Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30015083
Length (bp)2027
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015083

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30015083SMESG000050487.1 Contig4734_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 425.246 bits (1092), Expect = 1.126e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 425.246 bits (1092), Expect = 1.126e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 424.861 bits (1091), Expect = 1.890e-142
Identity = 202/432 (46.76%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG  S++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3D (tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:24071])

HSP 1 Score: 424.861 bits (1091), Expect = 1.890e-142
Identity = 202/432 (46.76%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG  S++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1B (tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:18809])

HSP 1 Score: 422.55 bits (1085), Expect = 1.151e-141
Identity = 204/432 (47.22%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++ Q+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: mec-12 (Tubulin alpha-3 chain Detyrosinated tubulin alpha-3 chain [Source:UniProtKB/Swiss-Prot;Acc:P91910])

HSP 1 Score: 422.165 bits (1084), Expect = 6.067e-142
Identity = 205/440 (46.59%), Postives = 298/440 (67.73%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLG 1361
            H+GQAG QIG + WEL C EHGIQ DG+   D+    SD SF++FF E+ SG++VPR + +DLEPTVI++++ G+YR L+HP QLI+G +D+++N++R   T+G+ I     +++R+  ++C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE P+ T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL +F+P+ +  +  HE+ S+ ++T   FE   Q+V CDP  GKYM   L+FRG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + + P +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+    G  G
Sbjct:    8 HIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSMEDNGEEG 447          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 421.779 bits (1083), Expect = 8.108e-142
Identity = 199/430 (46.28%), Postives = 293/430 (68.14%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG       +   SF +FF ++ SG+YVPR +F+DLEPTV+++++ G+Y+KL+HP Q+I+G +D+++N++R   TVG+ +  ++ +++R+  ++C  +Q    + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L +E P+ T++NRI+ QV S+ITAS RF   +  D+N   TNLVPYPRIHFPL ++ PL +  +  HE  S++D+T + FE   Q+V CDP  GKYM   L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + + P +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 421.779 bits (1083), Expect = 8.108e-142
Identity = 199/430 (46.28%), Postives = 293/430 (68.14%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG       +   SF +FF ++ SG+YVPR +F+DLEPTV+++++ G+Y+KL+HP Q+I+G +D+++N++R   TVG+ +  ++ +++R+  ++C  +Q    + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L +E P+ T++NRI+ QV S+ITAS RF   +  D+N   TNLVPYPRIHFPL ++ PL +  +  HE  S++D+T + FE   Q+V CDP  GKYM   L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + + P +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 421.779 bits (1083), Expect = 8.108e-142
Identity = 199/430 (46.28%), Postives = 293/430 (68.14%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG       +   SF +FF ++ SG+YVPR +F+DLEPTV+++++ G+Y+KL+HP Q+I+G +D+++N++R   TVG+ +  ++ +++R+  ++C  +Q    + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L +E P+ T++NRI+ QV S+ITAS RF   +  D+N   TNLVPYPRIHFPL ++ PL +  +  HE  S++D+T + FE   Q+V CDP  GKYM   L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + + P +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 421.394 bits (1082), Expect = 1.424e-141
Identity = 198/430 (46.05%), Postives = 294/430 (68.37%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG    D++    SF +FF ++ +G+YVPR +F+DLEPTV+++++ G+Y+KL+HP Q+I+G +D+++N++R   TVG+ +  ++ +++R+  ++C  +Q    + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L ++ P+ T++NRI+ QV S+ITAS RF   +  D+N   TNLVPYPRIHFPL ++ PL +  +  HE  S+ D+T + FE   Q+V CDP  GKYM   L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + + P +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLSVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISADKAYHEALSVNDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 423.705 bits (1088), Expect = 2.015e-142
Identity = 202/432 (46.76%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV +D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 421.779 bits (1083), Expect = 1.292e-141
Identity = 199/432 (46.06%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            H+GQAG QIG + WEL C EHGIQ DG    D+     D SF++FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT  ++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ ++ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV +D+
Sbjct:    8 HIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGIDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 419.853 bits (1078), Expect = 6.687e-141
Identity = 200/432 (46.30%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF ++P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V  DP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV +D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 386.341 bits (991), Expect = 1.321e-127
Identity = 190/442 (42.99%), Postives = 284/442 (64.25%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGK-------------CTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVD 1334
             +GQ G QIG + WEL   EHGI  DG               ++  + S     +FF E+ +G+ VPR +F+DLEPTVI+ ++ G  R+LYHP QLISG +D+++N++R   ++G+ +   + ++L+K  E CD +Q  L + SL GG+GSG TS++ E L  DY K  K +F ++PSP   + VV PYN++L  H  M+  D   ++DNEA++DIC N LG++ P   ++NR++ Q+ S+ TAS RF   M  D+N   TNLVP+PRIHFPL ++APL +  +  HE+++IT LT A FE    +V CDP  GK+M C +++RG V   +V + +S IKS ++ +FVDWCPTGFK+GI  + P  +P   + +T  +  M++N++A+S  +  LS KF  ++ KR+F+HW+V EG+EE EF EA  NIA L +D+EEV +D
Sbjct:    8 QIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDARTFFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEVGLD 449          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 346.28 bits (887), Expect = 3.251e-112
Identity = 185/428 (43.22%), Postives = 260/428 (60.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFF-LESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFE-LLEDY-KKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEV 1325
            H+GQAG QI  + WEL C EHGI  +G+ T  +   D SF +FF   SH     PR + ID EPTVI++++ GSYR L+HP  LI+G DDS SNF+R +N +   +     N +R+  + C  ++  L +R++ GGSGSGL + I E L+ED+ KK    EF ++PSP     +V PYN++L  HF M+  DV  ++DNEAL+DIC N L +  PT T++NRI+ QV S+ TAS RF          + TNLVPYPRIH+PL ++APL   +       S   LT   F+   Q+V C+P+ GKYM   L++RG +  +E+ + L  IK ++  RFVDW PTGFK+G+   PP  +P   +  T  + V ++N++ +   W RL  KF +LY +R+F++ +V EGLEE  F EA  NI  L  DY EV
Sbjct:   11 HIGQAGVQIANACWELFCLEHGILANGRLT--QSPMDDSFLTFFEFTSHQPCVQPRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAISNNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEGLEEGNFNEASENICQLVHDYLEV 436          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8])

HSP 1 Score: 432.565 bits (1111), Expect = 1.041e-145
Identity = 209/432 (48.38%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   DR     D SF +FF E+ SG++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I  S+ +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ D+T A FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGAQIGNACWELYCLEHGIQPDGQMPSDRSIGGGDDSFNTFFSETASGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDSVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8])

HSP 1 Score: 432.18 bits (1110), Expect = 3.951e-145
Identity = 209/432 (48.38%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   DR     D SF +FF E+ SG++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I  S+ +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ D+T A FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:   36 HVGQAGAQIGNACWELYCLEHGIQPDGQMPSDRSIGGGDDSFNTFFSETASGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDSVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDS 467          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba7l (tubulin, alpha 7 like [Source:ZFIN;Acc:ZDB-GENE-040704-78])

