFTFNSIS-KLCEDVNECRHYSGRLCAHKCENTEGSYHCSCIKGFKLAENGNNCEDVDECEINPCSQECANVYGSYQCYCRRGYELNDIDGITCEDIDECAIPNVCSYRCINTVGGFNCTCPSSGYTLGPDGRS-CQDVDECAAGTHTCSASEN------CFNIQGGFRCLYFDCPPNFRRATSGSEAETSAFVRCIKS---CKRHDTDCANNPVLVITSTVLSLPTLRKLEEPEDIAVLRTAAAAKPDLLPN-----EPQVYFDIQATDEQ--YSFDVVKRSQHGMILGVIRQV--KPIVGPRELVLEVTVNYVQSGVISQQNIVIINVYIS 766          

HSP 3 Score: 83.5741 bits (205), Expect = 6.215e-16
Identity = 66/183 (36.07%), Postives = 83/183 (45.36%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECE--TANACANKWEICVNTVGSFRCDCQKGFKHSKLGI-CEDIDECMNVNICSDDKKCKNNVGSYKC----------IRSIPC---------------------GF-------GWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKG 1466
            GF FN   ++C D+NEC   +   CA+K   C NT GS+ C C KGFK ++ G  CED+DEC  +N CS  ++C N  GSY+C          I  I C                     GF       G+   PD   C DVDEC A    C     C NI+G  RC   +CP N +R   G
Sbjct:  454 GFTFNSISKLCEDVNECRHYSGRLCAHK---CENTEGSYHCSCIKGFKLAENGNNCEDVDEC-EINPCS--QECANVYGSYQCYCRRGYELNDIDGITCEDIDECAIPNVCSYRCINTVGGFNCTCPSSGYTLGPDGRSCQDVDECAAGTHTCSASENCFNIQGGFRCLYFDCPPNFRRATSG 630          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000032548.1 (SMESG000032548.1)

HSP 1 Score: 1952.18 bits (5056), Expect = 0.000e+0
Identity = 983/988 (99.49%), Postives = 985/988 (99.70%), Query Frame = 3
Query:  120 MILEIILIFLVLNACNSQINYQTCCHSGIEKAEMAIKNVTLSNTHLSTMCTFKSIGSHLERTNRSRSFICVLFARSCCIKVYSAKICQLGSSQTESCEKYISDLSPVLNQIKMECCMCCKHGNGGLLFESCSMLKGNCSRTRNKDSSRSLGTSATPSPNRLFSAQIHSYQPRPTKATVTNESSVEDISNGNAENNNTVGWEXXXXXXXXXXXXXGKTTEISMKSTRKMSQISLKANPMTTTSDATSALLKISQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTXXXXXXXXXXXXXXXGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYLTRYPSN 3083
            MILEIILIFLVLNACNSQINYQTCCHSGIEKAEMAIKNVTLSNTHLSTMCTFKSIGSHLERTNRSRSFICVLFARSCCIKVYSAKICQLGSSQTESCEKYISDLSPVLNQIKMECCMCCKHGNGGLLFESCSMLKGNCSRTRNKDSSRSLGTSATPSPNRLFSAQIHSYQPRPTKATVTNESSVEDISNGN ENNNTVGWETSSTTFTLSPFTSGKTTEISMKSTRKMSQIS KANPMTTTSDATSALLKISQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTSKCVPVVKPKVPCSKGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSES+CE NDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVE+LLYLDVKKYHQEMFLGHSESFINLYLTRYPSN
Sbjct:    1 MILEIILIFLVLNACNSQINYQTCCHSGIEKAEMAIKNVTLSNTHLSTMCTFKSIGSHLERTNRSRSFICVLFARSCCIKVYSAKICQLGSSQTESCEKYISDLSPVLNQIKMECCMCCKHGNGGLLFESCSMLKGNCSRTRNKDSSRSLGTSATPSPNRLFSAQIHSYQPRPTKATVTNESSVEDISNGNGENNNTVGWETSSTTFTLSPFTSGKTTEISMKSTRKMSQISPKANPMTTTSDATSALLKISQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTSKCVPVVKPKVPCSKGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESLCESNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEVLLYLDVKKYHQEMFLGHSESFINLYLTRYPSN 988          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000032551.1 (SMESG000032551.1)

HSP 1 Score: 191.815 bits (486), Expect = 4.715e-52
Identity = 152/533 (28.52%), Postives = 238/533 (44.65%), Query Frame = 3
Query: 1479 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQ-DSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRL-CINLLGYYKCVNSSCPVGY-TKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYL 3065
            C+ G+ F  E + C+DI+EC+         C   + C NLPGSY CI K  C  G         C D++EC Q    C+   +C N   S++C   PC  ++   ++ G   C++GYR N   +IC D+DEC             IC+  PG   C    +C  G  +  + + C DVDEC   +  C     C N  G Y C                         E  C   E   +N A + +C C  GF+ + Y   KC D++EC +  P CG K +C N +G Y C+C  GY       TC DIDEC+     C +  C N PG ++C C  G+    + +C+DI+EC+ + G+C  E    N R+ C NL+G YKC+ S CP GY    E+ +   C+L   +        C+   P  + Y  I+I +       I+   +  +      + + VK A N+ + + + + +   L +   D   I V +   +    EI+L +++K   Q     +S + +++++
Sbjct:    8 CESGYQFVFEEKKCKDINECSQKADI----CHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIK--IANICYDVDECAENKNNCTDTQRCNNYFGYYTC------------------------SEIKCEGYEE--LNNA-TKECHCKSGFKRNLY-TGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIIL-RPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 500          

HSP 2 Score: 165.622 bits (418), Expect = 3.623e-43
Identity = 122/358 (34.08%), Postives = 181/358 (50.56%), Query Frame = 3
Query: 1197 CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKE-TDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGM-FRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECL----LFRPEESCPDLEARCVNTAGSYKCQ---CPKGF 2237
            C+DI+EC    +IC  ++ C+N  GSYKCI    CG G++ + +T  C+D++EC    + C  GM C N+ GS  C    CP N        C +CK+G+ +      CEDIDECT   G Y  +C+   ++C   PG   C  + +C  GT+   N   C D+DEC + K  C   + C N +  Y C    C   ++ + +  +C C+ G+++N     C DVDEC  +    +CG+   C N  G Y C    +C PG  F+++    C D+DEC + +  C   + C N  G +KC+C  GY +++ N C D+NEC     + R E    +    C N  GSYKC    CP G+
Sbjct:   21 CKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT---GPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC--DSLIPVCGNKGRCKNEIGRYNC----QCNPGYEFKNAT---CLDIDECVSLKDICGH-LKCENTPGFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 360          

HSP 3 Score: 92.4337 bits (228), Expect = 4.462e-19
Identity = 105/352 (29.83%), Postives = 145/352 (41.19%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRC-----------------DCQKGFKHSKL-GICEDIDECMNVN--ICSDDKK-CKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDEC--TMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYI-----CINHPGSYACIQRAECPPG---MFRSSMYSNCQ 2003
            G+ FN   + C D+NEC  +    +   +C N +GSF C                  C++G++ + L  ICEDIDEC       C   K+ C    G   C     C  G  +    N C DVDEC      C    +C N  G + C + +C    + NN      CK GF     T  CED+DEC   + V    GRCK      N  G Y+C    +C PG         C DIDEC  +K      +IC        C  +P            KC+C+ GY+ + +++C D++EC +  G      L +     C N  GSY C++   CP G   +  SS    CQ
Sbjct:   58 GYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIK--IANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCK------NEIGRYNC----QCNPGYEFK--NATCLDIDECVSLK------DIC----GHLKCENTP---------GFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESI-CPSGYRVLSESSSTKACQ 373          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000032551.1 (SMESG000032551.1)

