Dynein heavy chain 5, axonemal

Overview
NameDynein heavy chain 5, axonemal
Smed IDSMED30015079
Uniprot Best hitDynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3 (E=9.55372e-55)
Length (bp)9719
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015079SMESG000049144.1 SmedASXL_018345SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015079SMESG000049144.1 dd_Smed_v6_4569_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30015079SMESG000049144.1 dd_Smed_v6_4569_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30015079 Contig10559newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015079 Contig10559uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30015079SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH5 (dynein axonemal heavy chain 5 [Source:HGNC Symbol;Acc:HGNC:2950])

HSP 1 Score: 4014.15 bits (10409), Expect = 0.000e+0
Identity = 1971/3043 (64.77%), Postives = 2418/3043 (79.46%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI------EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG+GHYC +R F   V + V+KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSR+WQG++NT S+VI     LL+LW HEC RV++DR    SD+ WF++ +      EF  +   +V+        TYFVDFLRDAPE   E ++++    PKIYEP+ SF  LKERL+MF + YNE++RG+ +++VFF DAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA YV FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK FP+   T ENL+ YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C+ YF ++RRS  +T KSYLS+I  YK +Y      V  L  RM  GL+KLKEA E++  LSKELE KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKD+  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TI+P+DI+TVR L +PPHLI RIMDCVL+LFQ+K+     D E+     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L +K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P  K +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+ + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLE+NFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+D+TWLNLV LSKL  FS +++QI  +EK W+ WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL LD+M+ELMD +IETE++HD FRLW+TTE H +FPI+ LQMSIKF N+PPQG++AG+KRTY+  +QD LD+S+  QW+PM+YAVA+LH+ VQERRKFG LGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW TI YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD S GG ETRE+VV R+ DDML KLP DYV FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLAIDGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTELIERNSQF++W+F GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E    RD     Y CP+YKKP RTDL +IA+V LR   T   +HW LR VALLCD+K
Sbjct: 1598 NRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDC----GIDTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRD--PRFYSCPIYKKPVRTDLNYIAAVDLRTAQT--PEHWVLRGVALLCDVK 4624          

HSP 2 Score: 218.009 bits (554), Expect = 1.989e-55
Identity = 102/152 (67.11%), Postives = 119/152 (78.29%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD
Sbjct: 1425 TVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGD 1576          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 3868.16 bits (10030), Expect = 0.000e+0
Identity = 1910/3049 (62.64%), Postives = 2369/3049 (77.70%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL L++MEEL++ +I TE   D FR+W+TTE H +FPI+ LQ S+KFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA ++L+ I NIQPK++  G GETRE++VYR+ +DML KLP DY+  EV  RL  MG L  MNIFLRQE+DRMQ+VI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP EGVY+YGLY++GA WDRRN KL+ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1453 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4490          

HSP 2 Score: 224.557 bits (571), Expect = 2.238e-57
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1291 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1441          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 3866.62 bits (10026), Expect = 0.000e+0
Identity = 1910/3049 (62.64%), Postives = 2369/3049 (77.70%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL L++MEEL++ +I TE   D FR+W+TTE H +FPI+ LQ S+KFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA ++L+ I NIQPK++  G GETRE++VYR+ +DML KLP DY+  EV  RL  MG L  MNIFLRQE+DRMQ+VI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP EGVY+YGLY++GA WDRRN KL+ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1670 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4707          

HSP 2 Score: 224.172 bits (570), Expect = 2.617e-57
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1508 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1658          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 3122.03 bits (8093), Expect = 0.000e+0
Identity = 1561/2509 (62.22%), Postives = 1939/2509 (77.28%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQE 7951
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+
Sbjct: 1670 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQ 4175          

HSP 2 Score: 224.942 bits (572), Expect = 1.552e-57
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1508 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1658          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 1836.23 bits (4755), Expect = 0.000e+0
Identity = 1098/3113 (35.27%), Postives = 1721/3113 (55.28%), Query Frame = 2
Query:  467 YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC-GEPHREMRM---------NPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI-YKMETLEAFVVRQACDLLEGLI-----------PRKDEKD--SSQISRI--HYERLYIFSVMWSIGALLEIEDRGKLEAYIR---SNNNIKLDLPKIEKDSEDTMFDYMVSENG-----------------EWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCK----ERHFRSSV------INMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKH--PQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAV---IHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTS--WVESLKLLAST-NFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAK--KHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEEL--MDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLD-ISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKD---HSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIAS------VYLRCPPTKQADHWTLRAVALLCDI 9568
            Y  PF++ I    +KL  + E++E+W+  Q  W+YLE +F   DI +QLP E+KR+  +++ W KIM  A+EN  V+  C  D  +   L    + L++ QK L+ YLE KR  FPRF+F+SD  LLEIL Q  DP  +Q HL   F+NI  + F E     I   YS EGE ++L   +   SNVE WL  +    + S+H +I  A  +         +++  +P QV + G Q  WT +  EAL       ++  Q  +Q   L+ L+  +      +++R     LI I VH KD+  +L+++ V S +DF W+ Q R+Y+  +     +   + +FIY  E+LG + RLVITPLTDRCY+TL  AL +  GGAPAGPAGTGKTET KD+G+ L    VVFNCSDQ+DF  +G+ FKGL+ +G+W CFDEFNRID+ VLSV AQQI  +   +++R ++F+F +G  + + P   +F+TMNPGYAGR ELP+NLK  FR VAMMVPD  +I  + L S GF +  VLA+K  T +KL  EQL+ Q HYDFG+R + +V+   G  KR NP+  E+   +R +RD+N+ K + +D  LF  +++DLFP I+ +   Y  L+ AI      + +     ++ K IQL+ET  VRHG+M +GP+G+GK+ C  VL  A+T   G+P     M         NPK+IT  Q++G  D+ T++WTDGIFS+  R           W + DGPVDAIWIEN+N+VLDDNK L L++G+ I ++ +  ++FEV ++  ASPATVSR GMVY+  S L   P ++ WL K      P +L+ +   F  ++   ++  I +   +++  +    C+L   L+           PR+  K   S ++SRI    E  +IFS++WS+GA  +   R     ++R    N  + L  P+     E  +FDY + + G                  WV W      +    D+   Y +I+VP +D V+   L++ + + +K VL IG  GT KT+ I+  L       ++   L FS+ T     Q  I+S +DKR    +GPP GR    FIDD+NMP +  +G Q   E++RQ ++  G+Y     G F +++D++FV AM  PGGGRN +  RL RHF   +       S  RI+S I LG++      E+ +R  V       +    L+  T  ++ +  +++ PTP+K HY FNLRDLS+++QG++      +    +LLRLW HE  RV  DRL++E D  WF++ ++ C++  EV   +  P +   + DF+         G+D       K YE + S   + + +  + + YN+ +  + + LV F+DAM H+ +ISR +R   GN LL+GVGGSG+ S+TRLAS +A+Y CFQI +++ Y ++ + +D+K +   AG +N    F+F+D +IK+ES+LE INN+L SG I  L++ +E D+I+S     M+ +  +     T+ NL   +  RVR N+H+VLC SPIGE FR R   FP+L + CTI+WF +WP EAL +VA   L++ P +  +  +E+I  L+ V   IHQ V   C++Y  +  R   +T KSYL  + ++  +    K  +     RM++GL KL    E +  + ++LE     L  A+ +    +  +   T  AE  +N V+T + K     +K +     A++ L  A PAL  A  +L  +  ND++ VR +Q+PP  ++ +++ V I+  K I P     E+ G K    W     LL    +FL SL  F +D I + +I  +QPY   E++      K       +C W +AM K+++V + V P +  L      L   Q  L  A++ L E E+ +A ++ +Y   I +K+ LE     C +++  A +L+NGL DEK RW       +  +  + GD++V + FV+Y GPF  Q+R  ++  W   +R++ VP      ++  L NP +I  W + GLPND LSVEN +I   + R++ FIDPQSQ   WI N E ++ +     +++ F + +E+A+  G P ++E++ EELDPAL  VL K   K      +K+GD  +  H+ F +YITTKL NPH++PEI  K ++I+F+++  GLEDQLLG V+  E+ +LE ++NQL+   +  ++++K++ED +L RL+++EG+ V+D  L+ VL  +K  + ++  ++  A  TE++I+  R EY  ++ R  +L+F ++DL+ V+PMYQ  L+ FLN+F++ I  SE++  +++RI +I   +T ++++ + RSL++  +  F  LL +++ M    + Q E   LL GGS + + T +P P  W+ D  W +++ALS L  FS      V    ++R  FD   P  E +P  ++  LD+F+KLL++RC   D+     + ++   L   FIE     +  + +++++ TPL+ +LS G DP   +   A+  K   ++  IS+GQGQ   +  ++  +++ G WV  QNCHL+  +M  L  + + I  + +H DFRLW+T+    KFP+S LQ   K T EPP+G++A + ++Y+S  +DFL+    +M+++ ++ ++   H    ERRKFGPLG+NIPYE+   DL   +  ++  LD+ D    + +K + Y  GEI YGGRVTDD+D+R +      ++N D+ +P+  +      H IP    L+ Y+  I  LP  D PE+FGLH NA+IT+      ++L  I+ +QPK +SA G + RE +V  +  ++L K+P       VM +  ++   + MN  L QEV R  +++  +  TL DL  A+ G ++M+  L     S+Y+  +P    +K       L  W  +L++R      W+  G P  FW++GFF  Q FLT   Q   R     ++DT+     V      E+ Q P  G Y++GL+LEGA WD    +L ES+ K L+  + VI +      K  +      ++ Y CP+YK   R              + +  P  +   HW  R VAL+C +
Sbjct: 1212 YKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVC-SDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDL--EITHMYSAEGEEVQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAY--PTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLCQQLSDLVALVRGKL----SRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTNN--DLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMF-EGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKL-----PPLLKPYEEHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKMENEQLTLLFPE-----EGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTN--YCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALDYISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTI-LGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLLKRCMEQWEVTFNKVCPFQPILYGDFM-------SPGSD------VKSYELITSESKMMQVIEEYIEDYNQ-INTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVS----TMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPEL--ESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIM--KGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGGS-ISIMTENPAP-DWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSSLGEDFLNSCHKVMEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYD---DIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDVLSPEHSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSA-GSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVL-YEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFV-ISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQD------QDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALICAL 4263          