HSP 1 Score: 427.557 bits (1098), Expect = 1.056e-143
Identity = 203/432 (46.99%), Postives = 295/432 (68.29%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDS--DRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG    D   S  D+SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG  S++ E L  DY K  K EF ++P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + +  IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VDT
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQADGHMPSDHTTSGGDQSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRVRKLCDQCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKAKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVVEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIGSIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGVDT 439          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l3 (tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-040801-77])

HSP 1 Score: 426.017 bits (1094), Expect = 3.822e-143
Identity = 205/432 (47.45%), Postives = 295/432 (68.29%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG Q+G + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + ++ RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ D+T A FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1a (tubulin, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-090507-4])

HSP 1 Score: 425.246 bits (1092), Expect = 7.810e-143
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 425.246 bits (1092), Expect = 1.021e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 424.476 bits (1090), Expect = 1.911e-142
Identity = 204/432 (47.22%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S++++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: ENSXETT00000053522.1 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:100497157])

HSP 1 Score: 424.091 bits (1089), Expect = 2.727e-142
Identity = 203/432 (46.99%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S++++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ +K+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    7 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATVKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: ccdc171 (coiled-coil domain containing 171 [Source:Xenbase;Acc:XB-GENE-1003303])

HSP 1 Score: 424.091 bits (1089), Expect = 2.727e-142
Identity = 203/432 (46.99%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S++++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ +K+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    7 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATVKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 423.705 bits (1088), Expect = 3.985e-142
Identity = 203/432 (46.99%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S++++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 425.246 bits (1092), Expect = 7.730e-143
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406])

HSP 1 Score: 424.861 bits (1091), Expect = 1.298e-142
Identity = 202/432 (46.76%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG  S++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3b (tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:1095408])