HSP 1 Score: 191.815 bits (486), Expect = 1.315e-51
Identity = 152/533 (28.52%), Postives = 238/533 (44.65%), Query Frame = 3
Query: 1479 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRL-CINLLGYYKCVNSSCPVGY-TKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEILLYLDVKKYHQEMFLGHSESFINLYL 3065
            C+ G+ F  E + C+DI+EC+         C   + C NLPGSY CI K  C  G         C D++EC Q    C+   +C N   S++C   PC  ++   ++ G   C++GYR N   +IC D+DEC             IC+  PG   C    +C  G  +  + + C DVDEC   +  C     C N  G Y C                         E  C   E   +N A + +C C  GF+ + Y   KC D++EC +  P CG K +C N +G Y C+C  GY       TC DIDEC+     C +  C N PG ++C C  G+    + +C+DI+EC+ + G+C  E    N R+ C NL+G YKC+ S CP GY    E+ +   C+L   +        C+   P  + Y  I+I +       I+   +  +      + + VK A N+ + + + + +   L +   D   I V +   +    EI+L +++K   Q     +S + +++++
Sbjct:   63 CESGYQFVFEEKKCKDINECSQKADI----CHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIK--IANICYDVDECAENKNNCTDTQRCNNYFGYYTC------------------------SEIKCEGYEE--LNNA-TKECHCKSGFKRNLY-TGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIIL-RPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 555          

HSP 2 Score: 166.007 bits (419), Expect = 6.223e-43
Identity = 122/358 (34.08%), Postives = 181/358 (50.56%), Query Frame = 3
Query: 1197 CEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKE-TDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGM-FRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECL----LFRPEESCPDLEARCVNTAGSYKCQ---CPKGF 2237
            C+DI+EC    +IC  ++ C+N  GSYKCI    CG G++ + +T  C+D++EC    + C  GM C N+ GS  C    CP N        C +CK+G+ +      CEDIDECT   G Y  +C+   ++C   PG   C  + +C  GT+   N   C D+DEC + K  C   + C N +  Y C    C   ++ + +  +C C+ G+++N     C DVDEC  +    +CG+   C N  G Y C    +C PG  F++   + C D+DEC + +  C   + C N  G +KC+C  GY +++ N C D+NEC     + R E    +    C N  GSYKC    CP G+
Sbjct:   76 CKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT---GPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC--DSLIPVCGNKGRCKNEIGRYNC----QCNPGYEFKN---ATCLDIDECVSLKDICGH-LKCENTPGFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 415          

HSP 3 Score: 92.4337 bits (228), Expect = 5.390e-19
Identity = 105/352 (29.83%), Postives = 145/352 (41.19%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRC-----------------DCQKGFKHSKL-GICEDIDECMNVN--ICSDDKK-CKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDEC--TMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYI-----CINHPGSYACIQRAECPPG---MFRSSMYSNCQ 2003
            G+ FN   + C D+NEC  +    +   +C N +GSF C                  C++G++ + L  ICEDIDEC       C   K+ C    G   C     C  G  +    N C DVDEC      C    +C N  G + C + +C    + NN      CK GF     T  CED+DEC   + V    GRCK      N  G Y+C    +C PG         C DIDEC  +K      +IC        C  +P            KC+C+ GY+ + +++C D++EC +  G      L +     C N  GSY C++   CP G   +  SS    CQ
Sbjct:  113 GYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIK--IANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCK------NEIGRYNC----QCNPGYEFK--NATCLDIDECVSLK------DIC----GHLKCENTP---------GFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESI-CPSGYRVLSESSSTKACQ 428          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000076582.1 (SMESG000076582.1)

HSP 1 Score: 184.111 bits (466), Expect = 1.077e-46
Identity = 187/601 (31.11%), Postives = 276/601 (45.92%), Query Frame = 3
Query: 1050 FNQFLEICGDINECETANACANKWE-------ICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICG--PGMKCVNIRGSHRC--------------EDDECPINMKRNNKGICSRCKDGF-------YFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEP-DEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDEC--AENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGE-----GKCPQ-NMHCVNVVGSYKCMCDRGYILTSNNT-CADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLA-ANPCGKKHQ--CVNTVGSYKCKCFQGYRLS--ISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPN 2711
            FN +++I G    C   N C N  E       IC++T GS+ C C+ GFK    G CE+I+EC    + CS +  C++    + C +  P GF W ++ + N C D+DEC   P  C   P   C+N  GS  C              + +EC I        +C+    GF         +     CE I+EC  N+           VC++LP  Y C+         V  Q    C + +EC+     C+  +  CV+TY S+                  KC+C+ G+ +N D  C D DEC  +E      C +   CIN  G + C    +CP G   ++   +C DVDEC   +       C Q N HC+N VG ++C C+RG+++  N+T C D++EC       SC  L+  C N  GS++C C  G++  +    KCTDINEC   +  CG +    C+N  GS++CKC  GY  S   S + C+ ++EC+     C  N  CV+    YEC C  G+  D+  IC++I+EC   E  C   +D      C++  G YKC   +C  GY     G+G +     ++IC PN
Sbjct: 4921 FNGYVKIPG-TQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSC-QCKP-GFKWSDETNLN-CEDIDECTN-PTSCSSMPHSICMNNPGSFECVCPHGFSLQGGYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQ---VCENQNECEINIHSCQASNSECVDTYGSF------------------KCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGK-CINTAGGFTC----DCPEGFIYNNY--DCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCYCNRGFVMIENSTKCVDIDECQF---PNSC--LDGLCNNLPGSFECLCNIGYDLVN---GKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQI-EDSCHYLAD------CLDTDGSYKC---TCKYGY----KGDGIV---SCKAICGPN 5463          

HSP 2 Score: 161.77 bits (408), Expect = 1.026e-39
Identity = 186/614 (30.29%), Postives = 257/614 (41.86%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLG--ICEDIDECMNVNICSDD-KKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------DDECPINMKRNNK-------GICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHC-----VASPCAPSQQFDY-----------------SVGK--CMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGY--------RLSISGDTCEDIDEC----------------LLEPRKCL----------NGICVNVPGRYECKCPPG--FAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            GF+ N     C D NEC +T N C      C NT GS+RCDC+ GF+ S +   +C D++EC  V+ C  +  KC N  GSY C     C  G++ D    +C D+DEC +      P   CVN+ GS+ C         D + P N  +  K       G C  CK GF     T  CEDIDEC        GR  +   C NL GSY+C    +C  G  ++     C +I+EC     +C  +  C++T   Y+C         C   +  D                  S+G   C C +GY  +  S+C+++DEC   G  N   S   C N  G + C     C  G ++S    +C D +EC   +  C  N  C+N  GS+ C+C  GYI +  N   D  E L    +  CP L A CVN+     C C  G+E S     +C + +EC +   C     C++T GS+ C C +GY        +     D C+  + C                + +  KC           N IC    G   C C  G   ++D  + C DIDEC  +E V     D Q   +C N  G Y C    CP  Y
Sbjct: 3279 GFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCT----CDSGYQGD--GRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQC-FCKHGFQNNVTTNICEDIDECDTAANDCAGRKAK---CANLDGSYEC----ECLYGYRMSSINKICENINECIDNLHQCGENAECIDTDGGYYCQCKTGFTGHCDECRDIDECAFSLNNCDSDRATCENSIGSFTCRCNEGYSGD-GSVCSEIDECLL-GLHNCSRSHQFCFNVNGGFEC----RCLSG-YKSDTNGSCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRN--CDPQEGLEECGKLLCP-LNALCVNST----CLCKSGYENS---TNQCINTDECESQTSCDVNANCIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAICSISSGSPVCSCSVGTSLSSDSSQ-CIDIDEC--NENV----DDCQENSICFNRFGSYDC---KCPPNY 3851          