HSP 2 Score: 56.6102 bits (135), Expect = 1.192e-6
Identity = 38/143 (26.57%), Postives = 66/143 (46.15%), Query Frame = 3
Query:   39 VDIEKISNELTEFQNRCRKLPKGLKDWPAFE----DLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            +D E++   + E      K  K  KD PA +    D+R  I++F   +PL++ + NP M+ RHW+ +S+  + +   +++       LE  L    E I  +   A KE  IE  L  ++ EWS    +   +K     +L+ 
Sbjct: 1048 IDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKAN-LTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKS 1189          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1155.58 bits (2988), Expect = 0.000e+0
Identity = 871/3110 (28.01%), Postives = 1507/3110 (48.46%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKF------HYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYE--------PVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKK---FFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDF------------------VKEKIVDLLAVIHQDVFSNCLKYFNQY-----RRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQ--RRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNS-------------------VRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPED------EDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFI-EDVPFKIGSL-SREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVH-SRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKG--------MSWKTICYMLGEIQYGGRVTDDYDKRLL-----NTFCRRWFNDD-MFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSF---EVME-RLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPN----CFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVL 9211
            ++A +   Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQ +E+ GFY       ++S+  + FV A   P   GR+ +  R  RH  I     P   S+ +IY             F  +++ M   + GL  +L  +  +    +   F      HYV++ R+L+R  +G+    + + S S+++L+RLW HE  R+  DRL+ E + +W ++ +             D   ER YF +  R           D A   P +Y         PV   EL   +  RL  F   Y E +    + LV F   + HV++I R+ R  +G++LL+G  G+GK +++R  +++     FQ+ +   Y   +F ED++++ R AG  N+   F+  ++ + D  +LE +N +LA+G + GLF  +E   +++ +    ++       H    + LY++F  +V  NLH+V   +P G   R+RA   PAL + C +NWF  W + AL  V         L   D+                   ++ +V+ L ++H+ V     + FN+       R +  T + +L +I  + +++   ++ +      +  GL K+ E +E +  L K L++K   L      A   L  +      AE  K     ++ + A  ++++   +   E  L   +PA+ EA+ A+  IK + +  V+ +  PP  ++  ++ + IL  +             V T W    +++   +F+  +L F  +L+  EI+  ++ Y    D+  +   ++      +  W +A   +  +  +V PL++ L       AK   + +  +  +TE EE +   K EY   I + + ++ D    ++K++ + +L++ L+ E+ RW+  S  F  Q+  LVGD ++ SAF++Y G ++Q  R ++F  W + + N G+     +  +E LS  +   +W L  LP D L  ENAI++ + +RY L IDP  Q   +I+ +    +I  T+F ++ F+++LE AL  G+ L+++D+ E  DP LN VL +   + G  + + +GD+++D+   F +++ T+ S   FSP+I ++ + ++F+VT   L  Q L  V+  E+ +++  RN LLK       +++ LE +LL  L  ++G +++D +++  L K K  + +V+ + A+      E++    +Y+ +S   S +Y  +  L+ ++ +Y   L   + +F + +   E S      +R++ I + +   ++  + R +   D+    LLL +++ + +N                     + +E +  + GG  LD  T++ K           ++    K+  F  +   +  +     +W   D PE       +D       +      L+++    PDR +  A R +     DHF+ +D    I S+   E     P+L   + G D +  IE  A + + Q+ +I++G  +  + +   +  A + G WVLL+N HL+  ++ +L ++ + +   H  FRL++T EIHPK P S L+ S     EP  G+KA + R+ +S     L  +   + R +   V +LH  VQER ++ PLGW+  YE++ ADL  +   +   +D   + +G        + W T+  +L +  YGG++ + +D+ LL     N F  + F  D +  PK+        P +SK ++ I  + EL N   P   GL +NA+    +K  +S+L  +L +   D      E  +  V       LG+L   ++     E+++ R  +  I  P+  F  +EV+   +++  +R  L ++          N + R    S+    +P+           T+  W T+L ER  Q       G  N     FW+ G F+ + ++TA RQ+V +A+  W+L+ + L
Sbjct:  539 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV-------------DTTAER-YFGNACRL----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSH----DELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTV-----QKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGE------------NVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQL-EKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVD--AVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIR--IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNL 3540          

HSP 2 Score: 56.225 bits (134), Expect = 6.128e-7
Identity = 33/139 (23.74%), Postives = 71/139 (51.08%), Query Frame = 3
Query:   30 WGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELL 446
            W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+
Sbjct:  386 WLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLI 522          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 871/3110 (28.01%), Postives = 1507/3110 (48.46%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKF------HYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYE--------PVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKK---FFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDF------------------VKEKIVDLLAVIHQDVFSNCLKYFNQY-----RRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQ--RRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNS-------------------VRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPED------EDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFI-EDVPFKIGSL-SREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVH-SRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKG--------MSWKTICYMLGEIQYGGRVTDDYDKRLL-----NTFCRRWFNDD-MFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSF---EVME-RLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPN----CFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVL 9211
            ++A +   Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQ +E+ GFY       ++S+  + FV A   P   GR+ +  R  RH  I     P   S+ +IY             F  +++ M   + GL  +L  +  +    +   F      HYV++ R+L+R  +G+    + + S S+++L+RLW HE  R+  DRL+ E + +W ++ +             D   ER YF +  R           D A   P +Y         PV   EL   +  RL  F   Y E +    + LV F   + HV++I R+ R  +G++LL+G  G+GK +++R  +++     FQ+ +   Y   +F ED++++ R AG  N+   F+  ++ + D  +LE +N +LA+G + GLF  +E   +++ +    ++       H    + LY++F  +V  NLH+V   +P G   R+RA   PAL + C +NWF  W + AL  V         L   D+                   ++ +V+ L ++H+ V     + FN+       R +  T + +L +I  + +++   ++ +      +  GL K+ E +E +  L K L++K   L      A   L  +      AE  K     ++ + A  ++++   +   E  L   +PA+ EA+ A+  IK + +  V+ +  PP  ++  ++ + IL  +             V T W    +++   +F+  +L F  +L+  EI+  ++ Y    D+  +   ++      +  W +A   +  +  +V PL++ L       AK   + +  +  +TE EE +   K EY   I + + ++ D    ++K++ + +L++ L+ E+ RW+  S  F  Q+  LVGD ++ SAF++Y G ++Q  R ++F  W + + N G+     +  +E LS  +   +W L  LP D L  ENAI++ + +RY L IDP  Q   +I+ +    +I  T+F ++ F+++LE AL  G+ L+++D+ E  DP LN VL +   + G  + + +GD+++D+   F +++ T+ S   FSP+I ++ + ++F+VT   L  Q L  V+  E+ +++  RN LLK       +++ LE +LL  L  ++G +++D +++  L K K  + +V+ + A+      E++    +Y+ +S   S +Y  +  L+ ++ +Y   L   + +F + +   E S      +R++ I + +   ++  + R +   D+    LLL +++ + +N                     + +E +  + GG  LD  T++ K           ++    K+  F  +   +  +     +W   D PE       +D       +      L+++    PDR +  A R +     DHF+ +D    I S+   E     P+L   + G D +  IE  A + + Q+ +I++G  +  + +   +  A + G WVLL+N HL+  ++ +L ++ + +   H  FRL++T EIHPK P S L+ S     EP  G+KA + R+ +S     L  +   + R +   V +LH  VQER ++ PLGW+  YE++ ADL  +   +   +D   + +G        + W T+  +L +  YGG++ + +D+ LL     N F  + F  D +  PK+        P +SK ++ I  + EL N   P   GL +NA+    +K  +S+L  +L +   D      E  +  V       LG+L   ++     E+++ R  +  I  P+  F  +EV+   +++  +R  L ++          N + R    S+    +P+           T+  W T+L ER  Q       G  N     FW+ G F+ + ++TA RQ+V +A+  W+L+ + L
Sbjct: 1471 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV-------------DTTAER-YFGNACRL----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSH----DELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTV-----QKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGE------------NVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQL-EKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVD--AVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIR--IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNL 4472          

HSP 2 Score: 56.225 bits (134), Expect = 6.159e-7
Identity = 33/139 (23.74%), Postives = 71/139 (51.08%), Query Frame = 3
Query:   30 WGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELL 446
            W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+
Sbjct: 1318 WLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLI 1454          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 871/3110 (28.01%), Postives = 1507/3110 (48.46%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKF------HYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYE--------PVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKK---FFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDF------------------VKEKIVDLLAVIHQDVFSNCLKYFNQY-----RRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQ--RRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNS-------------------VRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPED------EDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFI-EDVPFKIGSL-SREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVH-SRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKG--------MSWKTICYMLGEIQYGGRVTDDYDKRLL-----NTFCRRWFNDD-MFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSF---EVME-RLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPN----CFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVL 9211
            ++A +   Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQ +E+ GFY       ++S+  + FV A   P   GR+ +  R  RH  I     P   S+ +IY             F  +++ M   + GL  +L  +  +    +   F      HYV++ R+L+R  +G+    + + S S+++L+RLW HE  R+  DRL+ E + +W ++ +             D   ER YF +  R           D A   P +Y         PV   EL   +  RL  F   Y E +    + LV F   + HV++I R+ R  +G++LL+G  G+GK +++R  +++     FQ+ +   Y   +F ED++++ R AG  N+   F+  ++ + D  +LE +N +LA+G + GLF  +E   +++ +    ++       H    + LY++F  +V  NLH+V   +P G   R+RA   PAL + C +NWF  W + AL  V         L   D+                   ++ +V+ L ++H+ V     + FN+       R +  T + +L +I  + +++   ++ +      +  GL K+ E +E +  L K L++K   L      A   L  +      AE  K     ++ + A  ++++   +   E  L   +PA+ EA+ A+  IK + +  V+ +  PP  ++  ++ + IL  +             V T W    +++   +F+  +L F  +L+  EI+  ++ Y    D+  +   ++      +  W +A   +  +  +V PL++ L       AK   + +  +  +TE EE +   K EY   I + + ++ D    ++K++ + +L++ L+ E+ RW+  S  F  Q+  LVGD ++ SAF++Y G ++Q  R ++F  W + + N G+     +  +E LS  +   +W L  LP D L  ENAI++ + +RY L IDP  Q   +I+ +    +I  T+F ++ F+++LE AL  G+ L+++D+ E  DP LN VL +   + G  + + +GD+++D+   F +++ T+ S   FSP+I ++ + ++F+VT   L  Q L  V+  E+ +++  RN LLK       +++ LE +LL  L  ++G +++D +++  L K K  + +V+ + A+      E++    +Y+ +S   S +Y  +  L+ ++ +Y   L   + +F + +   E S      +R++ I + +   ++  + R +   D+    LLL +++ + +N                     + +E +  + GG  LD  T++ K           ++    K+  F  +   +  +     +W   D PE       +D       +      L+++    PDR +  A R +     DHF+ +D    I S+   E     P+L   + G D +  IE  A + + Q+ +I++G  +  + +   +  A + G WVLL+N HL+  ++ +L ++ + +   H  FRL++T EIHPK P S L+ S     EP  G+KA + R+ +S     L  +   + R +   V +LH  VQER ++ PLGW+  YE++ ADL  +   +   +D   + +G        + W T+  +L +  YGG++ + +D+ LL     N F  + F  D +  PK+        P +SK ++ I  + EL N   P   GL +NA+    +K  +S+L  +L +   D      E  +  V       LG+L   ++     E+++ R  +  I  P+  F  +EV+   +++  +R  L ++          N + R    S+    +P+           T+  W T+L ER  Q       G  N     FW+ G F+ + ++TA RQ+V +A+  W+L+ + L
Sbjct: 1471 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV-------------DTTAER-YFGNACRL----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSH----DELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTV-----QKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGE------------NVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQL-EKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVD--AVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIR--IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNL 4472          