HSP 1 Score: 424.861 bits (1091), Expect = 1.298e-142
Identity = 202/432 (46.76%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG  S++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 422.55 bits (1085), Expect = 7.899e-142
Identity = 204/432 (47.22%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++ Q+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 421.394 bits (1082), Expect = 1.974e-141
Identity = 207/449 (46.10%), Postives = 300/449 (66.82%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLGKNDLDVGEE 1388
            HVGQAG Q+G + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++ Q+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV +D+          D D GEE
Sbjct:    8 HVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDS--------YEDEDEGEE 448          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68370|TBA1A_RAT (Tubulin alpha-1A chain OS=Rattus norvegicus OX=10116 GN=Tuba1a PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 5.407e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|A5A6J1|TBA1A_PANTR (Tubulin alpha-1A chain OS=Pan troglodytes OX=9598 GN=TUBA1A PE=2 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 5.407e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68369|TBA1A_MOUSE (Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 5.407e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q71U36|TBA1A_HUMAN (Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 5.407e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68362|TBA1A_CRIGR (Tubulin alpha-1A chain OS=Cricetulus griseus OX=10029 GN=TUBA1A PE=2 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 5.407e-142
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: H2KQ69 (Tubulin alpha chain (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_103359 PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 1.432e-152
Identity = 221/430 (51.40%), Postives = 314/430 (73.02%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            HVGQAG Q+G +IWEL CAEH I  DG+ T    + +   ++FF +S  GQ+VPR LFIDLEP+V+++++ G +RKLYHP +LI+G +D+++NF+R F T+G+L+   I +++R+ +ESC+  Q ++ YRSL GG+G+GLT+ + +++ D+ K  K E P++PSP   + +V PYNS+LGEHF ME+  +GLL+DNEAL+DIC   LG+   T TSINR++ Q  S ITAS RF + +  DIN + TNLVPYPRIHFPL++FAP  +  + +HE  +  +LT AVF+RE Q+V  DP  GK+M+C+L++RG V+ S VY  L+ +KSS+   FVDWCPTGFKVG+   PP+ +P S + +   +VVM+ N+S+V   WQRL+ KF+ LYSKRSF+HWF+ EG+EESEF +AL N+ SL KDYEE S ++K
Sbjct:    8 HVGQAGVQMGNAIWELYCAEHAIGLDGQPTQAPLEQECQ-STFFQQSPKGQHVPRALFIDLEPSVVDEIRVGPWRKLYHPDRLITGYEDAANNFARGFFTIGKLLIAPILSEIRRSLESCEAPQGIILYRSLGGGTGAGLTAALLDVMPDFHKLTKIEIPVYPSPSLSNSLVEPYNSLLGEHFAMEDIQLGLLMDNEALYDICGRYLGLTVTTYTSINRLIAQATSAITASLRFPNILNGDINVIQTNLVPYPRIHFPLSNFAPCISWEKAEHETLTTRELTLAVFDRENQMVKVDPTYGKFMSCTLLYRGDVSPSHVYQALTELKSSRCIEFVDWCPTGFKVGLTSSPPVSVPDSRVAQCDKNVVMLANNSSVGQAWQRLTHKFYLLYSKRSFVHWFIGEGMEESEFNDALINMTSLVKDYEEASGESK 436          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A3R7GY66 (Tubulin alpha chain OS=Clonorchis sinensis OX=79923 GN=tuba PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 1.463e-152
Identity = 221/430 (51.40%), Postives = 314/430 (73.02%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            HVGQAG Q+G +IWEL CAEH I  DG+ T    + +   ++FF +S  GQ+VPR LFIDLEP+V+++++ G +RKLYHP +LI+G +D+++NF+R F T+G+L+   I +++R+ +ESC+  Q ++ YRSL GG+G+GLT+ + +++ D+ K  K E P++PSP   + +V PYNS+LGEHF ME+  +GLL+DNEAL+DIC   LG+   T TSINR++ Q  S ITAS RF + +  DIN + TNLVPYPRIHFPL++FAP  +  + +HE  +  +LT AVF+RE Q+V  DP  GK+M+C+L++RG V+ S VY  L+ +KSS+   FVDWCPTGFKVG+   PP+ +P S + +   +VVM+ N+S+V   WQRL+ KF+ LYSKRSF+HWF+ EG+EESEF +AL N+ SL KDYEE S ++K
Sbjct:    8 HVGQAGVQMGNAIWELYCAEHAIGLDGQPTQAPLEQECQ-STFFQQSPKGQHVPRALFIDLEPSVVDEIRVGPWRKLYHPDRLITGYEDAANNFARGFFTIGKLLIAPILSEIRRSLESCEAPQGIILYRSLGGGTGAGLTAALLDVMPDFHKLTKIEIPVYPSPSLSNSLVEPYNSLLGEHFAMEDIQLGLLMDNEALYDICGRYLGLTVTTYTSINRLIAQATSAITASLRFPNILNGDINVIQTNLVPYPRIHFPLSNFAPCISWEKAEHETLTTRELTLAVFDRENQMVKVDPTYGKFMSCTLLYRGDVSPSHVYQALTELKSSRCIEFVDWCPTGFKVGLTSSPPVSVPDSRVAQCDKNVVMLANNSSVGQAWQRLTHKFYLLYSKRSFVHWFIGEGMEESEFNDALINMTSLVKDYEEASGESK 436          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A5J4NYS2 (Tubulin alpha chain OS=Paragonimus westermani OX=34504 GN=DEA37_0012854 PE=3 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 2.399e-152
Identity = 225/431 (52.20%), Postives = 312/431 (72.39%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDG-KCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            HVGQAG Q+G +IWEL CAEH I  DG +    RE   +S  +FF  S  GQ VPR +FIDLE +VI++++ G +RKLYHP +LI+G +D+++NF+R F T+G+L+   I N++R+ +ESC+  Q ++ YRSL GG+G+GLT+ + +++ D++K  K E P++PSP   + +V PYNSILGEHF ME+  +GLL+DNEAL+DIC   L +   T TSINR++ Q  S ITAS RF + + +D+N + TNLVPYPRIHFPL++FAP  +  + +HE  +  +LTRAVF+RE Q+V  DP  GK+M C+L++RG V+ S VY +L  +KS++   FVDWCPTGFKVGI   PP+ +  S + ++  +VVM+ N+SAV   WQRL+ KFH LYSKRSFIHW++ EG+EESEF +AL N+ SL +DYEE SVD K
Sbjct:   44 HVGQAGVQMGSAIWELYCAEHAIGMDGFQLEPPREQECQS--TFFHLSPKGQSVPRSIFIDLEASVIDEIRVGPWRKLYHPDRLITGYEDAANNFARGFFTIGKLLIAPIVNEIRRSLESCEAPQGLILYRSLGGGTGAGLTAALLDVMSDFRKLTKIEIPVYPSPSLSNSLVEPYNSILGEHFAMEDIQLGLLMDNEALYDICARYLAVNMTTYTSINRLIAQATSAITASLRFPNVLNSDLNVIQTNLVPYPRIHFPLSNFAPCISSEKAEHETLTTRELTRAVFDRENQMVKVDPTYGKFMACTLLYRGNVSPSHVYLSLMELKSARGIEFVDWCPTGFKVGISSSPPVSVINSRVAQSDKNVVMLANNSAVGQAWQRLTHKFHLLYSKRSFIHWYIGEGMEESEFNDALVNMTSLVRDYEEASVDMK 472          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A074ZKQ1 (Tubulin alpha chain OS=Opisthorchis viverrini OX=6198 GN=T265_06402 PE=3 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 7.090e-152
Identity = 221/430 (51.40%), Postives = 314/430 (73.02%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            HVGQAG Q+G +IWEL CAEH I  DG+ T    + +   ++FF +S  GQ+VPR LFIDLEP+V+++++ G +RKLYHP +LI+G +D+++NF+R F T+G+L+   I +++R+ +ESC+  Q ++ YRSL GG+G+GLT+ + +++ D+ K  K E P++PSP   + +V PYNS+LGEHF ME+  +GLL+DNEAL+DIC   LG+   T TSINR++ Q  S ITAS RF + +  DIN + TNLVPYPRIHFPL++FAP  +  + +HE  +  +LT AVF+RE Q+V  DP  GK+M+C+L++RG V+ S VY  L+ +KSS+   FVDWCPTGFKVG+   PP+ +P S + +   +VVM+ N+S+V   WQRL+ KF+ LYSKRSF+HWF+ EG+EESEF +AL N+ SL KDYEE S ++K
Sbjct:   52 HVGQAGVQMGNAIWELYCAEHAIGLDGQPTQAPLEQECQ-STFFQQSPKGQHVPRALFIDLEPSVVDEIRVGPWRKLYHPDRLITGYEDAANNFARGFFTIGKLLIAPILSEIRRSLESCEAPQGIILYRSLGGGTGAGLTAALLDVMPDFHKLTKIEIPVYPSPSLSNSLVEPYNSLLGEHFAMEDIQLGLLMDNEALYDICGRYLGLTVTTYTSINRLIAQATSAITASLRFPNILNGDINVIQTNLVPYPRIHFPLSNFAPCISWEKAEHETLTTRELTLAVFDRENQMVKVDPTYGKFMSCTLLYRGDVSPSHVYQALTELKSSRCIEFVDWCPTGFKVGLTSSPPVSVPDSRVAQCDKNVVMLANNSSVGQAWQRLTHKFYLLYSKRSFVHWFIGEGMEESEFNDALINMTSLVKDYEEASGESK 480          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A183AE01 (Tubulin alpha chain OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5186 PE=3 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 2.151e-150
Identity = 222/430 (51.63%), Postives = 311/430 (72.33%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            HVGQAG Q+G +IWEL CAEH I  DG  T    + +   ++FF  S  GQ VPR +FIDLE +VI++++ G +R+LYHP +LI+G +D+++NF+R F T+G+L+   I N++RK +ESC+  Q ++ YRSL GG+G+GLT+ + +++ DY+K  K E P++PSP   + +V PYNS+LGEHF ME+  +GLL+DNEAL+DIC   L     T TSINR++ Q  S ITAS RF + +  D+N + TNLVPYPRIHFPL++FAP  +  + +HE  +  +LTRAVF++E Q+V  DP  GK+M+C+L++RG V+ S+VY +L  +KSS+   FVDWCPTGFKVGI   PP+ +  S + +   +VVM+ N+SAV   WQRL+ KF+ L+SKRSFIHW+V EG+EESEF +AL N+ SL KDYEE S+D+K
Sbjct:   24 HVGQAGVQMGNAIWELYCAEHAIGMDGFQTAKPMEQECQ-STFFQTSPRGQCVPRSIFIDLEASVIDEIRVGPWRRLYHPDKLITGYEDAANNFARGFFTIGKLLISPILNEVRKSLESCEAPQGIILYRSLGGGTGAGLTAALLDVMSDYRKLTKIEIPVYPSPSLSNSLVEPYNSLLGEHFAMEDIQLGLLMDNEALYDICSRFLAFTTTTYTSINRLIAQATSAITASLRFPNVLNGDLNVIQTNLVPYPRIHFPLSNFAPCISPEKAEHEMLTTRELTRAVFDKENQMVKVDPTYGKFMSCTLLYRGDVSPSQVYLSLMELKSSRGIEFVDWCPTGFKVGISSSPPVSIVDSRVAQCDKNVVMLANNSAVGQAWQRLTHKFYLLFSKRSFIHWYVGEGMEESEFNDALINMTSLVKDYEEASLDSK 452          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000042562.1 (tubulin alpha chain [Source:NCBI gene;Acc:103038315])

HSP 1 Score: 425.631 bits (1093), Expect = 3.893e-143
Identity = 205/432 (47.45%), Postives = 295/432 (68.29%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG Q+G + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + ++ RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ D+T A FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000049713.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:103046666])

HSP 1 Score: 425.246 bits (1092), Expect = 6.070e-143
Identity = 205/432 (47.45%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 425.246 bits (1092), Expect = 8.387e-143
Identity = 205/432 (47.45%), Postives = 298/432 (68.98%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S++++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:   19 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 450          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 425.246 bits (1092), Expect = 8.758e-143
Identity = 205/432 (47.45%), Postives = 298/432 (68.98%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S++++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:   19 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 450          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch73-199e17.1 (tubulin alpha chain-like [Source:NCBI gene;Acc:103038622])