HSP 3 Score: 153.295 bits (386), Expect = 3.878e-37
Identity = 186/659 (28.22%), Postives = 254/659 (38.54%), Query Frame = 3
Query: 1071 CGDINECETA-NACANKWEICVNTV-GSFRCDCQKGFKHSKLGICEDIDECMN-VNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGS--------------YDCI-----PKK---KCRPGTV--LAQNGIACN-----------------------DIDECKQMKFRCEPDEICVNTYSSYHCV---------------ASPCAPS-----------QQFDYSVG-----KCMCRDGYRQNQDS-ICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILT--SNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC--LNGI------------------------------------------------CVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            C  I+ C    + C  K E C+++   S+ C C +GF+    G C D+DEC + ++ C ++  C N +GSY C     C    K D     C D +EC+  P ICG   KC+N  GS+ C+                  C  G+  K    +CEDIDEC +        C +   C N+PGS              Y CI     P +   KC  G+   +  N I CN                       DIDEC   K  C     C N   +Y C                 + CA             +  D +V      +C C +GY +   + IC + +EC  N  +N C    ICI+  GSY C     C  G F+      C++++ECE     C  N  C +    + C C  G+  +  +N  C D++EC       S P   + C+N  GS++C CP GF         C DINECL  N CG+   C NTV  + C C  G R   +GD CE I+ECL    +C  LNG                                                 CV+  G ++C C PGF+ +    C D DEC  SE        F N   CIN  G + C    CP G+
Sbjct: 4620 CKPIDSCAMGLDNCDRKVEDCISSKDSSYTCQCIEGFQRIN-GSCVDVDECADKIDSCKNNATCNNMIGSYVC----KCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQ------------------CVTGY--KWNGTNCEDIDECAIKTH----PCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECL-NPVENDCVENAICIDTEGSYEC----RCKSG-FKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMP--HSICMNNPGSFECVCPHGFSLQG---GYCNDINECLIPNSCGQNSVCANTVSGFNCSCANGARQLPNGD-CELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISE---QSNMKFCNNGKCINTAGGFTC---DCPEGF 5231          

HSP 4 Score: 141.739 bits (356), Expect = 1.425e-33
Identity = 150/530 (28.30%), Postives = 213/530 (40.19%), Query Frame = 3
Query: 1065 EICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGI----CEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQ-MKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCP--DLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCV--NTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC--LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            E+C D++EC   +        C N  GSF C C  GF+  +  +    C DIDEC+    C+ + +C+N +GS+KC     C  G+  D    DC    +CE +          VN+  S      EC  + + +  GI S  K+   F     SC                  E  +C  +  +Y CI      P          CNDIDEC       C   E CVN+   Y+CV                  C DG     D IC D+DEC+ N   N C S  IC N  G+Y+C    +C  G +   +   C D+DEC+ G   C +N  C+N  G++ C C  G  L +  TC D +EC   +     P  D  A C N    Y C+C  G++ + +    C     C   N C     C   N      C+C   ++L    DTC    EC  +   C      CV +   ++C+C PGF       CQD +EC  +    + +    +G  C+N  G + C 
Sbjct: 4142 ELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKC----ECKDGFIGDGKY-DCRIDSKCEKYGGCHEDASCIVNVESSIY----ECQCHTEFSGDGITSCIKNNLCFVNGKSSCH-----------------ENAICEQVNATYRCI-----CPDGFQGDGYNFCNDIDECANDNTHNCSSLEKCVNSNGQYNCV------------------CGDGAVY-VDDICVDIDECSSNQ-TNKCSSNAICQNKEGTYSC----QCAEGFYGDGLL--CHDIDECKFGVANCSENALCINKPGTFACECQAG-TLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGW---FCIKQTPCDVPNACKANQTCTPSNENSLAICECKPDFKL--ENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNM-VGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCT 4607          

HSP 5 Score: 134.42 bits (337), Expect = 2.457e-31
Identity = 145/449 (32.29%), Postives = 197/449 (43.88%), Query Frame = 3
Query: 1476 RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPC--APSQQFDYSVG-KCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYI-CINHPGSYACIQRAECPPGMFRSSMYSN-CQDVDECETGEGKCPQN-MHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSD-------------------------------YPIKKCTDINEC-LAANPC-GKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKC-LNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESI 2699
             CK+GF    +   C+DIDEC+ N       C     C N  GS+ C     C+ G     NG+ C +I+EC  +                     SPC  A  + FD   G +C C+ G+ +N  +  C D +ECA+ G  NLC  +   C N  GSY    R +C  G   S + S  C DV+EC     +C +N   C N  GSY C CD GY     N C D++EC      + C   +A CVN  GSY+C+C  G    D                                    C DI+EC  AAN C G+K +C N  GSY+C+C  GYR+S     CE+I+EC+    +C  N  C++  G Y C+C  GF     E C+DIDEC+ S   C  +        C N +G + C    C  GY    +G+G +C    E +
Sbjct: 3193 HCKNGFM--GDGIMCKDIDECSNNTS----VCDSNAFCKNTIGSFSC----SCKEG--FEGNGVTCTNINECYPL---------------------SPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTG--NLCDRVSTNCNNTFGSY----RCDCKYGFRPSPIDSFVCTDVNECNLVH-ECDKNYAKCTNTPGSYYCTCDSGYQGDGRN-CTDIDEC---SSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSINKICENINECIDNLHQCGENAECIDTDGGYYCQCKTGFTGHCDE-CRDIDECAFSLNNCDSDR-----ATCENSIGSFTC---RCNEGY----SGDGSVCSEIDECL 3584          

HSP 6 Score: 132.109 bits (331), Expect = 1.254e-30
Identity = 155/483 (32.09%), Postives = 208/483 (43.06%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNIC----SDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEIC-GPGMKCVNIRGSHRC---------------EDDECPI----NMKRNNKGICSRCKDGFY------FKKETRSCEDIDECTMN-VGWYNGRCKETD-VCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCG--SLYICINHPGSYACIQRAECPPGMFRSS--MYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDI---NECLAANPCGKKHQCVNTVGSYKCKCF-QGYRLSISGDTCE 2396
            C DINEC   N+C     +C NTV  F C C  G +    G CE I+EC+ N++ C      D  C +    Y C+   P GF   ++     C + +ECE     C     +CV+  GS +C               + DEC I    NMK  N G C     GF       F      C D+DEC+++ V      C + +  C N  G + C     C  G V+ +N   C DIDEC Q    C  D +C N   S+                  +C+C  GY    +  CTD++EC+ N    +CG  +  ICIN  GS+ C    +C  G   S    Y+ CQ V+EC      CP N  CV+    Y+C+C  GY       C ++NEC +   E+SC  L A C++T GSYKC C  G++     I  C  I   N CL    C    Q VN    Y C C  QG R   +G  C+
Sbjct: 5062 CNDINECLIPNSCGQN-SVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACV--CPDGF-VNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQCY----CNRGFVMIENSTKCVDIDEC-QFPNSCL-DGLCNNLPGSF------------------ECLCNIGYDL-VNGKCTDINECSNNS--QICGPQAAGICINAAGSFQC----KCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINECQI---EDSCHYL-ADCLDTDGSYKCTCKYGYKGDG--IVSCKAICGPNSCLPGQLC----QIVNG-NQYDCGCVCQGPRCRDNGPVCD 5498          