HSP 2 Score: 56.225 bits (134), Expect = 6.159e-7
Identity = 33/139 (23.74%), Postives = 71/139 (51.08%), Query Frame = 3
Query:   30 WGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELL 446
            W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+
Sbjct: 1318 WLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLI 1454          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 904.049 bits (2335), Expect = 0.000e+0
Identity = 833/3074 (27.10%), Postives = 1450/3074 (47.17%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNP---GYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVR-TDFLMNTVASQEKAVLLI-GEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKR--MGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPG-GGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSF-ELLKERLSMFNKSYNETVRGSPIN--LVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVA--EEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLE--AARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKF--RFFKDHSIPAVSKLNEYIDIINE-LPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRE------SVVYRMC--DDMLGK-LPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTI--IMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESK-SKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALL 9559
            +S  ++ + +S  Y   F        ++L++    + Q   +Q  W+YLE +F  G     LP EA RFS +D  +  I++   ++  ++  C   ++L + L  +++QL  CQK+L  +LE+KR  FPRF+F+ D  LLEILGQ+++P  IQ+H+  +F  I  V+F     ETI++  S EGE + L K V+    VE WL  L +  +R+L  +   A   + D + +    L  YP+QV  L  ++ ++  S E  +N  SD       + +  LL  L          KV   K ++LI   +H  D+ DQL+ ++ KS + + W +Q RFY V      ++     +F Y  E+ G   +LV TPLTD+CY+TL QA+ M +GG P GPAGTGKTE+VK +   +G+ V+VFNC + +D   +GRIF G+ + G+WGCFDEFNR+D  VLS  + QI  +    K R     F  G  V +NP   IF+T+NP   GY GRQ++P+NLK  FR V M  PD ++I    L S GF+D   LARK  ++++L  + L+KQ HYD+GLR +  VL   G  +R      E   V++ L    LSKL   D   F SLI+D+F  +  +   + EL   +     E  I      + K+ QL+E  R R G++ +G +G+GK+    +L ++L    +P +  + NPKA+   ++ G +D+ T +W+DGI +   R   K     H W+V DG +D  W+E LNSVLDDN+ LT+ +G+RI    +   +FE  ++  ASPATVSR GM+Y+S   +    ++  WL+K   +    M       F   +R       +K+  + +F +     L  GL   K  K  +Q           F V+   G L  +    + E + +      + +P  +    D   D ++S   + V  N   EE +  +D  P      V   D  R +D + + + S  +   LI G  G  K  ++ K+    +PE  +      + ++   + Q   ++ V      G  + P     M +F+  IN+P  +++G      +++Q +  +GF+  D   +++S+ ++ FV +M   G G    I  RL    R  +      + +  IY    L    +E   R+S I + ++++ +  K+    ++  +PT S   ++F+ RDL+     L+  + D      KL  +   E  R+ +DRL  E+D   FE  +   +  S+        NE   F + +     TV  G  ++   +  I   +  F +LL + ++ F  ++       P+   L FF         I RV+    G++ L G  G G++   RL + + +   F   +T  ++   F  +LK+    A   N+  V +  D++++   +L+ IN++LASG + GLF+++E+D +++ V                 L Q+   R+R  +H+VL        F+      PA+   C + +  ++ + +LV + + ++    +   D +     D+L  + + +    +KY                 +++ +  +    + ++S+  ER++ G+ KL EA++ +  + K+   K + L+   AEA+  L  +T+  + AE    K+   + K A   E +R+++Q A  +E+L   +P + EA  A+ +IK   +S +R L+ PP  ++ I+  VL LF   +D            TSW    K L+ +   + ++ F  + I  EI   +     ++    E   A+++    A L AW KA  ++  +  ++ PL+         L KA+  +++  K L   +EV+  +K +++  +K    ++ D    +  +  A  L+  L  E  RW +Q   F  +   +    ++ SAF++Y G  +++ R  +    +S+ +   +P   T   +   S   +   W  +GLP D+LS+EN  I+  +    L ID   Q   + L+K  E    T           +E A+  G  +II+DI E  D AL  +L K+    G    +  G K +D +  F +Y  T+       P  Y + ++++F+ T+  L  QLL + I++EK ELE   + LL+     K +++ LE  LL++LA+++G+L+E+  LL  LNK+K+++  ++  I ++    +E+   ++ Y  +S   S L+F  ++L   NPMY   +   ++LF  +I   E       R++ +   M + ++  I R +++ DR  F +        +    ++ EL   +    + DL  +    ++WI     L  +A  + H+ S      +  +  W   F K    +   P   E  +  F+K+L I+   P+R       ++ +TL    I    F++  + +E+++  P+L +L+ GADP+  +   A   ++   +ISMGQGQE+ +   I ++  +G W+ L N HL L  +  +   +  T   H++FRLW+TTE   +FP   LQ S+K T EPP G++  + RTYT  ++   ++         ++ +A+LH  +QERR F P GW   YE+  +D+  +  FV+     +   K   W+ +  +L  + YGGR+ +D+D ++L+++    F D+  N +   +  K   + A + + EYI  I++ +P+ D P +FGL  N   ++Q   A   +  I  +   D      +  +      S+  ++C  DD+  + LP+   S + +  +  +  +  +++   +++ R    +AK   T      A+  TI  ++ +   D  DSM+      +         T G    +L E +   S       P  F  +  F    FL A+RQ  +R  K   LD ++L +  T         P  + V V GL L+GA +D   S L E+  S   +   P++      ++   E S  +     Q PVY    R+DL  I SV + C   + AD W + AVAL 
Sbjct: 1265 DSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRG----ALPSEASRFSRVDSEYRAILNDVSKDARLVSLC-SRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTG-ETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQA---VADAQPS----LAKYPSQVLCLAEEVKFSA-SIENNLNGSSD-----LNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNG--GIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTF-GGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTSVHH-WIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSWIEEHF---WRCLKWVRSHKISGITSFAI-----LKNGLTHLKASKTKTQ-----------FLVLLFNGFLPTVTPENRQE-FAKGVVFQGMSVPDPKNICYDERIDGIMSYTDD-VSQNVTKEE-VEREDLRP-----FVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLL-KHCFQNDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFF--DHNLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTY-LTPILEEVGERNSEI-IANRMVDIYNKV----QSNFRPTDSVV-FLFSPRDLTNWVVSLLRHELD----QGKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQA-------NETVIFKEKVYVTTGTVVPGESNTGLPLTPIN--MSDFNQLLAKSINRF--AFEIANFNCPLTSQLAFFCAC------IDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEA-----ANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMESQGITTTDAILTGFNDVLVNLPEHLSIQPIKY---------------RQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAE--DQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVL-LFMGILD------------TSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLL---KSMCKMFNMP--PTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLF-LSKFLEKS-ETFKAAQPDLMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKS--STRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKEWELFTGVLVDESTDLSALR---VQWI-SPDRLQSLARIRTHLPSLFNNFQIQDDATWNE-FSKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLSLT-TPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVITCQS----IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQ----LTANKA-DWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKISQIVSLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLI--KQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRG--TLQLFESSKSSSL---LSSPIDF--SDLFYPNIFLNALRQTTSRQIK-IPLDQLILSSAWTPS-----QLPAKQCVQVQGLLLQGATFD---SFLRETTVSSAAYSQAPIVF-----LAWTSESSSTITGEQIQVPVYSSSERSDL--ICSVNMPC---RGADQWNIAAVALF 4169          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 108.997 bits (271), Expect = 6.449e-23
Identity = 77/303 (25.41%), Postives = 156/303 (51.49%), Query Frame = 2
Query: 5276 RMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLL-QPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARW 6181
            + + G++K+K A+E +  +  EL   +  L   S E   +++ + K+T   E  +  V   ++K      K +  +  +E +L +A PAL+ A +AL T+  +D+S+++ ++ PP+ ++  M+ V IL   K    I +   + V   WV   KLL+  +FL  + +F RD ++++ + L+ + Y ++E++  E  ++      GLC W  A++ +  +++ V P ++ L    +++ +    L+   K L +  E L  +  ++    ++KQ LES  + C  +M  A +L+  L  EK +W
Sbjct: 2124 KYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVK-PAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKW 2425          