HSP 1 Score: 424.476 bits (1090), Expect = 1.250e-142
Identity = 204/431 (47.33%), Postives = 296/431 (68.68%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDR-EDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG    ++    D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ +  ++ +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ D+T A FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGAQIGNACWELYCLEHGIQPDGHMPSEKIPRGDDSFNTFFSETGTGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEVIDAVLDRIRKLTDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPCNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 438          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 326.635 bits (836), Expect = 9.546e-107
Identity = 161/344 (46.80%), Postives = 234/344 (68.02%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGF 1073
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGF
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGF 351          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 277.715 bits (709), Expect = 7.072e-88
Identity = 153/348 (43.97%), Postives = 216/348 (62.07%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDS---DRSFASFFLESHSGQYVPRGLFIDLEPTVINQ---LKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGF 1073
            H+GQAG Q+G + WEL C EHGI+ DG      + +   D SF +FF E+ SG++VPR +FIDLEP+VI +   L+  +       S +++G +  SS   R     GR I   +  + R Q E C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYN+IL  H  +E  D   ++DNEA++DIC   L I+ P+  ++NR++ Q+ S+ITAS RF   +  D+N   TNLVPYPRIHFPLT++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG +   +V + ++IIKS +  RFVDWCPTGF
Sbjct:    9 HIGQAGVQMGNACWELYCLEHGIKPDGHLATHPDVTSVVDSSFNTFFSETGSGKHVPRAIFIDLEPSVIGEPCGLRTLTVGGXLRMSMMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTGF 356          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 208.764 bits (530), Expect = 1.591e-61
Identity = 110/383 (28.72%), Postives = 200/383 (52.22%), Query Frame = 3
Query:   90 WELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSM-LFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIH-PSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPP--LILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKR 1226
            WE++  EHGI   G    D +        ++ E+  G+YVPR + +DLEP  ++ ++ G + +++ P   + G   + +N+++   T G  +  S+ + +RK+ ESCD +Q   L +    G      T +I ++ E+Y   + +      PSP     VV PYN+ L  H  +E  D    +DNEAL+DIC   L +  PT   +N ++    S +T   RF   +  D+  +  N+VP+PR+HF +  FAPL +R    +   ++ +LT+ +F+ +  +  CDP  G+Y+T + +FRG ++  EV   +  +++   + FV+W P   K  + D PP  L +  +F+G          NS+A+  +++R+S++F  ++ ++
Sbjct:    3 WEVISDEHGIDPTGSYHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYIIQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIG----------NSTAIQELFKRISEQFTAMFRRK 375          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 9.967e-56
Identity = 140/482 (29.05%), Postives = 229/482 (47.51%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRED-SDRSFASFF----LESHSGQYV--------------PRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLED-YKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNI-----------------------LGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFV-AEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLGK 1364
             VGQ GNQIG   W+L   EH         ++++   D + +SFF        +G+ V               R + ID+E  V+N+L +G  R ++   QLI+    S +N++      G    + I  +LR   E CD +Q      S+ GG+GSGL + +  LLED +    +F   ++PS   D  V  PYNS+L      E  D  L ++N+AL DI   I                        G E P   ++N I+  +  N+T+SSRF   +  D+N +  NLVP+PR+H+ ++S  PL   A +      +  +    F +E QL+  DP    Y+ C+L+ RG V  S+V   +  +K S +  FVDW   G+K G+   PP+  P S +         + N++ V   +  + ++F RLY +++ +H +   EG+E S F EA  ++AS+ ++Y ++  +   L G++ +
Sbjct:    8 QVGQCGNQIGCRFWDLALREHA-------AVNKKGIYDEALSSFFRNVDTRPGTGEEVDIPVDSRSTIRSLKARAVLIDMEEGVVNELLQGPLRDVFDQKQLITDVSGSGNNWAVGNKVYGAQFREKILERLRVTAEHCDSLQCFFLIHSMGGGTGSGLGTFVLRLLEDEFPDVHRFVMALYPSAE-DDVVTSPYNSVLAMRELTEHADCVLPIENQALVDIVNKINHAAALGKSVRSQTTLSSSHGCLKGQEKP-FDTMNNIVANLMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRRNIERLKPSLH--FVDWNEEGWKTGLCSVPPVGYPHSLLA--------LANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEYNQLDRNKGQLAGDIPR 470          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 171.014 bits (432), Expect = 5.224e-47
Identity = 113/436 (25.92%), Postives = 217/436 (49.77%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCT-IDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQL-ISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSP-HFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDH-EKNSITDLTRAVFEREYQLVNCDPNVGK---YMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGL---EESEFCEALYNIASLAKDYEEVS 1328
             +GQ GNQIG+  W+ LCAEHGI  DG       E +DR    FF ++    Y+PR + +DLEP VIN +   SY  LY+P  + +S     + N   + ++ G  I++ I + + ++ +  D ++     R L+  + +     + +    + K +   + + P+       VV PYNS+L      +  D  ++LDN AL  I  + L I++P+ + IN+++  + S  T + R+   M ND+  ++ +L+P PR+HF +T + PL     +    K ++ D+ R + + +  +V+   +      Y+    + +G V+ ++V+ +L  I+  K   F+ W P   +V +  + P +           S +MM N +++SS++ R  +++ +L  + +F+  F  E +   + SEF ++   +  L  +Y+  +
Sbjct:    9 QLGQCGNQIGFEFWKQLCAEHGISPDGILEDFATEGTDRKDV-FFYQADDEHYIPRAVLLDLEPRVINSIVNSSYANLYNPENIYLSEHGGGAGNNWASGHSQGEKIHEEIFDIIDREADGSDSLEKCPLTRRLSATNWNE----LCKYFCRFPKKLIQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYL-----TSAHRVSGLMMANHTSISSLFDRTCKQYDKLRKREAFLDQFRKEDMFKEDLSEFDDSREVVQQLIDEYQAAT 434          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 396.356 bits (1017), Expect = 1.339e-132
Identity = 191/433 (44.11%), Postives = 291/433 (67.21%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCT---IDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            +VGQAG QIG + WEL   EHGI+ DG         +  +  F++FF E+  G++VPR +++DLEP VI++++ G +++L+HP QLI+G +D+++N++R   TVGR I   +E ++RK  + CD +Q  LF  SL GG+GSGL S++ E L  +Y K  K EF ++P+P   + VV PYN++L  H  +E  D   ++DNEA++DIC   LGI  P+ +++N ++ QV S++TAS RF   +  D+N   TNLVPYPRIHFPL S+AP+ ++ +  HE NS++++T A FE   Q+V CDP  GKYM   L++RG V T +V   +  +K+ K  + VDWCPTGFK+GI  +PP ++P S +     +V M++N++A++  W+R+ QKF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L +DY EV  D+
Sbjct:    8 NVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADS 440          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 382.104 bits (980), Expect = 5.253e-127
Identity = 179/433 (41.34%), Postives = 280/433 (64.67%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCT---IDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLF-YRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            +VGQAG QIG + WEL   EHGI+ DG         +  +  F++FF E+  G++VPR +++DLEP VI++++ G Y+ L+HP QLISG +D+++N++R   TVGR I   + +++RK  + CD +Q  LF +    G      + ++ EL  +Y K  K EF ++P+P   + VV PYN++L  H  +E  D   ++DNEA++D+C   L I  P+  ++N ++ QV S++TAS RF   +  D+N   TNLVPYPRIHFPL S++P+ ++++  HE NS++++T A FE   Q+V CDP  GKYM   L++RG V T +V   +  +K+ K  + VDWCPTGFK+GI  +PP   P S +     +V M++N+++++  W+R+ +KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L +DY EV  D+
Sbjct:    8 NVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADS 440          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 244.588 bits (623), Expect = 3.170e-74
Identity = 121/424 (28.54%), Postives = 221/424 (52.12%), Query Frame = 3
Query:   54 VGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSM-LFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEE 1322
             GQ GNQIG + WE +C EHG+  +G      +        +F E+ SG++VPR + +DLEP  I+ ++  +   L+ P   I G   + + +++   T G  +  S+ + +R++ E CD +Q   + +    G      T +I ++ E++   +   F + PSP     VV PYN+ L  H  +E  D    +DNEAL+DIC   L +  P+   +N ++  V S +T S R+   + +D+  +  NLVP+PR+HF +  +APL           ++ +LT+ +F+ +  +   DP  G+Y+T +  FRG V+  EV   +  ++S   + FV+W P   +  +      + PQ        +   + NS+++  +++R+  +F  ++ +++F+HW+ +EG++E EF EA  N+  L  +Y++
Sbjct:    9 TGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCS----VAPQGL----DMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQ 424          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 131.724 bits (330), Expect = 3.085e-33
Identity = 117/465 (25.16%), Postives = 214/465 (46.02%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFAS--FFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFN-TVGRLIYKSIENKLRKQIESCD-FMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGN---RAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEES------EFCEALYNIASLAKDY---------EEVSVDTKFLQGNLGKNDLDV 1379
              GQ GN +G  +W  L  EH I  DG   +    ++R   +  FF E+   ++ PR + +D EP+VI  ++  ++R  + P       D +S+  S A    +G      I NK+ K+I+S D F    L +    G      ++++  L + Y K I   + + P+      VV  YN+IL     +E+ D  ++ DN +L +I   +    +  +   N+++  + S++T S RF S M++ ++++ + L+P P +HF   SF P  +      I H+ +S  D+   + +    LV+   N   Y        G V   ++  + ++ K  +  +F  W  +   V I  + P +  Q    E   S +M++N S V +V++     F ++++K +F++ +    L +S      EF E+   + SL +DY         ++V VD + + G L + DLD 
Sbjct:    9 QAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSRNKFTPRAIMMDSEPSVIADVEN-TFRGFFDPRNTWVASDGASAGNSWANGYDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQI--SRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLPLQP--NENEVSGMMLSNMSTVVNVFENACNTFDKVFAKGAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGEL-EEDLDA 466          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO41766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G2])