HSP 7 Score: 123.635 bits (309), Expect = 5.131e-28
Identity = 171/607 (28.17%), Postives = 247/607 (40.69%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM------NVNICSDDKKCKNNVGSYKC-IRSIPCGFGW---KEDPDTNDCVDVDECEAFPEICGP----GMKCVNIRGSHRCEDDECPINMKRNNK----------------GICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGR--CKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAAN--PCGKKHQCVNTVGSY-KCKCFQGY----RLSISGDT----CEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDF-QNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCL 2726
            GF  +  L  C DI+EC+   A  ++  +C+N  G+F C+CQ G   +    C D DEC           C ++  CKN    Y C  +S   G GW   K+ P    C   + C+A  + C P     +     +   + E+D C    +  NK                G    CK GF     T  C+D +EC      +  +        C N  GS+ C   ++      + +N  +C  ID C      C+                  C  S+   Y+   C C +G+++   S C DVDECA+    + C +   C N  GSY C    +CP  +        C D +EC+     C     C+N  GSY+C C  GY     N C D++EC +      C DL ARC N  GS KC+C  GF      I  C + + C A +   C     C N +G++  C C  GY    ++   GD     C DIDEC+     C     C N  G Y C CP     D K  C+D +EC+     C+  + + +N    +N+L  ++C    C  GY K       IC  K+E +  P + DC+
Sbjct: 4393 GFYGDGLL--CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGT-TCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTCECQSGYKGTGWFCIKQTP----CDVPNACKA-NQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVGNT--CQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCTCNQE-----QMNENNSSCKPIDSCAMGLDNCDRK-------------VEDCISSKDSSYT---CQCIEGFQRINGS-CVDVDECADK--IDSCKNNATCNNMIGSYVC----KCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTN-CEDIDECAI--KTHPCHDL-ARCSNVPGSCKCKCQPGFTGDG--IYSCIETDSCPARDDVKCPTGSYC-NMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQC---HCFNGYVKIPGTQ--ICLNKNECL-NPVENDCV 4948          

HSP 8 Score: 113.235 bits (282), Expect = 8.006e-25
Identity = 137/519 (26.40%), Postives = 196/519 (37.76%), Query Frame = 3
Query: 1128 CVNTVGSFRCDCQKGFKHSKLGICEDIDECMN-VNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPE-ICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI--------PKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSN----NTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGS--YKCKCFQGYRLSISGD---TCEDIDECLLEPRKCL--NGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCV 2621
            C   +  + C C+ G++   +  C DIDEC   +N C+ ++ C N  GS+ C     C  G+  +  +  C   + C      ICGP   C                           +CK G+     +  C+D++EC          C     C N PGSY C         P+ KC                D+CK    +C+  E+C  +     C    C  S+                   ++ C  V++  +N     CG+   C    G   C     C  G +       C DVDEC  G+  CP N  C N  GS+ C C+ G+    N    ++C D++ECLL    ESC      C NT GS+KC+C  GF         C   ++C     C +   C+  V S  Y+C+C        SGD   +C   + C +  +     N IC  V   Y C CP GF  D    C DIDEC+          +  +   C+N  G Y CV
Sbjct: 3920 CEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTC----SCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYIC---------------------------QCKSGYEINP-SGMCQDVNECQTQ-----SPCHILAQCINTPGSYKCQCPENFYGDPQNKCFE--------------DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEIL----------------INNECLPVNQVCQNIN---CGNHAFCKIENGRADCF----CDSGYYGDGEL--CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLL---SESCA-TNGECQNTIGSFKCECKDGFIGDGK--YDCRIDSKCEKYGGCHEDASCIVNVESSIYECQC----HTEFSGDGITSCIKNNLCFVNGKSSCHENAICEQVNATYRCICPDGFQGDGYNFCNDIDECAN-----DNTHNCSSLEKCVNSNGQYNCV 4347          

HSP 9 Score: 103.219 bits (256), Expect = 8.750e-22
Identity = 160/577 (27.73%), Postives = 228/577 (39.51%), Query Frame = 3
Query: 1071 CGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICE---DIDECMNVNICSD----------------------DKKCKNNVGSYKCIRSIP-------CGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGIC---------SRCKDGFYFKKETRSC------EDIDECTMN-----VGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI-ACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKC--------------------MCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHC-VNVVGSY--KCMCDRGYILTSNNTCADVNECLLFRPEESCPDL----EARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAAN-PCGKKHQCVNTVGSYKCKC---FQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEG 2549
            C + +ECE+  +C      C++T GSF C C +G+    +   +   D D C   N C+D                      D++C+N V     I SI        C  G     D++ C+D+DEC    + C     C N  GS+ C+     +++ ++ K +C           C  G Y    + SC      +  D+  +N          G C     C      Y C    KC+PG      GI +C DIDEC      C  +E C NT  S+ C    C      + S G C                     C+ GY  N   +C DV+EC      + C  L  CIN PGSY C    +CP   F     + C + D+C+T   +C     C +++ GS   K  C+   IL  NN C  VN+         C ++     A C    G   C C  G+ + D  +  C D++EC   +  C     C N  GS+ C C   FQ    ++  D+C DIDECLL      NG C N  G ++C+C  GF  D K  C+   +C    G
Sbjct: 3699 CINTDECESQTSCDVNAN-CIDTHGSFICYCNEGYIGDGINCFKKDTDTDACQIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCEN-VCPKNAICSISSGSPVCSCSVGTSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGK-VCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYIC----KCKPG--YEGVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTC---SCKRGYSRNSSSGLCETNNVCNCGSHGICGPNYICQCKSGYEINPSGMCQDVNECQT---QSPCHILAQCINTPGSYKC----QCPEN-FYGDPQNKCFE-DKCKTKALQCQAGEVCKLSLYGSVCEKISCNSSEILI-NNECLPVNQ--------VCQNINCGNHAFCKIENGRADCFCDSGY-YGDGEL--CVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDECLLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGG 4242          

HSP 10 Score: 62.7734 bits (151), Expect = 1.604e-9
Identity = 41/99 (41.41%), Postives = 49/99 (49.49%), Query Frame = 3
Query: 1968 GMFRSSMYSN---CQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYP 2255
            G+  + MYSN   C D DEC     KCP    C N  GS+ C C  G++  +   C D+NEC L     S  D  A C+NT GSY C C  GF  S  P
Sbjct: 2685 GLGGNEMYSNGRSCIDDDECALL--KCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSL---NSSICDANADCINTYGSYICNCKPGFRGSGNP 2778          