HSP 2 Score: 67.0106 bits (162), Expect = 3.440e-10
Identity = 84/350 (24.00%), Postives = 150/350 (42.86%), Query Frame = 2
Query:  491 IQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVK---AESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVG--LLGIQLLWTRDST---EALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKF-ETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLG 1513
            I+  +  L N +  +  +      W  +E VF   DIA Q+P E + F  I   W+ I ++  E   +L+     + L+  L  L       +     YL KKR +FPR F +SD  +L ++  + +P   +S++  +F ++ T  F +     I++  S + E + L KPV    ++ +VE W+  L +  + +L   IR     +N     V   LN  P QV    L I   W  +++    +L    S+ KI  +  +  +L              K +R +F   L  I+     + ++L+ ++V    D+ W  Q R+Y+   ++   + +  V   Y  E  G
Sbjct:  811 IRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTT--FDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILN-EPIQVAAVYLKIAFTWQMENSMKQNSLTILASELKICIRDCQHAVL-------------HKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYW--HLENVFIRVGTVSTRYDYEVQG 1141          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 3603.91 bits (9344), Expect = 0.000e+0
Identity = 1804/3075 (58.67%), Postives = 2310/3075 (75.12%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISRI----------------------HYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1640 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4700          

HSP 2 Score: 239.58 bits (610), Expect = 2.702e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1479 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1629          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 3602.37 bits (9340), Expect = 0.000e+0
Identity = 1804/3075 (58.67%), Postives = 2310/3075 (75.12%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISRI----------------------HYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1632 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4692          

HSP 2 Score: 239.58 bits (610), Expect = 2.656e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1471 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1621          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 3593.51 bits (9317), Expect = 0.000e+0
Identity = 1805/3099 (58.24%), Postives = 2309/3099 (74.51%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1632 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4716          

HSP 2 Score: 239.58 bits (610), Expect = 2.530e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1471 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1621          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 3593.13 bits (9316), Expect = 0.000e+0
Identity = 1805/3099 (58.24%), Postives = 2309/3099 (74.51%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1640 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4724          

HSP 2 Score: 239.58 bits (610), Expect = 2.776e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1479 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1629          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: kl-3 (gene:FBgn0267432 transcript:FBtr0346771)

HSP 1 Score: 3358.54 bits (8707), Expect = 0.000e+0
Identity = 1682/3059 (54.99%), Postives = 2252/3059 (73.62%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGL---IPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI--EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETE------VIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  ++ +  S+ YN PFKKDIQ  +SKL N+ +I+E+W+ VQNLW+YLEAVFVGGDI+KQLP EAKRF+NIDKS++KIM RA E  N + CC GDE+L+  L  LL+QLE CQKSLTGYLE KRL+FPRFFFVSDP LLEILGQASDP +IQ HLLS+FD I TV F EK  + I +  SM  E ++ E  V+   +VE+WL  LL   Q ++  ++   + S+ND EFN  E    +  Q G++G+QLLWT+DS  AL   ++D+ IM++TN +FL+LLN  I  T  DL  ++R +FET++TIHVHQ+DIFD L   ++KS  DF+W KQ RFY+ ED D  IV ITDV+F+YQNE+LG TERL ITPLTDRCYITLAQA+GM MGGAPAGPAGTGKTET KDMGR LGK VVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KE++  F+F DGD+V +NPEFGIF+TMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVK+ASCGF +N+VL+RK YTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG QKR+NP DTE+T VMRVLRDMN+SKL+D+DE LF+SL++D+FPGI+L    Y +L+ AI +  DE   +++P W LK++QL+ET  VRHG+M +GP+G+GKT+C   +++  T+ G  H+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRR+LK  + ++ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRI M+ + K++FE  N+DNASPATVSR GMV+ SSS L W   ++ WLLK+  +   +    +   + D + +    L+ KM  LEA  +RQ  D+++GL   +P + EK          ER+++FS+MWS+GA+LE+ +R KLE ++  + + KL  PK  +   +T+F+Y V +NG W HW+++VEE+ YP+D  PE+ SILVPNVDNVRT FL++ +A Q K VLLIGEQGTAKTVMI  Y+   +PE H+FKS NFSSAT P M+QR IES+V+KR G+TYGPP  R MT+FIDDINMPVINEWGDQI NEIVRQ IE +GFYSL++PGDF +++D+  ++AMIHPGGGRNDIP RLKRH  IFNCTLP+  S+D+I+  IG G++  +R     V+ ++  L+ LTR  WQ+ K KM PTP+ FHYVFNLRDLSRIW+G++  + +   S  ++L+LW HEC+RV+SDR   E D  WF   +  +  L+  E +EF   P E TY+VDFLRDAPE  EE  ++ +F  PKIYE +PSF+ ++ ++ +F   +NE +RG  ++LVFF+DA+ H++ +SR+I   +GN LLVGVGGSGKQS+TRL+SFIA Y  FQ+T+TR YN  N  EDLK +YR AG +  G  F+FT NEIK+ES+LE+INN+L+SG IA LF+K+E+DE+ S +   MKK  P+ P TQ+NLY +F+ R R NLH+ LCFSP+GEKFR R+L FP L SGC I+WFQKWP++A + V++H L D+ +VC + VK++++D+++ IH+ V   CL Y++++RR   +T KS +S+++ YK +Y+  +  + +++ERM +GL KL EA  ++ +L K+L    + +++AS EAE VLA V +   AAE VK +V   K +   +V+ I   + VAE KL  A PAL+EAE AL TIK  DI+TVRKL KPP+LI  IMDCV ILF++K+ P  PD E+  +++SW ESLK+++ T+FL  ++ +P DLIN E++D++ PYF    Y  EAA+ +CGNVAGL +WT AM K++ VN+EV+PLK +LA Q     KA  DLQ AE++L +KE  LA V+   + A+ +K A+  +A  C+ KM  A  L+ GL  EK RWT Q   F+S+   LVGD+++L+AF+SY GPFNQ+FR  + S W   I    +PI+  ++I+E L++ +QIGEWN+QGLP D+LS++N II T+A R+ L IDPQSQGK WI NKE ++ ++ T   +KYF+ HLED+++ G P+IIED+ EELDP L+N+L++N +K+GT  K+K+GDKEVD +  F  YITTKL NP ++PEI+A+TS+IDF+VTM+GLEDQLLG VI  E++ELE+ R QL++  + N +K+KELE +LL++L+ T+GSL++D  ++ VLN +K T+ +V  +I  A  TE +IN AREEYR ++ RGS+LYFL+  ++ VN MYQ+ L QFL  F  S+  S K+   Q+RI+ II+ +T  I+ +  R LY+ D+  F LL+AL +D +   +  +E  V +KGG+AL+L    P P +W  D TWLNLV L+ L  F  ++ ++  +E+ W  W+ KDAPE+E IP GY + LD F+K+LL+R WC DRT+   R+YI  +LGD F E V      L  E+    P++  LSLG+DP+  IE  AKK+ ++   ISMGQGQE+H+R++I   +++G WVLLQNCHL L+YM EL  Q++E E       ++ +FR+W+TTE HPKFPI+ LQM +K+TNEPP GI+AG+KRTYT+ +QDFLD S    + P+VY++++LHT VQERRKFGPLGWNIPYE+N++D  AS  FVQNHLDD++  KG+SW T+ YMLGE+QYGGRVTDDYDKRLLNTF R WF+D +F   F+FFK + + +  +   Y+  I+++ N D P+++G HSNA+ITYQ+ T ++ILD I++IQPK++SAG GE+RE  V R   +ML K P  +  F+V + L  MG    MNIFLRQE+DRMQ++I  VR+   DL LA++GTIIM+E+LRDALD++++AR+P+ + + SW SS+LGFWFTEL+ER++QF  W F  RP  FWM+GFFN QGFLTAMRQEV RAH+GWALD V + NDV K   +E  +PP EGV+VYGL+++GAGWD+R S+L+E+ +KVLF  +PVI I AI  S   + S+     +Y CPVYKK  RTDL +I +++L+    K  DHWTLR VALLCD+K
Sbjct: 1559 DSLMIMNSLASNRYNAPFKKDIQLWLSKLVNTGDILEKWLMVQNLWIYLEAVFVGGDISKQLPMEAKRFTNIDKSYVKIMMRAREIPNAVDCCTGDESLATNLTWLLDQLETCQKSLTGYLESKRLVFPRFFFVSDPVLLEILGQASDPTSIQPHLLSIFDAIATVDFQEKSIDIIESMNSMNREKVKFENTVQCLGSVELWLGRLLKEMQDTIRTILAQMSVSLNDPEFNFAEEFPSFCGQAGVVGVQLLWTKDSEYALRKCRTDKTIMKRTNNKFLVLLNFFIDLTVKDLTSLDRIRFETMVTIHVHQRDIFDDLCTLRIKSAGDFEWQKQARFYYNEDNDDVIVGITDVNFVYQNEYLGVTERLAITPLTDRCYITLAQAVGMCMGGAPAGPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKEKRSTFIFLDGDIVSLNPEFGIFITMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKMASCGFKENVVLSRKMYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGSQKRSNPNDTEETIVMRVLRDMNVSKLIDEDEGLFVSLVDDMFPGIKLTTNVYKDLQKAIIKVCDELGYVNNPEWNLKVVQLYETSLVRHGLMLMGPTGSGKTSCTVCMLRCFTEMGRTHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRSLKVPQHQNCWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIKMADNSKLVFEPDNVDNASPATVSRVGMVFTSSSVLSWKIYMEAWLLKQGEDSE-VFRRCYDVLYDDAHVFLQSRLLAKMRILEAIYIRQMLDIMDGLLLDLPLRTEK--------ALERIFLFSLMWSLGAVLELSEREKLEEFLLKHVS-KLRWPK--RGVNETIFEYYVDDNGNWQHWSTRVEEFRYPEDEIPEFSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPEVHIFKSFNFSSATTPNMYQRIIESYVEKRQGTTYGPPNQRAMTIFIDDINMPVINEWGDQITNEIVRQMIEQRGFYSLERPGDFSTIMDIQMLSAMIHPGGGRNDIPNRLKRHLCIFNCTLPSNNSMDQIFKSIGAGYFSPDR-LGDEVVEVIPLLVPLTRIFWQNVKAKMLPTPANFHYVFNLRDLSRIWEGILKVKHEECKSVDQILKLWCHECTRVISDRFTAEKDKIWFSSKMISDAELNIKEFMEFY--PEEPTYWVDFLRDAPEGQEEEDEEMSFEPPKIYEEIPSFDFVRSKVLVFMSQFNEYIRGYNMDLVFFMDALKHLMIVSRIISNPRGNALLVGVGGSGKQSLTRLSSFIAGYKFFQMTLTRSYNTGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILSSGEIANLFAKDELDEMYSELIPVMKKHQPRRPATQDNLYDFFISRARYNLHIALCFSPVGEKFRMRSLKFPGLISGCVIDWFQKWPEDARIAVSRHYLTDYQIVCSEKVKDQVIDIMSWIHESVQETCLSYYDRFRRVTFVTPKSLISFLESYKLLYKDKQDHIVIMSERMSSGLDKLDEAGASVAILKKDLIEMNKVIALASEEAEDVLATVEQSKAAAEIVKVEVAEKKGQAEVLVKNISAVKHVAEAKLEKALPALEEAEAALKTIKAADIATVRKLGKPPYLITLIMDCVCILFRRKVKPIRPDTEKAFIQSSWDESLKVMSDTSFLRKIVEYPTDLINAEMVDMMVPYFQYPQYTFEAAKVACGNVAGLLSWTMAMSKYFEVNKEVLPLKANLAVQEAKYQKASSDLQEAEELLQQKENELAEVQQTLEDAVSKKDAVLDEAKKCQDKMDAATALIGGLAGEKIRWTEQIASFKSETDRLVGDVILLTAFLSYTGPFNQEFRSDLQSIWTKQIIEKMIPISANVNIIESLTDRSQIGEWNIQGLPTDELSIQNGIISTKAMRFPLLIDPQSQGKVWIKNKEKQNKVIVTTLNHKYFRNHLEDSVSMGIPIIIEDVAEELDPCLDNLLDRNLLKVGTQYKIKIGDKEVDWNPAFRCYITTKLPNPAYTPEIFARTSIIDFTVTMRGLEDQLLGRVILAERKELEDERVQLVETVTGNMKKMKELEANLLQKLSTTKGSLLDDVTVIEVLNTSKNTAIEVKEKIEIAKVTEAKINAAREEYRVVATRGSVLYFLVCSMARVNNMYQTSLVQFLERFDASMYNSSKTHITQKRIKRIINYLTFEIYRYKSRGLYEKDKFLFVLLMALSIDRQLELITFDEFQVFIKGGAALNLNDCPPVPFRWTTDETWLNLVQLTNLTPFVNILSKVSGNERAWFTWYKKDAPENEIIPDGYNS-LDPFRKMLLVRSWCMDRTISQCRKYIANSLGDRFAEPVVLNFEELLLESRELMPMICFLSLGSDPSSNIELLAKKNELKCHPISMGQGQEIHARKLILSCLEDGGWVLLQNCHLGLEYMVELTVQILELERQGKDAAVNPNFRIWITTEPHPKFPITLLQMCLKYTNEPPAGIRAGLKRTYTNLSQDFLDYSQSPFYLPLVYSISFLHTVVQERRKFGPLGWNIPYEFNSSDWYASCLFVQNHLDDIEQGKGISWVTVRYMLGEVQYGGRVTDDYDKRLLNTFTRVWFHDTLFEDCFQFFKGYKVYSFKEQEAYLAAIDDMANVDPPQVYGFHSNAEITYQTNTMRNILDEIMSIQPKESSAGTGESREDRVARQVKEMLSKTPLAFDLFDVKQHLIAMGATSSMNIFLRQEIDRMQRIIILVRSIFKDLLLAVEGTIIMSENLRDALDNIFNARVPTVFKRGSWVSSSLGFWFTELLERHTQFYNWCFGARPVVFWMSGFFNPQGFLTAMRQEVARAHQGWALDQVTMHNDVLKVGPEECKKPPKEGVFVYGLFVDGAGWDKRTSRLVEATNKVLFTLMPVIHIYAI-FSTAAKNSK-----LYTCPVYKKINRTDLNYICALWLQS--NKHPDHWTLRGVALLCDVK 4593          