HSP 1 Score: 429.098 bits (1102), Expect = 8.111e-145
Identity = 204/432 (47.22%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDS--DRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ GSYR+L+HP QLI+G +D+++N++R   T+G+     + ++LRK  + C  +Q    + S  GG+GSG +S++ E L  DY K  K EF ++P+PH  S VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE P+ T++NR++GQ+ S++TAS RF   +  D+N   TNLVPYPRIHFPL ++AP+ +  +  HE+ ++ ++T A FE   QLV CDP  GKYM C L+FRG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTQGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGSYRQLFHPEQLITGKEDAANNYARGHYTIGKQQVDQVLDRLRKLADQCSGLQGFFIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAVYPAPHIASAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQLVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY2])

HSP 1 Score: 425.631 bits (1093), Expect = 1.407e-143
Identity = 202/432 (46.76%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG +S++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT0])

HSP 1 Score: 425.631 bits (1093), Expect = 1.487e-143
Identity = 204/432 (47.22%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   TVG+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C +++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S698])

HSP 1 Score: 425.631 bits (1093), Expect = 1.602e-143
Identity = 206/432 (47.69%), Postives = 295/432 (68.29%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D +F +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   TVG+     + ++LRK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+PH  S VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++ Q+ S+ITAS RF   +  D+    TNLVPYPRIHFP+ S+AP+ +  +  HE+ ++ D+T + FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ K  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFAETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEQIDIVLDRLRKLADGCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPHISSAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQLVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPMASYAPVVSAEKAYHEQLTVADITNSCFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKKTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGADS 439          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY3])

HSP 1 Score: 425.631 bits (1093), Expect = 1.747e-143
Identity = 203/432 (46.99%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTV+++++ G+YR+L+HP QLI+G +D+++N++R   TVG+ +   + +++RK  + C  +Q  L + S  GG+GSG +S++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000003572.2 (tubulin alpha chain [Source:NCBI gene;Acc:101171518])

HSP 1 Score: 427.172 bits (1097), Expect = 1.079e-143
Identity = 211/452 (46.68%), Postives = 301/452 (66.59%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLGKNDLDVGEEGEG 1397
            HVGQAG Q+G + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   TVG+ I   + ++ RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF ++P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ D+T A FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+             VGEE EG
Sbjct:    8 HVGQAGAQMGNACWELYCLEHGIQPDGRMPSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIASIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS-------------VGEEDEG 446          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: tuba8l3 (tubulin alpha chain [Source:NCBI gene;Acc:101168255])

HSP 1 Score: 425.246 bits (1092), Expect = 5.237e-143
Identity = 204/432 (47.22%), Postives = 295/432 (68.29%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG Q+G + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + ++ RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF ++P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ D+T A FE   Q+V CDP  GKYM C L++RG V   +V S ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV  D+
Sbjct:    8 HVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020614.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 424.861 bits (1091), Expect = 8.738e-143
Identity = 204/432 (47.22%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYN+IL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:   10 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 441          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000037900.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 424.476 bits (1090), Expect = 1.343e-142
Identity = 204/432 (47.22%), Postives = 297/432 (68.75%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYN+IL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++GQ+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L++RG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:    8 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 423.705 bits (1088), Expect = 2.726e-142
Identity = 205/432 (47.45%), Postives = 296/432 (68.52%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDRE--DSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLE-DYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDT 1337
            HVGQAG QIG + WEL C EHGIQ DG+   D+     D SF +FF E+ +G++VPR +F+DLEPTVI++++ G+YR+L+HP QLI+G +D+++N++R   T+G+ I   + +++RK  + C  +Q  L + S  GG+GSG TS++ E L  DY K  K EF I+P+P   + VV PYNSIL  H  +E  D   ++DNEA++DIC   L IE PT T++NR++ Q+ S+ITAS RF   +  D+    TNLVPYPRIHFPL ++AP+ +  +  HE+ S+ ++T A FE   Q+V CDP  GKYM C L+FRG V   +V + ++ IK+ +  +FVDWCPTGFKVGI  QPP ++P   + +   +V M++N++A++  W RL  KF  +Y+KR+F+HW+V EG+EE EF EA  ++A+L KDYEEV VD+
Sbjct:   14 HVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 445          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000050487.1 (SMESG000050487.1)