HSP 11 Score: 62.7734 bits (151), Expect = 1.948e-9
Identity = 48/136 (35.29%), Postives = 64/136 (47.06%), Query Frame = 3
Query: 1995 NCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP------------CGKKHQCVNTV-GSYKCKCFQG 2363
            NC D+DEC  G   C  N  CVN +G+Y C+C  G++    N C D NEC     + +     A C NT GSYKC C  G+E +      C+ I   +A NP            C +   CV+   GS+ C C +G
Sbjct:  528 NCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNEC---ESKTANCSAYATCYNTFGSYKCICQNGYEGNG---SICSQI-PIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTCDCTEG 655          

HSP 12 Score: 61.2326 bits (147), Expect = 4.563e-9
Identity = 63/219 (28.77%), Postives = 100/219 (45.66%), Query Frame = 3
Query: 2271 DINECLA-ANPCGKKHQCVNTVGSYKCKCFQGYR------LSISGDTCEDIDECLLEPRKCLN-GICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNGFICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFN-MSHMPMGSSRINLKV---KYALNSNTNQSV 2891
            D NEC    + C     C N    ++C C +G++      +  +G +C D DEC L   KC +   C N PG + C C  GF      +C DI+ECS +  +C   +D      CIN  G Y C   +C  G+  + +GN   CE  + +IC      C  + P+ +S++   +    + + T+ R    + +P+ SS  N +V    +  N+ TN  V
Sbjct: 2651 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECAL--LKCPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSICDANAD------CINTYGSYIC---NCKPGF--RGSGNPGDCE--AVAIC-----GCWGD-PHCLSFDGNWLHYQGRCKYTLVRDECRNGLPIESSTANFEVIMKNWDQNTGTNSMV 2848          

HSP 13 Score: 58.151 bits (139), Expect = 4.479e-8
Identity = 60/200 (30.00%), Postives = 86/200 (43.00%), Query Frame = 3
Query: 1476 RCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAEN--------GGDNLCGSLYICINHP-GSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQN 2048
            RCK G+  + +  +C DIDEC+   G Y   C +   C N  G+Y+C+    C+ G V   NG+ C D +EC+     C     C NT+ SY                  KC+C++GY  N  SIC+ +   A N          D  C  L  C++H  GS+ C    +C  G F   +    Q  ++       CPQN
Sbjct:  517 RCKKGYEGRAD--NCTDIDECSR--GSY--VCSDNGDCVNQLGTYNCL----CKTGFV--GNGLNCTDFNECESKTANCSAYATCYNTFGSY------------------KCICQNGYEGN-GSICSQIPIIAVNPDQTNCSFHQDASCDQLATCVDHADGSFTC----DCTEGSFGDGL----QGANQTGCTYYPCPQN 677          

HSP 14 Score: 56.6102 bits (135), Expect = 1.211e-7
Identity = 79/277 (28.52%), Postives = 107/277 (38.63%), Query Frame = 3
Query: 2034 KCPQNMHCVN--VVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRLCINLLG--YYKC-VNSSCPVGYTKKETGNGFICELKSESICE------PNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPM 2828
            +C +   C N    G  +C C +GY   ++N C D++EC   R    C D    CVN  G+Y C C  GF  +      CTD NEC +    C     C NT GSYKC C  GY    +G  C  I      P   +N      P +  C      + D+   C  +D    S      E  F +G    N  G  YY C  NS+   GY      N    + K+E IC           + L     K   +    +S +    + SRF  S +P+
Sbjct:  498 QCHEYGECFNSTASGESECRCKKGYEGRADN-CTDIDECS--RGSYVCSD-NGDCVNQLGTYNCLCKTGFVGNGL---NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEG--NGSICSQI------PIIAVN------PDQTNCSFHQDASCDQLATC--VDHADGSFTCDCTEGSFGDGLQGANQTGCTYYPCPQNSTAFEGYCYTFPPNSAN-QAKNEEICNNLGGHLATFTNLLALNFIKEQLQIFHANSPLHIGYSSSRFANSILPL 750          

HSP 15 Score: 52.7582 bits (125), Expect = 1.765e-6
Identity = 57/198 (28.79%), Postives = 81/198 (40.91%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECM-NVNICSDDKK--CKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPK 1625
            GF+  +    C DI+EC+  N+C +   +C N  GSF C C  G+     G C DI+EC  N  IC       C N  GS++C  ++  G+        N C  V+EC      C    +CV+    + C                   CKDG Y + +   C +I+EC +        C     C +  GSY C  K
Sbjct: 5277 GFVMIENSTKCVDIDECQFPNSCLDG--LCNNLPGSFECLCNIGYDLVN-GKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNV--GYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYEC------------------ICKDG-YQEDQIGICRNINECQI-----EDSCHYLADCLDTDGSYKCTCK 5445          

HSP 16 Score: 50.447 bits (119), Expect = 9.599e-6
Identity = 44/144 (30.56%), Postives = 59/144 (40.97%), Query Frame = 3
Query: 1338 VDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASP 1769
            +D +EC      C     C N+    RC+         +  +G+      G       RSC D DEC +       +C  T  C N PGS+ C     C  G V A   + CNDI+EC      C+ +  C+NTY SY C   P
Sbjct: 2650 IDFNECSTNFHDCDLHANCTNLDSGFRCD-------CIKGWQGL-----GGNEMYSNGRSCIDDDECAL------LKCPSTSDCTNTPGSFIC----NCHVGFVKAAPTV-CNDINECSLNSSICDANADCINTYGSYICNCKP 2770          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 179.874 bits (455), Expect = 2.198e-45
Identity = 138/393 (35.11%), Postives = 192/393 (48.85%), Query Frame = 3
Query: 1479 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETD-VCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDEC--LLEPRKCLNGICVNVPGRYECKCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGY 2645
            C+ GF    + +SC+DI+EC+ N+      C E +  C N PGSY C PK  C PG   + + + C DI+EC +    C+  ++C+NT+ SY+C                  +CR GY++ ++S C D+DEC+   G   CG    C N PGS+ C     C  G     +   C D+DEC +G   C ++  C N+ GSY+C C+ G+  TS +TC DVNEC     + +       C NT GSY+C CP  F        +  D   CL      KKH+           C  G+  + S   C DIDEC     P  C    C+N  G Y C CPPGF+ + K + C D+DEC T+ G+CS +      +LCIN  G Y C+   CP  Y
Sbjct: 3681 CRSGFMLSSDGKSCQDINECSKNIS----PCSEPNHECINTPGSYMCKPK--CAPGLRRSFDKLTCGDINECVEKPNICD-SQLCINTHGSYYC------------------LCRHGYKKMKNS-CIDIDECSL--GIAKCGLHQKCRNTPGSFFC--ENLCYDGY--QLINEQCYDLDECSSGTANCSKSSTCTNLPGSYRCECNDGF-YTSGSTCIDVNEC-----QTNSSQCIYGCKNTYGSYECICPPNF-------IQSRDKKSCL------KKHEI----------CKTGFTWT-SDRGCIDIDECTSYTNPHSCQYQ-CINTYGSYHCLCPPGFSLNPKTMKCLDVDECRTNLGICSEK------KLCINTPGNYSCIEPKCPKSY 4004          