HSP 2 Score: 189.504 bits (480), Expect = 3.743e-47
Identity = 87/151 (57.62%), Postives = 113/151 (74.83%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            ++  YY++ W DV+IEKIS EL++FQ RCRKLPKG++ WPAF DL+  IDDFN   PLLELMTN AMK RHW R++ L +  FD  +  F L  +LEAP+LK+KE++EDIC+ A KE DIEAKLK + ++WS   L  G FKNRG+L+L+G
Sbjct: 1397 TITDYYEMPWADVNIEKISAELSDFQLRCRKLPKGMQSWPAFIDLKTKIDDFNETCPLLELMTNKAMKERHWIRLNALFNTDFDPTNPKFTLGKLLEAPILKYKEDVEDICVGASKELDIEAKLKQIVSDWSLVSLQLGQFKNRGDLVLKG 1547          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4032.64 bits (10457), Expect = 0.000e+0
Identity = 1970/3059 (64.40%), Postives = 2450/3059 (80.09%), Query Frame = 2
Query:  419 NV*ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSE------VVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRC--PPTKQADHWTLRAVALLCDIK 9571
            N+ +S  V+ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL++FDNIK V+FHEK Y+ ILA  S EGE +EL+KPV AE NVE+WL  LL  +QRSLH VIR A  +I D+ F ++EFL+ +PAQVGLLGIQ++WT+DS +AL NA+ DRKIM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF ED D+ +++ITDV F+YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+K F+FTDGD V+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNI LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYP+LE+AI++Q+ EA +I+HPPW LK+IQL+ETQRVRHGMM LGPSGAGKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNI+NASPATVSRNGMV+MSSS L+W P+L+GWL  R++ E  ++ +LF++SFP++YR+SIQ L YKME LEAF++ Q  ++L+GLI  K++    ++SR H ERLY+F++MWS+GALLE++DR KLE ++R++++I LDLP I   SEDTMFD+ V+ +G WVHWN++VEEYIYP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  Y+S  +PE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQ +E  GF++L+KPG+F +++D+ F+AAMIHPGGGRND+P+RLKR F IFNCTLP+ ASID+I+ VIG GHYC  R F   V N V +L+ LTR+LWQ TK KM PTP+ FHY+FNLRDLSRIWQG++   ++VIS+ + LL+LW HEC RV++DR     D+ WF+  +   +++        VV+        +YFVDFLRDAPE   +  +++ F +PK+YEP+ SF+ L ERL+MF   +NE++RG+ +++VFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI+S +   MK+ FP+ P T ENL++YF+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+AL+ V++H L  + + C   VK ++V  +      V   C  YF +YRRS  +T KSYLS+I  YKT+Y+   + V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+A+A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D E+     SW ESLKL+ + NFL SL  FP+D INEE+++ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +LA Q   L  A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT  S EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +++ E L +   + EWNLQGLPND LS++N IIVT+A+R+ L IDPQ+QGK WI NKE+++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G   KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VTM+GLEDQLLG VI  EK+ELE  R  LL+  + NKRK+KELED+LL RL +T+GSLV+D++L+ VL   K+T+ +V+ ++  AA+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+ +S KSP   +RI +II  MT  +  +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK   PK  KWI+D+TWLNLV LSKL  FS +++QI   EKQWR+WFD++APE+E IP  Y+  LD F++LLLIR WCPDRT+  AR+YI +++G+ + E V   +     E++ +TPL+  LS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++  +M  G W LLQNCHL LD+M+ELMD + ET+ +HD FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   +QD LD+SNM+QWRPM+Y VA+LH+ VQERRK+GPLGWNIPYE+N AD NA++QFVQNHLDD+DIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF+P F F+K +SIP  S +++Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE++V R+ DDML KLP D+V FEV ERL  MG LQPMNIFLRQE+DRMQ+VI  VR TL DLKLAIDGTIIM+E+LRDALD MYDARIP+ W K SW S+TLGFWFTEL+ERN QF +W+F+GRPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VT+ M+D+I QPP+EGVYVYGLYLEGAGWDRRN KLI+SK KVLFE +PVI + A     E    +D    +Y  P+YKKP RTDL +IA+V LR   PP    ++W LR VALLCD+K
Sbjct: 1484 NMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLEQLEMCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNIFDNIKCVRFHEKMYDKILAISSREGETIELDKPVIAEGNVEVWLNALLKESQRSLHLVIRQAALAIQDSGFELIEFLDSFPAQVGLLGIQMIWTKDSEDALSNARYDRKIMSKTNQFFLELLNNLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIKSPTDFEWLKQCRFYFNEDSDKMMINITDVGFVYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRKNFIFTDGDNVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPNDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPDLESAIDKQVTEAGLINHPPWRLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIENASPATVSRNGMVFMSSSVLNWSPILEGWLKNRSAQEGMVLKDLFSSSFPELYRFSIQSLQYKMEMLEAFIIMQCINMLQGLIQPKEQ--GGELSREHMERLYVFALMWSVGALLELDDRMKLERWLRNHDSIHLDLPNIPPHSEDTMFDFYVTNDGHWVHWNTRVEEYIYPPDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYMSKYDPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQNGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDVPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSHRGFSEEVRNTVGRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLGVTAEVISTPQLLLQLWKHECKRVIADRFTAPEDVAWFDSTLAKLVEEQLGEEEREVVDL----GVDSYFVDFLRDAPEATGDEPEETDFDMPKVYEPIESFDSLMERLNMFLSHFNESIRGASMDMVFFRDAMIHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNTANLMEDLKGLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEIISDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSPVGERFRNRALKFPALISGCTMDWFSRWPKDALIAVSEHFLSTYDIDCTLEVKSEVVQCMGSFQDGVAEKCADYFQRYRRSTHVTPKSYLSFIHDYKTIYKEKHSEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANAKADMVLKEVTVKAQAAEKVKVEVQKVKDKAQAIVDSISADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNTVKTDPEKNCTMPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVEFLSPYFDMVDYNIETAKRVCGNVAGLCSWTKAMAAFFSINKEVLPLKANLAVQENRLTIANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDAERCRHKMQTASSLISGLAGEKERWTQLSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLTDWQREMKFRQIPFRTNLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIKNKESKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGFTYKVKIGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKERTDLLEDVTANKRKMKELEDNLLFRLTSTQGSLVDDESLITVLGNTKRTAEEVTQKLQIAAETEIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLTKSSKSPITSKRIANIIEYMTFEVHKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPPKAAKWILDITWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDREAPEEEPIPNAYDQALDCFRRLLLIRSWCPDRTIAQARKYITQSMGERYAEGVILDLEKTWEESEPRTPLICFLSMGSDPTDSIIALGKRQRIETRYVSMGQGQEVHARKLLQHSMANGGWALLQNCHLGLDFMDELMDTITETDSVHDTFRLWMTTEVHKHFPITLLQMSIKFTNEPPQGLKAGLKRTYGGISQDLLDVSNMVQWRPMLYGVAFLHSTVQERRKYGPLGWNIPYEFNQADFNATIQFVQNHLDDIDIKKGVSWNTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFSPDFHFYKGYSIPKCSNVDQYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSTGGGETREAIVGRLADDMLEKLPPDFVPFEVRERLMSMGPLQPMNIFLRQEIDRMQRVIVLVRNTLNDLKLAIDGTIIMSENLRDALDCMYDARIPARWKKASWASTTLGFWFTELLERNRQFHSWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPAEGVYVYGLYLEGAGWDRRNCKLIDSKPKVLFEMMPVIRMYA-----ENNGVKD--ARLYSSPIYKKPVRTDLNYIAAVDLRTSHPP----EYWILRGVALLCDVK 4525          