HSP 1 Score: 1154.43 bits (2985), Expect = 0.000e+0
Identity = 618/618 (100.00%), Postives = 618/618 (100.00%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLGKNDLDVGEEGEGPKIVVQXXXXXXXXXXXXXNDPTNSSNFNGNCQKTKFKTQLVENDWSEINNQMYINQRKVEIETPEKSEILDANSLSCSLNSEIFIKSHMRNDSCLQFSTKISKENSSAKSNHISLGSHQTKEXXXXXXXXXXXXXMFDKHNGYXXXXXXXXXXXXXXXXXXVSKTFYV 1904
            HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRSLAGGSGSGLTSMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLGKNDLDVGEEGEGPKIVVQEGEGEGGEDGEGGNDPTNSSNFNGNCQKTKFKTQLVENDWSEINNQMYINQRKVEIETPEKSEILDANSLSCSLNSEIFIKSHMRNDSCLQFSTKISKENSSAKSNHISLGSHQTKENGNSNNFRRNINNMFDKHNGYLSNDSNDEDEEFDLLNSLVSKTFYV
Sbjct:   35 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRSLAGGSGSGLTSMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLGKNDLDVGEEGEGPKIVVQEGEGEGGEDGEGGNDPTNSSNFNGNCQKTKFKTQLVENDWSEINNQMYINQRKVEIETPEKSEILDANSLSCSLNSEIFIKSHMRNDSCLQFSTKISKENSSAKSNHISLGSHQTKENGNSNNFRRNINNMFDKHNGYLSNDSNDEDEEFDLLNSLVSKTFYV 652          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000002455.1 (SMESG000002455.1)

HSP 1 Score: 526.168 bits (1354), Expect = 2.378e-179
Identity = 244/430 (56.74%), Postives = 339/430 (78.84%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            H+GQ G QIG+++WELL AEHGI  DG       D   S+ ++F  S +GQYVPR +F+DLEPTV++Q++ G+YR+LYHP+QLI+G +D+++NF+R F+TVGR++ +  EN++RK+ E  D +Q +  YRSL GG+GSG+T+ +FE L +Y K  K E PIHPSPH    +V PYN IL EHFCM++ D+ +L+DNE+L+DI    +G++ PT+  INR++ QV S++TASSRF ++++ND  +VLTNLVPYPRIHFPL S+AP G+ +++  + N++++LT AVF    QLV CDP  GKYM+CSLV+RG ++ ++V+  LS IK +++ +FVDWCPTGFKVGIV+QPP +LP S +G +  +VVMMTNSS+VS++W RL+QKFH+LYSKRSFIHWFVAEGLEE+EFCE+LYN+A+LAKDYEEV++DTK
Sbjct:    2 HIGQCGLQIGFALWELLIAEHGISRDGLMNNGDVDEKASYNTYFNVSMAGQYVPRSIFVDLEPTVVDQMRTGAYRQLYHPNQLINGYEDAANNFARGFHTVGRIMKRVCENRIRKEFEINDSIQGIHIYRSLGGGTGSGMTATLFESLLEYPKISKVEIPIHPSPHLSCAIVEPYNCILSEHFCMDDVDISVLIDNESLYDIMLEQIGLKEPTLHHINRLVAQVCSSLTASSRFENELYNDF-SVLTNLVPYPRIHFPLVSYAPFGSESKLARDTNTVSELTHAVFSASNQLVKCDPISGKYMSCSLVYRGEISPTQVFGALSEIKGNRFVKFVDWCPTGFKVGIVNQPPQVLPGSKIGHSSKNVVMMTNSSSVSALWHRLAQKFHKLYSKRSFIHWFVAEGLEENEFCESLYNLATLAKDYEEVALDTK 430          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000002455.1 (SMESG000002455.1)

HSP 1 Score: 524.628 bits (1350), Expect = 2.082e-177
Identity = 244/430 (56.74%), Postives = 339/430 (78.84%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            H+GQ G QIG+++WELL AEHGI  DG       D   S+ ++F  S +GQYVPR +F+DLEPTV++Q++ G+YR+LYHP+QLI+G +D+++NF+R F+TVGR++ +  EN++RK+ E  D +Q +  YRSL GG+GSG+T+ +FE L +Y K  K E PIHPSPH    +V PYN IL EHFCM++ D+ +L+DNE+L+DI    +G++ PT+  INR++ QV S++TASSRF ++++ND  +VLTNLVPYPRIHFPL S+AP G+ +++  + N++++LT AVF    QLV CDP  GKYM+CSLV+RG ++ ++V+  LS IK +++ +FVDWCPTGFKVGIV+QPP +LP S +G +  +VVMMTNSS+VS++W RL+QKFH+LYSKRSFIHWFVAEGLEE+EFCE+LYN+A+LAKDYEEV++DTK
Sbjct:  104 HIGQCGLQIGFALWELLIAEHGISRDGLMNNGDVDEKASYNTYFNVSMAGQYVPRSIFVDLEPTVVDQMRTGAYRQLYHPNQLINGYEDAANNFARGFHTVGRIMKRVCENRIRKEFEINDSIQGIHIYRSLGGGTGSGMTATLFESLLEYPKISKVEIPIHPSPHLSCAIVEPYNCILSEHFCMDDVDISVLIDNESLYDIMLEQIGLKEPTLHHINRLVAQVCSSLTASSRFENELYNDF-SVLTNLVPYPRIHFPLVSYAPFGSESKLARDTNTVSELTHAVFSASNQLVKCDPISGKYMSCSLVYRGEISPTQVFGALSEIKGNRFVKFVDWCPTGFKVGIVNQPPQVLPGSKIGHSSKNVVMMTNSSSVSALWHRLAQKFHKLYSKRSFIHWFVAEGLEENEFCESLYNLATLAKDYEEVALDTK 532          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000021744.1 (SMESG000021744.1)

