SMED30015082
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30015082 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Alignments
SMED30015082 aligns in the following genomic locations:
Homology
BLAST of SMED30015082 vs. TrEMBL
Match: K1RMT1 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10018354 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 6.231e-10 Identity = 31/72 (43.06%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 189 YNTSEDHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNMENSA 404 Y + +D GA YVVAV++++GLSIV++IAS +R+N D + YLKE+ +R R++I V N+ SA Sbjct: 5 YKSDDDDIGALYYVVAVVMIYGLSIVMMIASHIRRNNQDNQLRSYLKEMSLLRKNDRRERIFTQVANVSTSA 76
BLAST of SMED30015082 vs. TrEMBL
Match: V3ZQT2 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_166990 PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 7.735e-10 Identity = 29/67 (43.28%), Postives = 50/67 (74.63%), Query Frame = 3 Query: 204 DHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNMENSA 404 D GA YVVAV++++GLSIV++IAS +RKN+ D ++ +YLKE+ +R R+KI++ V ++ +++ Sbjct: 41 DESGALFYVVAVVMIYGLSIVMMIASHIRKNKQDSHLRIYLKEMAVLRKNDRREKIMEQVNSIASTS 107
BLAST of SMED30015082 vs. TrEMBL
Match: A0A2C9KT45 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059450 PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 2.938e-9 Identity = 32/68 (47.06%), Postives = 47/68 (69.12%), Query Frame = 3 Query: 195 TSEDHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNMEN 398 TS+D GA YVVAVI ++GLSIV++IAS +RKN+ D + YLKE+ +R R+K+L + ++ N Sbjct: 83 TSDDDIGALYYVVAVIFIYGLSIVMMIASHIRKNKQDSQLRTYLKEMANLRKSDRREKVLSKMNDLAN 150
BLAST of SMED30015082 vs. TrEMBL
Match: A0A433TCA8 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_012972 PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 3.135e-9 Identity = 36/93 (38.71%), Postives = 57/93 (61.29%), Query Frame = 3 Query: 114 KFRLNLINDSYFIASYVNQNKFNNIYNTSEDHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNM 392 K R+ + DS ++V N+ +T +D GA YVVAVI ++GLSIV++IAS +RKN+ D + YLKE+ +R R+K+L + ++ Sbjct: 44 KLRIRVRPDSVQNDTWVGI--IENVQSTDDDDIGALYYVVAVIFIYGLSIVMMIASHIRKNKQDSQLRTYLKEMSNLRKTERREKVLHKMTDL 134
BLAST of SMED30015082 vs. TrEMBL
Match: A0A2T7NPG4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16308 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 6.956e-8 Identity = 33/92 (35.87%), Postives = 57/92 (61.96%), Query Frame = 3 Query: 126 NLINDSYFIASYVNQNKFNNIYNTSEDHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNMENS 401 ++ ND++ Y+ + YN ++D GA YV+AVI ++GLSIV++IAS +RKN+ D + YLKE+ +R R+K++ + + N+ Sbjct: 23 DMGNDTWL--GYIEDRRR---YNENDD-IGALYYVIAVIFIYGLSIVMMIASHIRKNKQDCQLRAYLKEMAILRKADRREKLMGRISTLANA 108
BLAST of SMED30015082 vs. Planmine SMEST
Match: SMESG000046965.1 (SMESG000046965.1) HSP 1 Score: 371.318 bits (952), Expect = 8.732e-133 Identity = 182/185 (98.38%), Postives = 182/185 (98.38%), Query Frame = 3 Query: 66 MYNSKFPQEHRHKLPIKFRLNLINDSYFIASYVNQNKFNNIYNTSEDHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNMENSADIMTGLEEEVKQIKKPSHKPSAPIINRFIAPFKGRKIFIRINHLLEEHDRNVSRKCSLAVPEIFVEDEDERN 620 MYNSKF QEH HKLPIKFRLNLINDSYFIASYVNQNKFNNIYNTSEDHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNMENSADIMTGLEEEVKQIKKPSHKPS PIINRFIAPFKGRKIFIRINHLLEEHDRNVSRKCSLAVPEIFVEDEDERN Sbjct: 1 MYNSKFQQEHHHKLPIKFRLNLINDSYFIASYVNQNKFNNIYNTSEDHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVVVNMENSADIMTGLEEEVKQIKKPSHKPSTPIINRFIAPFKGRKIFIRINHLLEEHDRNVSRKCSLAVPEIFVEDEDERN 185
BLAST of SMED30015082 vs. Planmine SMEST
Match: SMESG000039006.1 (SMESG000039006.1) HSP 1 Score: 88.1965 bits (217), Expect = 2.997e-21 Identity = 39/60 (65.00%), Postives = 52/60 (86.67%), Query Frame = 3 Query: 204 DHQGAFMYVVAVILLWGLSIVLLIASTVRKNRLDKNVSLYLKEIQAVRNRSDRQKILQVV 383 D +GA +YV AVI +WGL I LLIAST+RKNR+DK +SLYLKEIQ++R+ SD+QKIL+++ Sbjct: 60 DPKGAGIYVSAVIFIWGLCIALLIASTIRKNRMDKTISLYLKEIQSIRHNSDKQKILRLM 119 The following BLAST results are available for this feature:
BLAST of SMED30015082 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30015082 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30015082 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30015082 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30015082 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30015082 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30015082 ID=SMED30015082|Name=SMED30015082|organism=Schmidtea mediterranea sexual|type=transcript|length=682bpback to top protein sequence of SMED30015082-orf-1 >SMED30015082-orf-1 ID=SMED30015082-orf-1|Name=SMED30015082-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp MYNSKFPQEHRHKLPIKFRLNLINDSYFIASYVNQNKFNNIYNTSEDHQGback to top Annotated Terms
The following terms have been associated with this transcript:
|