HSP 2 Score: 220.705 bits (561), Expect = 1.639e-56
Identity = 101/152 (66.45%), Postives = 123/152 (80.92%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYDI W D+ I++I+NEL +FQ RCRKLP+GLK+W AF DL+KTID+F+   PLL+LMTN AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1325 TVNGYYDISWADIHIDRINNELLDFQARCRKLPRGLKEWQAFMDLKKTIDEFSECCPLLDLMTNKAMMTRHWKRITEVTGHTFEVETDNFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGD 1476          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 3836.19 bits (9947), Expect = 0.000e+0
Identity = 1876/3053 (61.45%), Postives = 2367/3053 (77.53%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPSE---GVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFK  IQ  V KLSNSSE+IE+W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW +IM RAHE   V+QCCVGDETL QLLPHLLEQLE+CQKSL+GYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL++FDN+  V FHEK Y+ IL+  S EGE + + +P+ A+ NVE WL  LL+  +++LH +IR A   I D  F ++EF +M+PAQVGLLGIQ +WTRD+ EAL  +K+D+KIMQ TN++FL LLN LI  TT DL K+ERTK+ETLITIHVHQKDIFD LV+  ++SP DF+W KQ+RFYF++D DRCI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQ +   GFYSL++PG+F +V+DL  VAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C ER F   V ++ + L+  TRK+WQ+ K KM P+P+KFHY+FNLRDLSRIWQG++   S+V  + + L  L+ HECSRV++DR IDE D + F+  +E            +    + YFVDFLRDAPE   E  +D+    PK+YEP+P+F+ L ERLSMF + YNE VRG+ ++LVFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N +EDLK++YR AG E KG  F+FTDN+IKDE++LEY+NN+LASG ++ LF+++E+DEI   +   MKK  P+ P T +NLY YFL RVR NLH+ LCFSP+GEK R RAL FP L SGCT++WFQ+WP++ALV VAQH L ++ L C D VK  +V  +      V   C +YF ++RR   +T KSYL++I  Y+ +Y     +V +L ERM  GL++L EA+ ++  L  EL  KE+ L VA  +A  VL  VT +  AAE VK +V+ VKDK  AIV++I  D++VAE KL AAKPAL+ +E AL TIKP DI+TVRKL KPPHLI RIMDCVL+LFQ+++D    D ER  VK SW E+LKL+ ++ FL+ LL F +D I EE+++LL PY   EDY+LE A+++CGNVAGLC+WT+AM +F+ +N+EV+PLK +L  Q   L  AQD+L  A++ L  K++ L   +  YD A+K KQ L  DA  C+KKMS A  L++GL  EK RWT  S +FE QI  +VGD+++ + F+SY GPFNQ++R  +   W+  + +  +P ++ ++++  L +   IGEWNLQGLPND LS++N IIVT+ASRY L IDPQ QGK WI N+E  + +  T+  +KYF+ HLED L+ G PL++ED+ EELDP L+N+LEKNFIK G   KVKVGDKEVD+ + F LYITTKL+NP +SPEI AKT V+DF+VTMKGLEDQLLG VI IEK+E+E  R +LL++ ++NKRK++ELE +LL RL + +GSLVED++L+ VL   K T+ +VS ++  AA+TE  IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+ +S KS    +R+++I+  +T  ++ +  R LY+  +  FTLLLALK+D++  ++   EL   +KGG++LDL +++ KP +WI+D TWLNLV LS LH F+ L+ Q+  +++ W++WFD+  PE+  +P GYE+ LD F+KLLLIR WCPDRT+  AR+YI  ++G  + E V   + ++  EA+ + PL+  LS+G+DPT  I+  AK   I    ISMGQGQEVH+RR++A++M +G W+LLQNCHL LD+++E ++ +  TE IHD+FRLWVTT++HPKFPI+FLQ SIKFTNEPPQG+KAG+KRTY S  Q+ L+I+NM QWRP+ YAVA+LHT VQERRKFGPLGWNIPYE+N AD  +S+QFVQNHLDD+DIK+G++W  + YMLGE+QYGGRVTDD DKRLLNTF R WF++ MF  KF F+K ++IP    L +Y   I+ LP  D+PE+FGLH NADITYQ+  A   L  ILNIQPKD+S+G GETRES V +M ++ML KLP+DYV  EV   LQ MG  QPM IFLRQE+DRMQ+VI +VR+TL DLKLAIDGTIIM+EDLRDALDSMYDAR+P SW K+SWE+++LGFWFTEL+ERN QF +W F GRP  FW+TGFFN QGFLTAMRQE TR +  KGWALDTV+L NDVT+ M++++  PP     GVY+YGLYL+GAGWD+RN KL ES  KVLF  LPV+ + A+  + E   S+    N+Y CPVYKKPRRTDLT+I S++LR   ++  DHWTLR VALLCD K
Sbjct: 1401 DSLMVLGSLMSNRYNAPFKPTIQQWVQKLSNSSEVIEKWLTVQNLWLYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQRIMQRAHEIPGVVQCCVGDETLQQLLPHLLEQLEVCQKSLSGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNLFDNVNRVVFHEKNYDQILSFQSQEGETVNMSEPINAQGNVEAWLGMLLDGVKKTLHSIIRQAAMVIGDQGFKLVEFQSMFPAQVGLLGIQFIWTRDAEEALQQSKADKKIMQTTNQKFLDLLNELIDMTTHDLTKMERTKYETLITIHVHQKDIFDDLVQMNIRSPLDFEWQKQSRFYFIDDTDRCIIQITDVEFDYCNEYLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQGPWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTE---SKKPAMNLYSCPVYKKPRRTDLTYIFSLFLRS--SQNPDHWTLRGVALLCDCK 4442          