HSP 1 Score: 469.159 bits (1206), Expect = 4.145e-157
Identity = 232/434 (53.46%), Postives = 314/434 (72.35%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQG 1352
            ++GQAG Q+G +IWELLCAEHGI   G       D +    +FF  +   +YVPR LF+DLEPTVI++++ GS++ L+HP +LI+G +D++SNF+R F TVG+L+  +I N+ R+ +E+ D +Q +  +RSL GG+G+GLTS IF+ L +Y K  K E PI+PSP   S +V PYN +LGEHFCME+ DVGLLLDNEAL+DIC   L I +PT  +INR++ Q+ S+ITAS+RF S M  DI  + TNLVPYPRIHFPL +FAP+ +  +  HE+ SI +LTR VFERE Q++  D + G++M+CSL+FRG V+   VY  L+ IK  K   FVDWCPTGFK+GI   PP  +P S + +T  +V M+TN+SA+   WQRL+ KF+ LYSKRSF+HWFV EG+EE EF E+LYNI++L KDYEE ++D KF +G
Sbjct:    8 YIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIE-CLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRSLGGGTGAGLTSAIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEG 440          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000037410.1 (SMESG000037410.1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.056e-156
Identity = 234/430 (54.42%), Postives = 299/430 (69.53%), Query Frame = 3
Query:   51 HVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASFFLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSNFSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRXXXXXXXXXXXXMIFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLLLDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDINAVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLVNCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKVGIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRSFIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTK 1340
            HVGQ G QIG ++WELL  EH + CDG    D    + S  SFF+     Q+VPR LFIDLEP VI+++K G+YRKL+HP+QLISG +D+++NF+R F+T GR+I    E + RK IE C  +Q+   YRSL GG+GSG+T+ IFE+L +Y KT K E PIHPSPH  S +V PYN IL EHFCME+ DV LL+DNEAL+DI  N + ++ PT + INRI+ QV S++T+S+RF +D++ND   VLTNLVPYPRIH+PL S+AP GN  +++ + NS+T++T+AVF    QLV C+P  GKYM+CSL++RG V+  +VYS L  IKS     FVDWCPTGFKV                                 VW RLSQKFH LYSKRSFIHWF+ EGLEE EFCE+L+NIA+LAKDYEEVS+DT+
Sbjct:    8 HVGQCGVQIGSALWELLTFEHCLDCDGILNEDESSKNESLDSFFINCKRNQFVPRVLFIDLEPNVIDEIKTGNYRKLFHPNQLISGTEDAANNFARGFHTAGRIIKGLCEQRFRKAIELCGHLQAFHIYRSLGGGTGSGMTATIFEMLSEYTKTTKIEIPIHPSPHLSSAIVEPYNCILTEHFCMEDIDVSLLMDNEALYDILTNEISVKEPTFSHINRIVAQVCSSMTSSARFSTDLYNDF-VVLTNLVPYPRIHYPLVSYAPFGNSMKLERDMNSVTEITKAVFNSNNQLVKCNPAYGKYMSCSLLYRGNVSPVDVYSALGDIKSFSTVNFVDWCPTGFKV---------------------------------VWHRLSQKFHHLYSKRSFIHWFIGEGLEECEFCESLFNIATLAKDYEEVSLDTE 403          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA1A1.126e-14247.45tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1A1.126e-14247.45tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA3C1.890e-14246.76tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA3D1.890e-14246.76tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:2407... [more]
TUBA1B1.151e-14147.22tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:1880... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mec-126.067e-14246.59Tubulin alpha-3 chain Detyrosinated tubulin alpha-... [more]
tba-28.108e-14246.28Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-28.108e-14246.28Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-28.108e-14246.28Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-11.424e-14146.05Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub84B2.015e-14246.76gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub85E1.292e-14146.06gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub84D6.687e-14146.30gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub67C1.321e-12742.99gene:FBgn0087040 transcript:FBtr0076393[more]
CG77943.251e-11243.22gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-199e17.11.041e-14548.38si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
si:ch73-199e17.13.951e-14548.38si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
tuba7l1.056e-14346.99tubulin, alpha 7 like [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tuba8l33.822e-14347.45tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba1a7.810e-14347.45tubulin, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-090507... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1b1.021e-14247.45tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
pex11.911e-14247.22peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
ENSXETT00000053522.12.727e-14246.99tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
ccdc1712.727e-14246.99coiled-coil domain containing 171 [Source:Xenbase;... [more]
pex13.985e-14246.99peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba1a7.730e-14347.45tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
Tuba3a1.298e-14246.76tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba3b1.298e-14246.76tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b7.899e-14247.22tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba4a1.974e-14146.10tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P68370|TBA1A_RAT5.407e-14247.45Tubulin alpha-1A chain OS=Rattus norvegicus OX=101... [more]
sp|A5A6J1|TBA1A_PANTR5.407e-14247.45Tubulin alpha-1A chain OS=Pan troglodytes OX=9598 ... [more]
sp|P68369|TBA1A_MOUSE5.407e-14247.45Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN... [more]
sp|Q71U36|TBA1A_HUMAN5.407e-14247.45Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=... [more]
sp|P68362|TBA1A_CRIGR5.407e-14247.45Tubulin alpha-1A chain OS=Cricetulus griseus OX=10... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KQ691.432e-15251.40Tubulin alpha chain (Fragment) OS=Clonorchis sinen... [more]
A0A3R7GY661.463e-15251.40Tubulin alpha chain OS=Clonorchis sinensis OX=7992... [more]
A0A5J4NYS22.399e-15252.20Tubulin alpha chain OS=Paragonimus westermani OX=3... [more]
A0A074ZKQ17.090e-15251.40Tubulin alpha chain OS=Opisthorchis viverrini OX=6... [more]
A0A183AE012.151e-15051.63Tubulin alpha chain OS=Echinostoma caproni OX=2784... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042562.13.893e-14347.45tubulin alpha chain [Source:NCBI gene;Acc:10303831... [more]
ENSAMXT00000049713.16.070e-14347.45tubulin alpha-1A chain [Source:NCBI gene;Acc:10304... [more]
tuba1a8.387e-14347.45tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
tuba1a8.758e-14347.45tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
si:ch73-199e17.11.250e-14247.33tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C9.546e-10746.80tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.17.072e-8843.97pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubb21.591e-6128.72tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001368.19.967e-5629.05pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
tubg15.224e-4725.92tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB31.339e-13244.11Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB15.253e-12741.34Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB23.170e-7428.54Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB43.085e-3325.16Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417668.111e-14547.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380661.407e-14346.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448031.487e-14347.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407791.602e-14347.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380671.747e-14346.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003572.21.079e-14346.68tubulin alpha chain [Source:NCBI gene;Acc:10117151... [more]
tuba8l35.237e-14347.22tubulin alpha chain [Source:NCBI gene;Acc:10116825... [more]
ENSORLT00000020614.28.738e-14347.22tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000037900.11.343e-14247.22tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
tuba1c2.726e-14247.45tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050487.10.000e+0100.00SMESG000050487.1[more]
SMESG000002455.12.378e-17956.74SMESG000002455.1[more]
SMESG000002455.12.082e-17756.74SMESG000002455.1[more]
SMESG000021744.14.145e-15753.46SMESG000021744.1[more]
SMESG000037410.11.056e-15654.42SMESG000037410.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015083 ID=SMED30015083|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=2027bp
AAATATTATTGATTAGAATTTGAATTATTATGAGGGAGATAATTTCGATT
CATGTCGGTCAAGCTGGCAATCAGATAGGCTATTCCATATGGGAATTATT
GTGCGCCGAGCATGGGATTCAGTGCGATGGCAAATGCACAATTGATAGGG
AGGACTCAGACCGTTCATTTGCATCTTTTTTTCTCGAATCCCATTCTGGT
CAGTACGTTCCCAGAGGACTGTTCATCGACCTGGAACCAACTGTTATTAA
TCAGTTAAAAAGAGGATCATATCGGAAATTATATCACCCTTCGCAATTAA
TTAGTGGGTGCGATGACAGTTCTTCAAACTTTTCAAGGGCATTCAATACA
GTGGGAAGATTAATATACAAATCAATTGAAAATAAACTGAGAAAGCAAAT
TGAATCATGCGACTTTATGCAATCAATGTTATTTTATAGATCACTGGCGG
GGGGGTCAGGTTCTGGTTTGACATCAATGATATTCGAACTCCTAGAAGAT
TATAAGAAAACAATAAAATTCGAATTCCCAATTCATCCTTCGCCTCATTT
TGACAGTTGCGTCGTAGGACCTTATAATAGCATTCTCGGGGAACATTTTT
GCATGGAAGAATGCGATGTTGGTCTTTTGTTAGATAATGAAGCTTTATTT
GATATTTGTTGTAATATTTTGGGAATCGAACATCCAACTATGACAAGCAT
TAATAGGATTTTAGGACAAGTCAATAGCAACATAACCGCCTCATCCAGAT
TTCACAGTGACATGTTTAATGATATCAATGCTGTTTTGACAAACCTTGTA
CCTTATCCCAGAATTCATTTCCCATTAACAAGTTTTGCCCCTCTTGGAAA
CCGTGCACAAATCGATCACGAAAAAAATTCCATTACAGATCTTACAAGAG
CTGTTTTTGAACGGGAATACCAGTTGGTCAATTGTGATCCTAATGTTGGA
AAATATATGACTTGCTCTTTGGTTTTTAGAGGTCCTGTGAATACTTCTGA
AGTCTATTCCACCTTGTCAATAATCAAGTCAAGTAAATATAATAGATTCG
TTGATTGGTGTCCAACAGGATTCAAAGTTGGAATTGTTGATCAACCTCCT
CTTATTTTGCCACAAAGCTTCATGGGAGAAACTCCGTGTAGTGTTGTTAT
GATGACAAATTCTTCTGCAGTAAGTTCTGTTTGGCAGCGTCTTTCACAAA
AGTTTCATCGACTCTATTCTAAACGAAGTTTTATACACTGGTTTGTGGCA
GAAGGACTTGAAGAAAGTGAATTCTGTGAAGCTTTATATAACATAGCAAG
TCTAGCCAAAGATTATGAAGAAGTATCGGTTGATACTAAATTTTTACAAG
GAAATTTAGGAAAGAATGATCTTGATGTCGGCGAAGAAGGTGAAGGGCCT
AAAATTGTTGTTCAAGAAGGTGAGGGTGAAGGAGGAGAAGACGGAGAAGG
CGGAAATGATCCAACAAATTCTTCAAATTTTAATGGAAACTGCCAAAAAA
CTAAATTCAAAACCCAATTGGTAGAAAATGATTGGTCGGAAATAAACAAC
CAAATGTATATTAATCAAAGAAAAGTGGAAATTGAAACACCGGAGAAATC
TGAAATTCTGGACGCAAATTCTTTATCTTGTTCACTGAATAGCGAAATAT
TTATCAAAAGTCACATGCGAAATGATTCGTGTCTTCAATTTTCTACAAAG
ATATCAAAGGAAAATTCGAGTGCAAAGTCGAATCATATAAGCTTAGGAAG
TCACCAAACGAAAGAAAACGGTAACTCAAACAATTTCAGGAGGAATATCA
ATAATATGTTTGATAAACATAATGGCTACCTTTCCAACGACAGCAACGAC
GAGGATGAGGAATTTGATCTTCTCAACTCACTTGTAAGTAAAACATTCTA
TGTTTAAAGCTTCTTCAATCTTCAAATTTATTTGAGTTATTTATTAACTT
GAATTTAAAAAGCATTTTGAATTTTTATAATTTTTGCTTCCTAATCTTGT
ATTTAGTAAATTTTATTTTAATCACGC
back to top