HSP 2 Score: 147.132 bits (370), Expect = 2.679e-35
Identity = 130/389 (33.42%), Postives = 179/389 (46.02%), Query Frame = 3
Query: 1041 GFLFNQFLEICGDINECETA--NACANKWEICVNTVGSFRCDCQKGFKHSKLG-ICEDIDEC-MNVNICSD-DKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRC--------------EDDECPINMK--------RNNKG--ICSR-CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKC--MCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCM---CDRGY 2102
            GF   +    C D+NEC+ A  + C    +IC NTV  F+C+C+ GF  S  G  C+DI+EC  N++ CS+ + +C N  GSY C     C  G +   D   C D++EC   P IC   + C+N  GS+ C              + DEC + +         RN  G   C   C DG+    E   C D+DEC+         C ++  C NLPGSY C    +C  G     +G  C D++EC+    +C     C NTY SY C+  P     +   S  K   +C+ G+    D  C D+DEC      + C   Y CIN  GSY C+    CPPG   +     C DVDEC T  G C +   C+N  G+Y C+   C + Y
Sbjct: 3642 GFTLIKSQRFCEDVNECKNAKLHKCD---QICENTVPRFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMC--KPKCAPGLRRSFDKLTCGDINECVEKPNICDSQL-CINTHGSYYCLCRHGYKKMKNSCIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGYQLINE--QCYDLDECSSGTA----NCSKSSTCTNLPGSYRC----ECNDG--FYTSGSTCIDVNECQTNSSQCIYG--CKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSDRGCIDIDECTSYTNPHSCQ--YQCINTYGSYHCL----CPPGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSY 4004          

HSP 3 Score: 104.375 bits (259), Expect = 3.598e-22
Identity = 93/291 (31.96%), Postives = 130/291 (44.67%), Query Frame = 3
Query: 1071 CGDINEC-ETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDEC-MNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCE--------------DDECPINMK------RNNKG----------ICSR-----------CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCM 1814
            CGDINEC E  N C +  ++C+NT GS+ C C+ G+K  K   C DIDEC + +  C   +KC+N  GS+ C      G+    +     C D+DEC +    C     C N+ GS+RCE               +EC  N        +N  G          I SR           CK GF +  + R C DIDECT     ++ + +    C N  GSY C+    C PG  L    + C D+DEC+     C   ++C+NT  +Y C+   C  S  FD  +  C+
Sbjct: 3740 CGDINECVEKPNICDS--QLCINTHGSYYCLCRHGYKKMK-NSCIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGYQLINE----QCYDLDECSSGTANCSKSSTCTNLPGSYRCECNDGFYTSGSTCIDVNECQTNSSQCIYGCKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSD-RGCIDIDECTSYTNPHSCQYQ----CINTYGSYHCL----CPPGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSYHFDIKLKACV 4014          