HSP 2 Score: 224.942 bits (572), Expect = 8.871e-58
Identity = 102/151 (67.55%), Postives = 124/151 (82.12%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            SV+GYYDILW D++IEKI+NEL +FQNR RKLP  LK+W AF DL+KTIDDFN   PLL +M N AM  RHW+R++DLT H F+VE+  F+LRN++EAPLLK KE+IED+CISAVKE+DIEAKLK V  EWS H+  F TF+NRGELLL+G
Sbjct: 1239 SVSGYYDILWADLNIEKINNELLDFQNRIRKLPAALKEWQAFNDLKKTIDDFNETCPLLYMMANKAMMARHWERITDLTKHKFEVEAPNFSLRNVMEAPLLKCKEDIEDVCISAVKERDIEAKLKDVVTEWSGHQFTFATFRNRGELLLKG 1389          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 3361.24 bits (8714), Expect = 0.000e+0
Identity = 1624/2678 (60.64%), Postives = 2061/2678 (76.96%), Query Frame = 2
Query: 1553 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPSE---GVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQ +   GFYSL++PG+F +V+DL  VAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C ER F   V ++ + L+  TRK+WQ+ K KM P+P+KFHY+FNLRDLSRIWQG++   S+V  + + L  L+ HECSRV++DR IDE D + F+  +E            +    + YFVDFLRDAPE   E  +D+    PK+YEP+P+F+ L ERLSMF + YNE VRG+ ++LVFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N +EDLK++YR AG E KG  F+FTDN+IKDE++LEY+NN+LASG ++ LF+++E+DEI   +   MKK  P+ P T +NLY YFL RVR NLH+ LCFSP+GEK R RAL FP L SGCT++WFQ+WP++ALV VAQH L ++ L C D VK  +V  +      V   C +YF ++RR   +T KSYL++I  Y+ +Y     +V +L ERM  GL++L EA+ ++  L  EL  KE+ L VA  +A  VL  VT +  AAE VK +V+ VKDK  AIV++I  D++VAE KL AAKPAL+ +E AL TIKP DI+TVRKL KPPHLI RIMDCVL+LFQ+++D    D ER  VK SW E+LKL+ ++ FL+ LL F +D I EE+++LL PY   EDY+LE A+++CGNVAGLC+WT+AM +F+ +N+EV+PLK +L  Q   L  AQD+L  A++ L  K++ L   +  YD A+K KQ L  DA  C+KKMS A  L++GL  EK RWT  S +FE QI  +VGD+++ + F+SY GPFNQ++R  +   W+  + +  +P ++ ++++  L +   IGEWNLQGLPND LS++N IIVT+ASRY L IDPQ QGK WI N+E  + +  T+  +KYF+ HLED L+ G PL++ED+ EELDP L+N+LEKNFIK G   KVKVGDKEVD+ + F LYITTKL+NP +SPEI AKT V+DF+VTMKGLEDQLLG VI IEK+E+E  R +LL++ ++NKRK++ELE +LL RL + +GSLVED++L+ VL   K T+ +VS ++  AA+TE  IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+ +S KS    +R+++I+  +T  ++ +  R LY+  +  FTLLLALK+D++  ++   EL   +KGG++LDL +++ KP +WI+D TWLNLV LS LH F+ L+ Q+  +++ W++WFD+  PE+  +P GYE+ LD F+KLLLIR WCPDRT+  AR+YI  ++G  + E V   + ++  EA+ + PL+  LS+G+DPT  I+  AK   I    ISMGQGQEVH+RR++A++M +G W+LLQNCHL LD+++E ++ +  TE IHD+FRLWVTT++HPKFPI+FLQ SIKFTNEPPQG+KAG+KRTY S  Q+ L+I+NM QWRP+ YAVA+LHT VQERRKFGPLGWNIPYE+N AD  +S+QFVQNHLDD+DIK+G++W  + YMLGE+QYGGRVTDD DKRLLNTF R WF++ MF  KF F+K ++IP    L +Y   I+ LP  D+PE+FGLH NADITYQ+  A   L  ILNIQPKD+S+G GETRES V +M ++ML KLP+DYV  EV   LQ MG  QPM IFLRQE+DRMQ+VI +VR+TL DLKLAIDGTIIM+EDLRDALDSMYDAR+P SW K+SWE+++LGFWFTEL+ERN QF +W F GRP  FW+TGFFN QGFLTAMRQE TR +  KGWALDTV+L NDVT+ M++++  PP     GVY+YGLYL+GAGWD+RN KL ES  KVLF  LPV+ + A+  + E   S+    N+Y CPVYKKPRRTDLT+I S++LR   ++  DHWTLR VALLCD K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQGPWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTE---SKKPAMNLYSCPVYKKPRRTDLTYIFSLFLRS--SQNPDHWTLRGVALLCDCK 2685          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1863.97 bits (4827), Expect = 0.000e+0
Identity = 1093/3077 (35.52%), Postives = 1722/3077 (55.96%), Query Frame = 2
Query:  479 FKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE---KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFV-------VRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDV--FSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIK-WIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI--QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEV--IHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQ-DFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHS-----IPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDAS---AGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNC-FWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD----LTFIASVYLRCPPTKQADHWTLRAVALLCDI 9568
            F+K++      LS   E+IE  +TVQ  W+YLE +F+  DI KQL +E   F  +  SW  IM R  ++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++            +S +GE ++   PV  E  VE WL  +    + +L   +R  + ++        +++  +P Q+ +   Q+ WT D T AL+ +K  +D+  ++   ++ + +LN   +    +L K+ R K   L+T+ VH +D+  +L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +DF+ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++RA P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+ A+  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+GKT     L   L+     GEP     RE  +NPKA++  +++G  ++STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E  ++ +LF        RY  + L +K    +  V       V   C L + L   ++     DS    R+  E  +IFS++WS+ A ++ E R K++ ++R    I+   P     ++DT+++Y V ++N  W  +  K+ +      + P Y  I+VP VD VR  +L+  + S +  VLL G  GT KT +    L S +       ++N SS T     Q  IES V+KR+   Y P  G+KM VF+DD+NMP ++ +G Q   E++R  I+  GF+   +      + DL  + +M  PGGGR  I  RL+  F + N T PT + I RIY   G     K + F   V  +   L   T +L+ +  ++  PTP+K HY+FNLRD+S+++QGL+    D   + + + RLW+HEC RV SDRL+D +D++ F   +   L     V F    P  +   F DFLR++                +IYE +  F+ LK  +    + YN T    P++LV F DA+ HV ++ RVI   +GN+LLVG+GGSG+QS+TRLA++I  +  FQ+ +T+ Y    F ED+K +YR  G ENK TVF+F D +I DES+LE INN+L+SG +  L+  +E+DEI S +    +K      +T + ++ Y ++RVR+NLH+VLC SP+G+ FR R   +PAL +  TI+WF +WP++AL+ VA+  L    L  +D ++ K+  +   +HQ V  FS+ +K   + +R   +T  +YL  +  YK +    +  +     +++NGL K+ + +  +  +S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K  A   K +   + A+  L  A PAL+EA  AL ++   D++ ++   +PP L++ +M  V+IL              +G + +W E+ + L   NF+  L+ F +D I++ ++  +  Y T+ D+  E   +       LC W +AME +  + R V P +  L      LA+ Q  L  A+  L E  E L  +K +YD  + +K+ L   +     K+  A +L++GL  E+ RW       E  +  LVGD ++ +AF+SY GPF    R ++ +  W   +R   VP +        LS P  + EWN+QGLP+D  S EN +IVT+ +R+ L +DPQ Q   WI N E +  +   +     F + LE+A+  G P++++++ EELDP+L  +L K+  ++G    +K+GDKE++   +F  Y+TTKLSNPH++PEI +KT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   ++ KRK++ELED +L  L    GSL++D  L+  L  +K T+ +V+ Q+  +  TE +I+ ARE YR  ++R S+L+F++ DL  ++PMYQ  L  ++NLF+ SI  S +S  ++ RI ++    T  ++ +  R L++  +  F+  +  K+   +  +  +E N  L+GG  LD K     P   W+ D  W N+  L KL  F  L+       + W  W+    PE   +P  +E   +E +K+L++R    DR  +    ++   LG  F+E     + ++  ++  +TPL+ +LS G DPT  +   A+   +  +   +S+GQGQ   + R+I + +  G WV L NCHLSL +M EL   + E +V   H DFRLW+++  HP+FPI+ LQ  IK T EPP+G+K  +KR Y   ++  FL  S  + +R +++++ + H+ + ERRKF  LGWNI Y +N +D   S   +  +LD+ +    + W  + +++  I YGG VTDD+D+RLL T+  ++F   + +    FFK  S     +P     + Y+D I++LP  + PE+FG + NADI  Q   A+++   +L++QP+  S      G +RE  V  +  D+L K+P++ + +E   +L +   L P+N+ L QE+ R   ++  +R +L++L+  I G ++M+  L +  + ++DAR+P  W K       L  W  +L +R  QF+ W    RP   FW++GF    GFLTA+ Q   R     ++DT+     VT    + +  PP +GV + GL+LEGAGWD++ S L+E++   L  P+P I  + ++  K       L KNMY CP Y  P R+      +F+ +V L+       DHW  R  ALL  +
Sbjct: 1380 FEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSF-EGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQKVETDLLWQLFE-------RYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRM-VELWFIFSLIWSVCASVDEEGRKKIDTFLR---EIEGSFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFY-KIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDY-GFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIY---GTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES----------------QIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARK--DNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKV--ELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYE---EIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTP--FFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAE-IDYEGTRKL-LKDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSAR-QNNVSVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKR------LAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVP-YDHWIKRGTALLMSL 4384          

HSP 2 Score: 63.929 bits (154), Expect = 4.322e-9
Identity = 38/123 (30.89%), Postives = 56/123 (45.53%), Query Frame = 3
Query:   93 KLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            KL +  KD  W   +  +  I+ F  ++PL+  + N A++ RHW ++       FD  S  F L  I+   L    E I DI  +A KE  IE  L+ +   W    L     K++G   LRG
Sbjct: 1231 KLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRG 1353          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1863.97 bits (4827), Expect = 0.000e+0
Identity = 1093/3077 (35.52%), Postives = 1722/3077 (55.96%), Query Frame = 2
Query:  479 FKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE---KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFV-------VRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDV--FSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIK-WIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI--QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEV--IHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQ-DFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHS-----IPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDAS---AGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNC-FWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD----LTFIASVYLRCPPTKQADHWTLRAVALLCDI 9568
            F+K++      LS   E+IE  +TVQ  W+YLE +F+  DI KQL +E   F  +  SW  IM R  ++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++            +S +GE ++   PV  E  VE WL  +    + +L   +R  + ++        +++  +P Q+ +   Q+ WT D T AL+ +K  +D+  ++   ++ + +LN   +    +L K+ R K   L+T+ VH +D+  +L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +DF+ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++RA P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+ A+  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+GKT     L   L+     GEP     RE  +NPKA++  +++G  ++STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E  ++ +LF        RY  + L +K    +  V       V   C L + L   ++     DS    R+  E  +IFS++WS+ A ++ E R K++ ++R    I+   P     ++DT+++Y V ++N  W  +  K+ +      + P Y  I+VP VD VR  +L+  + S +  VLL G  GT KT +    L S +       ++N SS T     Q  IES V+KR+   Y P  G+KM VF+DD+NMP ++ +G Q   E++R  I+  GF+   +      + DL  + +M  PGGGR  I  RL+  F + N T PT + I RIY   G     K + F   V  +   L   T +L+ +  ++  PTP+K HY+FNLRD+S+++QGL+    D   + + + RLW+HEC RV SDRL+D +D++ F   +   L     V F    P  +   F DFLR++                +IYE +  F+ LK  +    + YN T    P++LV F DA+ HV ++ RVI   +GN+LLVG+GGSG+QS+TRLA++I  +  FQ+ +T+ Y    F ED+K +YR  G ENK TVF+F D +I DES+LE INN+L+SG +  L+  +E+DEI S +    +K      +T + ++ Y ++RVR+NLH+VLC SP+G+ FR R   +PAL +  TI+WF +WP++AL+ VA+  L    L  +D ++ K+  +   +HQ V  FS+ +K   + +R   +T  +YL  +  YK +    +  +     +++NGL K+ + +  +  +S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K  A   K +   + A+  L  A PAL+EA  AL ++   D++ ++   +PP L++ +M  V+IL              +G + +W E+ + L   NF+  L+ F +D I++ ++  +  Y T+ D+  E   +       LC W +AME +  + R V P +  L      LA+ Q  L  A+  L E  E L  +K +YD  + +K+ L   +     K+  A +L++GL  E+ RW       E  +  LVGD ++ +AF+SY GPF    R ++ +  W   +R   VP +        LS P  + EWN+QGLP+D  S EN +IVT+ +R+ L +DPQ Q   WI N E +  +   +     F + LE+A+  G P++++++ EELDP+L  +L K+  ++G    +K+GDKE++   +F  Y+TTKLSNPH++PEI +KT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   ++ KRK++ELED +L  L    GSL++D  L+  L  +K T+ +V+ Q+  +  TE +I+ ARE YR  ++R S+L+F++ DL  ++PMYQ  L  ++NLF+ SI  S +S  ++ RI ++    T  ++ +  R L++  +  F+  +  K+   +  +  +E N  L+GG  LD K     P   W+ D  W N+  L KL  F  L+       + W  W+    PE   +P  +E   +E +K+L++R    DR  +    ++   LG  F+E     + ++  ++  +TPL+ +LS G DPT  +   A+   +  +   +S+GQGQ   + R+I + +  G WV L NCHLSL +M EL   + E +V   H DFRLW+++  HP+FPI+ LQ  IK T EPP+G+K  +KR Y   ++  FL  S  + +R +++++ + H+ + ERRKF  LGWNI Y +N +D   S   +  +LD+ +    + W  + +++  I YGG VTDD+D+RLL T+  ++F   + +    FFK  S     +P     + Y+D I++LP  + PE+FG + NADI  Q   A+++   +L++QP+  S      G +RE  V  +  D+L K+P++ + +E   +L +   L P+N+ L QE+ R   ++  +R +L++L+  I G ++M+  L +  + ++DAR+P  W K       L  W  +L +R  QF+ W    RP   FW++GF    GFLTA+ Q   R     ++DT+     VT    + +  PP +GV + GL+LEGAGWD++ S L+E++   L  P+P I  + ++  K       L KNMY CP Y  P R+      +F+ +V L+       DHW  R  ALL  +
Sbjct: 1500 FEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSF-EGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQKVETDLLWQLFE-------RYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRM-VELWFIFSLIWSVCASVDEEGRKKIDTFLR---EIEGSFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFY-KIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDY-GFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIY---GTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES----------------QIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARK--DNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKV--ELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYE---EIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTP--FFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAE-IDYEGTRKL-LKDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSAR-QNNVSVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKR------LAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVP-YDHWIKRGTALLMSL 4504          