protein sequence of SMED30015083-orf-1

>SMED30015083-orf-1 ID=SMED30015083-orf-1|Name=SMED30015083-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=626bp
MREIISIHVGQAGNQIGYSIWELLCAEHGIQCDGKCTIDREDSDRSFASF
FLESHSGQYVPRGLFIDLEPTVINQLKRGSYRKLYHPSQLISGCDDSSSN
FSRAFNTVGRLIYKSIENKLRKQIESCDFMQSMLFYRSLAGGSGSGLTSM
IFELLEDYKKTIKFEFPIHPSPHFDSCVVGPYNSILGEHFCMEECDVGLL
LDNEALFDICCNILGIEHPTMTSINRILGQVNSNITASSRFHSDMFNDIN
AVLTNLVPYPRIHFPLTSFAPLGNRAQIDHEKNSITDLTRAVFEREYQLV
NCDPNVGKYMTCSLVFRGPVNTSEVYSTLSIIKSSKYNRFVDWCPTGFKV
GIVDQPPLILPQSFMGETPCSVVMMTNSSAVSSVWQRLSQKFHRLYSKRS
FIHWFVAEGLEESEFCEALYNIASLAKDYEEVSVDTKFLQGNLGKNDLDV
GEEGEGPKIVVQEGEGEGGEDGEGGNDPTNSSNFNGNCQKTKFKTQLVEN
DWSEINNQMYINQRKVEIETPEKSEILDANSLSCSLNSEIFIKSHMRNDS
CLQFSTKISKENSSAKSNHISLGSHQTKENGNSNNFRRNINNMFDKHNGY
LSNDSNDEDEEFDLLNSLVSKTFYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR037103Tubulin/FtsZ_C_sf
IPR013838Beta-tubulin_BS
IPR000217Tubulin
IPR002452Alpha_tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR003008Tubulin_FtsZ_GTPase
IPR023123Tubulin_C
IPR008280Tub_FtsZ_C
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000217TubulinPRINTSPR01161TUBULINcoord: 10..30
score: 63.42
coord: 93..104
score: 23.2
coord: 51..70
score: 51.36
coord: 132..150
score: 39.67
coord: 150..171
score: 30.27
coord: 189..209
score: 46.56
coord: 175..188
score: 47.0
coord: 106..130
score: 26.59
coord: 377..405
score: 33.5
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 2..439
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 86..99
score: 52.4
coord: 318..339
score: 22.38
coord: 271..286
score: 25.58
coord: 344..357
score: 80.07
coord: 158..169
score: 40.13
coord: 357..376
score: 20.29
coord: 419..435
score: 49.73
coord: 43..56
score: 38.42
coord: 211..223
score: 41.69
coord: 382..398
score: 39.35
coord: 18..33
score: 61.34
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 245..390
e-value: 1.8E-22
score: 90.7
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 260..389
e-value: 3.7E-37
score: 127.3
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 47..243
e-value: 1.4E-18
score: 77.7
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 3..210
e-value: 3.5E-56
score: 190.5
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..265
e-value: 1.1E-88
score: 299.1
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..241
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 381..434
e-value: 1.4E-20
score: 74.5
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 266..380
e-value: 7.8E-37
score: 127.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 465..486
NoneNo IPR availablePANTHERPTHR11588:SF304AT04270P-RELATEDcoord: 2..439
NoneNo IPR availableCDDcd02186alpha_tubulincoord: 2..432
e-value: 0.0
score: 630.725
IPR013838Beta tubulin, autoregulation binding sitePROSITEPS00228TUBULIN_B_AUTOREGcoord: 1..4
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 245..432