HSP 4 Score: 72.0182 bits (175), Expect = 2.458e-12
Identity = 55/148 (37.16%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 2223 CPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECL--LEPRKCLNGICVNVPGRYEC--KCPPGFAADRKEI-CQDIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTK 2651
            CP GF       + C D+NEC  A        C NTV  +KC C  G+ LS  G +C+DI+EC   + P    N  C+N PG Y C  KC PG      ++ C DI+EC     +C       + +LCIN  G Y C+   C  GY K
Sbjct: 3639 CPPGFTLIKSQ-RFCEDVNECKNAKLHKCDQICENTVPRFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMCKPKCAPGLRRSFDKLTCGDINECVEKPNIC-------DSQLCINTHGSYYCL---CRHGYKK 3775          
The following BLAST results are available for this feature:
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LTBP22.395e-5733.52latent transforming growth factor beta binding pro... [more]
LTBP23.817e-5733.52latent transforming growth factor beta binding pro... [more]
LTBP45.961e-5634.17latent transforming growth factor beta binding pro... [more]
LTBP46.200e-5634.17latent transforming growth factor beta binding pro... [more]
LTBP46.413e-5634.17latent transforming growth factor beta binding pro... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbl-15.608e-6730.44Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-14.794e-6230.55Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-11.370e-5529.56Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-14.647e-5129.29Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-11.098e-4330.02Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG319992.700e-5929.80gene:FBgn0051999 transcript:FBtr0344870[more]
CG319992.700e-5929.80gene:FBgn0051999 transcript:FBtr0089144[more]
frac3.138e-4831.07gene:FBgn0035798 transcript:FBtr0290277[more]
frac3.138e-4831.07gene:FBgn0035798 transcript:FBtr0301222[more]
frac3.138e-4831.07gene:FBgn0035798 transcript:FBtr0301221[more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX663503.32.548e-5832.67latent-transforming growth factor beta-binding pro... [more]
si:dkey-30j22.13.849e-5731.64si:dkey-30j22.1 [Source:ZFIN;Acc:ZDB-GENE-041001-1... [more]
hmcn26.736e-5630.72hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765... [more]
BX663503.32.129e-5536.01latent-transforming growth factor beta-binding pro... [more]
si:ch73-105b23.12.440e-5534.80si:ch73-105b23.1 [Source:ZFIN;Acc:ZDB-GENE-081107-... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000044417.19.820e-6136.05pep primary_assembly:Xenopus_tropicalis_v9.1:5:166... [more]
ENSXETT00000044344.11.050e-5935.20pep primary_assembly:Xenopus_tropicalis_v9.1:5:166... [more]
ENSXETT00000044357.11.413e-5932.46pep primary_assembly:Xenopus_tropicalis_v9.1:5:166... [more]
FBN21.290e-5433.50fibrillin 2 (congenital contractural arachnodactyl... [more]
ENSXETT00000044459.19.204e-5432.70pep primary_assembly:Xenopus_tropicalis_v9.1:5:166... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ltbp48.746e-5834.94latent transforming growth factor beta binding pro... [more]
Ltbp42.751e-5734.94latent transforming growth factor beta binding pro... [more]
Ltbp43.199e-5734.94latent transforming growth factor beta binding pro... [more]
Ltbp43.734e-5734.94latent transforming growth factor beta binding pro... [more]
Ltbp43.742e-5734.94latent transforming growth factor beta binding pro... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14767|LTBP2_HUMAN1.833e-5633.52Latent-transforming growth factor beta-binding pro... [more]
sp|Q8K4G1|LTBP4_MOUSE1.924e-5634.94Latent-transforming growth factor beta-binding pro... [more]
sp|Q8N2S1|LTBP4_HUMAN3.080e-5534.17Latent-transforming growth factor beta-binding pro... [more]
sp|Q61555|FBN2_MOUSE3.210e-5533.33Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 ... [more]
sp|P35556|FBN2_HUMAN8.736e-5533.18Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 S... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RDM70.000e+040.55Fibulin-2 OS=Fasciola hepatica OX=6192 GN=D915_004... [more]
A0A087W1G00.000e+039.69Fibulin OS=Echinococcus multilocularis OX=6211 GN=... [more]
A0A4S2LUA00.000e+036.01Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A068WQV00.000e+039.79Fibulin OS=Echinococcus granulosus OX=6210 GN=EgrG... [more]
A0A074ZJX65.942e-18040.05Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000010369.21.180e-5730.18pep primary_assembly:Astyanax_mexicanus-2.0:3:7287... [more]
fbln15.351e-5633.62fibulin 1 [Source:NCBI gene;Acc:30240][more]
fbln16.311e-5631.27fibulin 1 [Source:NCBI gene;Acc:30240][more]
fbln11.203e-5531.27fibulin 1 [Source:NCBI gene;Acc:30240][more]
fbn2a2.469e-5532.75fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4][more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002704.11.147e-5532.60pep scaffold:Pmarinus_7.0:GL476354:513769:588114:-... [more]
ENSPMAT00000006555.18.033e-5532.95pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-... [more]
ENSPMAT00000010139.19.137e-4935.52pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 ... [more]
ENSPMAT00000008854.19.196e-4831.64pep scaffold:Pmarinus_7.0:GL476328:1008604:1022137... [more]
ENSPMAT00000000017.13.026e-4730.81pep scaffold:Pmarinus_7.0:GL477746:39241:65692:1 g... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO277421.285e-6335.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444174.270e-6230.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297647.985e-6234.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332953.149e-6130.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443986.523e-6134.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBLN11.148e-6828.30fibulin 1 [Source:NCBI gene;Acc:101160948][more]
FBLN11.081e-6728.35fibulin 1 [Source:NCBI gene;Acc:101160948][more]
FBLN22.201e-6533.28fibulin-2 [Source:NCBI gene;Acc:101172410][more]
FBLN22.201e-6533.28fibulin-2 [Source:NCBI gene;Acc:101172410][more]
FBLN12.177e-6235.21fibulin 1 [Source:NCBI gene;Acc:101160948][more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032548.10.000e+099.49SMESG000032548.1[more]
SMESG000032551.14.715e-5228.52SMESG000032551.1[more]
SMESG000032551.11.315e-5128.52SMESG000032551.1[more]
SMESG000076582.11.077e-4631.11SMESG000076582.1[more]
SMESG000021248.12.198e-4535.11SMESG000021248.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015090 ID=SMED30015090|Name=Latent-transforming growth factor beta-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3132bp
CCATATTTGACTGTTGATTTTATAATCCGTCAGTGTTCACTATATTTTTA
ATTTCAGTTTTAGTTTCAACATTTTCATTTCGTCCGTTTTATCATTTTAC
CTGTTAATTTCTTTGGAAAATGATTTTGGAAATAATCTTGATCTTTCTGG
TTTTAAACGCCTGTAACAGTCAGATAAATTATCAAACTTGCTGTCATAGT
GGGATAGAGAAGGCAGAAATGGCCATAAAAAATGTGACCCTTTCCAATAC
TCATTTATCAACCATGTGTACGTTCAAATCCATTGGAAGTCACTTGGAAA
GAACTAACAGGTCCAGATCTTTTATATGTGTTCTGTTTGCTAGGTCGTGC
TGCATAAAGGTCTACTCGGCCAAAATTTGTCAACTAGGTTCCTCACAAAC
GGAGAGCTGCGAGAAATATATTTCTGATTTGTCCCCGGTGCTCAACCAGA
TAAAAATGGAATGCTGTATGTGCTGTAAGCATGGGAATGGGGGCCTACTC
TTTGAAAGTTGTTCCATGTTGAAGGGCAACTGTTCGAGAACAAGAAATAA
AGACAGCTCTAGATCTTTGGGGACCTCCGCCACGCCATCGCCAAACCGGC
TGTTCTCAGCTCAAATTCATTCATATCAACCGAGGCCCACCAAAGCAACT
GTTACAAACGAATCGTCAGTAGAAGACATTTCAAATGGGAATGCAGAAAA
TAACAATACAGTCGGATGGGAGACCTCGAGCACTACATTTACTTTGTCTC
CCTTTACTTCGGGTAAAACTACCGAAATTTCTATGAAATCGACTAGAAAA
ATGTCGCAAATCTCCCTGAAGGCAAACCCAATGACAACTACAAGTGATGC
AACATCAGCCTTATTGAAAATATCACAAACAACTTCAAGTCCGACGGTTC
TCTGTGACCAAGGAAAGAAGTGGGAGCCCCTGTTACATGTCTGCGTGCAG
TTGATCATTTCTTGTCCTAAGAATTTCATTTTACATCCCAACACCAGCAA
ATGTGTTCCTGTGGTCAAACCAAAGGTACCTTGTAGCAAGGGGTTCCTAT
TCAATCAGTTTTTGGAAATTTGTGGAGACATCAACGAATGTGAAACGGCA
AATGCATGCGCCAACAAATGGGAAATTTGTGTGAATACCGTTGGGTCTTT
CAGGTGTGATTGTCAGAAAGGTTTCAAGCACAGCAAACTTGGAATTTGCG
AAGATATAGATGAATGTATGAACGTGAATATCTGTTCGGATGACAAGAAA
TGTAAGAACAATGTGGGATCATACAAATGTATCCGATCAATTCCTTGTGG
ATTTGGGTGGAAAGAAGATCCAGATACCAATGACTGCGTCGATGTGGACG
AATGTGAAGCGTTCCCAGAGATTTGCGGACCCGGCATGAAGTGCGTCAAC
ATCAGAGGAAGTCACCGATGCGAGGACGACGAGTGCCCAATAAACATGAA
GAGAAATAATAAAGGTATTTGCTCAAGATGCAAAGATGGCTTTTATTTTA
AAAAGGAAACTCGATCTTGTGAAGACATAGACGAGTGCACCATGAACGTG
GGGTGGTATAACGGGCGGTGTAAGGAAACTGATGTCTGTTTCAATCTGCC
CGGTTCATACGACTGCATTCCAAAAAAGAAATGCCGCCCAGGAACAGTTT
TGGCACAAAACGGAATCGCCTGTAACGATATTGACGAGTGCAAACAAATG
AAATTTCGATGCGAGCCTGACGAAATTTGCGTCAACACTTACTCTTCATA
TCATTGCGTTGCCTCTCCATGCGCTCCATCGCAACAATTCGACTATTCCG
TGGGGAAATGTATGTGTAGAGACGGATACCGTCAGAATCAGGACAGCATT
TGCACAGATGTTGATGAATGCGCAGAGAACGGAGGCGACAATTTATGCGG
CTCTCTCTATATCTGCATAAACCATCCAGGATCTTACGCATGTATTCAAC
GGGCGGAATGTCCGCCGGGAATGTTCCGATCGTCAATGTACTCCAATTGT
CAAGATGTAGATGAATGCGAAACCGGGGAGGGCAAATGTCCACAGAACAT
GCACTGTGTAAATGTCGTCGGATCATACAAGTGCATGTGCGACCGGGGAT
ATATTTTGACCTCCAATAATACATGTGCAGATGTAAATGAATGTCTGCTA
TTCCGTCCGGAAGAATCATGTCCAGATCTGGAAGCGCGTTGCGTCAATAC
GGCAGGTAGCTACAAGTGTCAATGTCCGAAAGGCTTTGAATGGTCCGATT
ATCCAATTAAAAAATGCACCGATATCAATGAATGCCTTGCAGCAAATCCT
TGCGGAAAGAAGCATCAATGCGTCAACACGGTTGGTAGTTACAAGTGCAA
ATGCTTTCAAGGTTATAGACTTTCAATTTCCGGTGATACTTGCGAAGATA
TTGACGAGTGTCTCCTTGAGCCAAGAAAGTGTCTGAATGGAATTTGTGTA
AATGTTCCCGGTCGCTACGAATGCAAATGCCCTCCGGGTTTTGCAGCTGA
TAGAAAAGAAATATGCCAAGACATTGATGAATGCTCAACTTCCGAAGGGG
TCTGCTCAAGAGAGAGTGATTTCCAAAATGGGAGATTATGCATAAACCTC
CTTGGATATTACAAATGTGTCAACAGTTCTTGTCCAGTAGGTTACACGAA
GAAGGAAACAGGAAATGGATTTATCTGTGAACTGAAATCCGAAAGCATTT
GCGAACCGAATGATGCTGACTGTTTGAATGAAAAGCCTTACAAAATATCC
TACGAATTCATCGAGATCTCGTCGGATATAAAGTTTCGTCGAACGATATC
AAGGTTCAACATGTCCCATATGCCAATGGGGTCCAGTCGTATCAATTTGA
AAGTAAAATACGCGCTTAACTCTAACACAAACCAGTCGGTTTATGTTAAA
AACGTGTTCCATTTAGACAAGGACCGCTACGACCCGGGCAATATTGAAGT
GATTATGAAGAAAATGATTAATCCTCCTGTTGAAATTCTGCTTTACCTAG
ACGTTAAGAAATACCACCAAGAGATGTTTCTAGGGCATTCAGAAAGCTTC
ATAAACTTGTATCTGACGAGATATCCGTCAAATTAGAACTTTGTCTATTA
ATGTCGGTCAAAATATATATTCAGAAGGGCGC
back to top

protein sequence of SMED30015090-orf-1

>SMED30015090-orf-1 ID=SMED30015090-orf-1|Name=SMED30015090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=989bp
MILEIILIFLVLNACNSQINYQTCCHSGIEKAEMAIKNVTLSNTHLSTMC
TFKSIGSHLERTNRSRSFICVLFARSCCIKVYSAKICQLGSSQTESCEKY
ISDLSPVLNQIKMECCMCCKHGNGGLLFESCSMLKGNCSRTRNKDSSRSL
GTSATPSPNRLFSAQIHSYQPRPTKATVTNESSVEDISNGNAENNNTVGW
ETSSTTFTLSPFTSGKTTEISMKSTRKMSQISLKANPMTTTSDATSALLK
ISQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTSKCVPVVK
PKVPCSKGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQK
GFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKED
PDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGI
CSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCI
PKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASP
CAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICI
NHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVV
GSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKC
QCPKGFEWSDYPIKKCTDINECLAANPCGKKHQCVNTVGSYKCKCFQGYR
LSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQ
DIDECSTSEGVCSRESDFQNGRLCINLLGYYKCVNSSCPVGYTKKETGNG
FICELKSESICEPNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSH
MPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMI
NPPVEILLYLDVKKYHQEMFLGHSESFINLYLTRYPSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030198extracellular matrix organization
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR018097EGF_Ca-bd_CS
IPR013032EGF-like_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 520..565
e-value: 0.0022
score: 23.3
coord: 718..759
e-value: 1.2E-11
score: 54.7
coord: 801..854
e-value: 0.0017
score: 24.1
coord: 408..455
e-value: 0.002
score: 23.5
coord: 362..407
e-value: 3.4E-4
score: 29.8
coord: 671..717
e-value: 5.3E-9
score: 45.9
coord: 629..670
e-value: 1.4E-8
score: 44.5
coord: 320..361
e-value: 2.0E-9
score: 47.3
coord: 760..800
e-value: 5.9E-12
score: 55.7
coord: 469..519
e-value: 0.0019
score: 23.7
coord: 580..628
e-value: 8.5E-6
score: 35.3
IPR001881EGF-like calcium-binding domainPFAMPF07645EGF_CAcoord: 760..795
e-value: 1.1E-7
score: 31.9
coord: 520..554
e-value: 2.4E-4
score: 21.2
coord: 362..406
e-value: 6.1E-7
score: 29.5
coord: 801..847
e-value: 8.9E-6
score: 25.8
coord: 408..446
e-value: 3.7E-4
score: 20.6
coord: 671..712
e-value: 3.2E-9
score: 36.8
coord: 469..510
e-value: 2.9E-4
score: 21.0
coord: 718..758
e-value: 2.7E-9
score: 37.1
coord: 580..618
e-value: 4.5E-5
score: 23.6
coord: 320..354
e-value: 1.7E-8
score: 34.5
coord: 629..669
e-value: 3.0E-11
score: 43.3
IPR000742EGF-like domainSMARTSM00181egf_5coord: 632..670
e-value: 0.0019
score: 27.5
coord: 674..717
e-value: 6.4
score: 15.7
coord: 365..407
e-value: 48.0
score: 8.2
coord: 323..361
e-value: 0.26
score: 20.3
coord: 763..800
e-value: 1.2E-5
score: 34.7
coord: 411..468
e-value: 30.0
score: 10.5
coord: 523..579
e-value: 74.0
score: 6.1
coord: 472..519
e-value: 170.0
score: 1.9
coord: 583..628
e-value: 32.0
score: 10.3
coord: 721..759
e-value: 2.9E-4
score: 30.2
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 718..759
score: 14.6
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 629..670
score: 11.553
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 320..361
score: 10.35
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 760..800
score: 12.592
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 671..717
score: 7.716
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 521..579
e-value: 2.6E-5
score: 26.9
coord: 409..469
e-value: 2.4E-6
score: 30.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 363..408
e-value: 1.5E-7
score: 33.5
coord: 470..520
e-value: 4.5E-9
score: 38.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 319..362
e-value: 2.9E-11
score: 45.2
coord: 718..760
e-value: 2.0E-14
score: 55.4
coord: 671..717
e-value: 2.7E-11
score: 45.3
coord: 761..798
e-value: 1.3E-12
score: 49.5
coord: 580..625
e-value: 6.1E-9
score: 37.8
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 626..670
e-value: 1.2E-10
score: 43.1
coord: 799..849
e-value: 1.3E-6
score: 30.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 218..239
NoneNo IPR availablePANTHERPTHR24034:SF59RE68558Pcoord: 481..620
NoneNo IPR availablePANTHERPTHR24034FAMILY NOT NAMEDcoord: 561..758
NoneNo IPR availablePANTHERPTHR24034FAMILY NOT NAMEDcoord: 190..435
NoneNo IPR availablePANTHERPTHR24034:SF59RE68558Pcoord: 561..758
NoneNo IPR availablePANTHERPTHR24034FAMILY NOT NAMEDcoord: 481..620
NoneNo IPR availablePANTHERPTHR24034:SF59RE68558Pcoord: 190..435
NoneNo IPR availablePANTHERPTHR24034FAMILY NOT NAMEDcoord: 628..922
NoneNo IPR availablePANTHERPTHR24034:SF59RE68558Pcoord: 628..922
NoneNo IPR availableCDDcd00054EGF_CAcoord: 718..759
e-value: 3.52076E-8
score: 48.0166
NoneNo IPR availableCDDcd00054EGF_CAcoord: 760..791
e-value: 1.89358E-4
score: 37.6162
NoneNo IPR availableCDDcd00054EGF_CAcoord: 629..665
e-value: 8.96483E-5
score: 38.3866
NoneNo IPR availableCDDcd00054EGF_CAcoord: 671..707
e-value: 4.20315E-4
score: 36.8458
NoneNo IPR availableCDDcd00054EGF_CAcoord: 580..617
e-value: 0.00902018
score: 32.9938
NoneNo IPR availableCDDcd00054EGF_CAcoord: 320..352
e-value: 1.07259E-5
score: 41.083
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.799
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 629..655
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 718..743
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 362..387
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 655..669
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 785..799
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 743..758
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 346..360
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 734..745
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 646..657
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 691..702
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 337..348
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 776..787
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 716..865
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 613..718
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 262..408
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 372..520