HSP 2 Score: 63.929 bits (154), Expect = 4.514e-9
Identity = 38/123 (30.89%), Postives = 56/123 (45.53%), Query Frame = 3
Query:   93 KLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            KL +  KD  W   +  +  I+ F  ++PL+  + N A++ RHW ++       FD  S  F L  I+   L    E I DI  +A KE  IE  L+ +   W    L     K++G   LRG
Sbjct: 1351 KLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRG 1473          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021690.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4063.84 bits (10538), Expect = 0.000e+0
Identity = 1982/3049 (65.00%), Postives = 2446/3049 (80.22%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++N+ S+VI  +  L++LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   E  +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   +QD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S     ++D     Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1581 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGEEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGGVSQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTS-----TKD--NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4617          

HSP 2 Score: 228.794 bits (582), Expect = 9.498e-59
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1420 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1570          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021565.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4047.66 bits (10496), Expect = 0.000e+0
Identity = 1981/3051 (64.93%), Postives = 2444/3051 (80.10%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPET--VEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++N+ S+VI  +     LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   ++   +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S     ++D     Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1203 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTT----LWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTS-----TKD--NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4236          

HSP 2 Score: 228.794 bits (582), Expect = 9.637e-59
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1042 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1192          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000035049.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4040.73 bits (10478), Expect = 0.000e+0
Identity = 1978/3052 (64.81%), Postives = 2444/3052 (80.08%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPET--VEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQS-IEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++N+ S+VI  +  L++LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   ++   +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT Q+ +E       L GD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S     ++D     Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1174 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQNKLEKYRYFLCLSGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTS-----TKD--NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4212          

HSP 2 Score: 228.794 bits (582), Expect = 9.223e-59
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1013 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1163          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021598.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4038.03 bits (10471), Expect = 0.000e+0
Identity = 1979/3051 (64.86%), Postives = 2440/3051 (79.97%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPET--VEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++    D+ S       LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   ++   +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S     ++D     Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1088 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMVPQPFDLFS-------LWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTS-----TKD--NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4118          

HSP 2 Score: 228.409 bits (581), Expect = 1.228e-58
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct:  927 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1077          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 3889.73 bits (10086), Expect = 0.000e+0
Identity = 1908/3053 (62.50%), Postives = 2392/3053 (78.35%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPSE---GVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  ++ +  S+ YN PFK  IQ  V KLSN++EIIE W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  N++QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLS+FDN+  V FHEK Y+ IL   S EGE + L +PV A+ NVE+WL  LLN  +++LH +IR A+ +I+D+ F + +F  MYPAQ+GLLGIQ++WTRD+ EAL  AK+DRK+MQ TN++FL LLN LI  TT DL ++ERTK+ETLITIHVHQKDIFD LV+  +KS SDF+W KQ+RFYF+ED+D+CI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLK+ FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I HPPW+LKLIQL+ETQRVRHGMMTLGPSGAGKT CI++LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+LK WL    + +  I+   F  +       + + +  KM+ LE   ++QA DLL+        K + Q S+ H  RL+IF+VMWSIGALLE++DR K+E +++ +++  L+LP +  D   T+F++++ ENG+W HW+ KV EY+YPKDS PEY SILVPNVDNVRTDFLM+T+  Q KAVLLIGEQGTAKTVMI  Y S  +PEYH  KSLNFSSAT+P MFQR+IES++DKRMG+TYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQ +E KGFY+L+KPG+F SV+D+ FVAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C++R F + V  + S L+  TRK+WQ+TK KM PTP+KFHY+FNLRDLSRIWQG++   S+V  S+  L+ L+ HECSRV+SDR ID+ D  WFE  I     +    E  +   + +YFVDFLRDAPE   +  +D+    PK+YEP+PSFE L +RL ++ + YNE VRGS ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLAS+IA Y  FQIT+TR Y  NN ++DLK +YR AG++  G  F+FTDNEIKDES+LEY+NN+LASG ++ LF+++E+DEI   +   MKK  P+   T ENLY YFL RVR NLH+VLCFSP+GEKFR RAL FP L SGCT++WFQ+WP++ALV VAQH L  + + C + VK+ +V+ +      V   C++YF +YRR   +T KSYLS+I  YKT+Y      V  L+ RM+ GL KL EA+ ++  LSKEL +KE++L+VAS +A+ VL  VT +  AAE VK +V+ VKDK  AIV++I +D+  AEEKL  A+PALQEAE AL TIKP DI+TVRKL +PPHLI RIMDC L+LFQ+KIDP   D ER  VK SW E+LKL+ ++ FLNSLLTFP+D I EEI++LLQPY   EDY+LE+A+K CGNVAGLC+WT+AM  F+ +N+EV+PLK +LA Q   LA AQ +L +A+  L  K+  L  V+  YD A++ KQAL  DA  CR+KM  A  L+ GL  EK RWT  S  F++QI  LVGD+++ + F+SY GPFNQ++R  +   W+  + +  +P ++ ++++  L +   IGEWNLQGLPND LS++N IIVT+ASR+ L IDPQ QGK WI N+E  + +  T+  +KYF+ HLED L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LYITTKL+NP ++PEI AKT+VIDF+VTMKGLEDQLLG VI  EK+ELE  R +L+++ + NKRK++ELED+LL RL +T+GSLV+D++L+ VL   K T+ +VS ++  AA+TE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+  S KS    +RI +II  +T  ++ +  R LY+  +  FTLL+ALK+D++   +   E   L+KGG+ LDL +++PKP KWI+DMTWLNLV LS L  F+ L+ Q+  +EK W+AWFD +APE+  +P GY+ +LD F++LLLIR WCPDRT+  AR YI  +LG  + E     + ++  E+D +TPL+  LS+G+DPT  IE  +K  +     ISMGQGQEVH+RR++ ++MQ+G W+LLQNCHL LD+M+EL+D +  TE +HD FR W+TTE+HPKFPI+ LQ S+KFTNEPPQG+KAG+KRTY+  +Q+ LD++N+ QW+P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QFVQNHLD+MD K+G++W  + YMLGE+QYGGRVTDD DK LLNTF R WF ++MF+ KF F+K + IP    ++EY+  I++LP  D+PE+FGLH NADITYQ+  A   L  I+NIQPKD+  G GETRESVV R+ ++ML KLP DY+  EV  RLQ MG +QPMNIFLRQE+DRMQ+VIA+VR+TLIDLKLAIDGTIIM+EDLRDALD+MYDARIP  W K+SWESSTLGFWFTEL+ERN QF +WLF GRPN FWMTGFFN QGFLTAMRQE TR +  KGWALD+V+L NDVT+ M++++N PP     GVY+YGL+L+GAGWDRRN KL+ES  KVLF  LPV+ + A+      ++ +     ++ CPVYKKPRRTDLT+I S++LR    +  DHWTLR +ALLCD K
Sbjct: 1045 DSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAWLQTLPAFQHEILWNCFNMA-------NYRAVSPKMQILECMYIKQAIDLLQ------KSKQNKQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQ-DHSAPLELPTVSGDQ--TIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIAV---EDHGQEIMNNALKESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTRTYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNPADLKKQ-QGYLHACPVYKKPRRTDLTYIFSLFLRS--IEVPDHWTLRGIALLCDSK 4075          

HSP 2 Score: 220.705 bits (561), Expect = 2.905e-56
Identity = 103/151 (68.21%), Postives = 125/151 (82.78%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            ++NGYY+ILW D+DIEKI+ EL +FQNR RKLPK LK+W AF DL+K IDDF+   PLLE+M N AM  RHW+R+S LT H FDVES+ F+L+NI+EA LLK+KE+IEDICISAVKEKDIEAKLK+V +EWSAH   F  FK+RGELLL+G
Sbjct:  883 NINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKG 1033          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 3989.5 bits (10345), Expect = 0.000e+0
Identity = 1958/3041 (64.39%), Postives = 2421/3041 (79.61%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNE---RTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQA-DHWTLRAVALLCDIK 9571
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG G+YC +R F   V + + KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG++N  S+VI  + +LLRLW HEC RV++DR    SD+ WF++ +   L + E  E + P  +     YFVDFLRDAPE   E  +++   +PK+YEP+ S   L+ERLS+F + YNE++RG+ +++VFFIDAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIK+ES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK  P+ P T +NLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C  YF ++RRS  +T KSYLS+I  YK +Y+     V  L  RM  GL+KLKEA E++  LSKEL  KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D ++     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VT+KGLEDQLLG VI  EK+ELE  R  LL+  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  + +TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+DMTWLNLV LSKL  FS +++QI  +EK WR WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+++ E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G WVLLQNCHL LD+++ELMD + ETE +HD FRLW+TTE+H +FPI+ LQMSIKF NEPPQG++AG++RTY   +QD LD+S   QW+PM+YAVA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD+S GG ETRE+VV R+ DDML KLP DY  FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLA+DGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTEL+ERN QF++W+  GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E   +RD    +Y CP+YKKP RTDL +IA+V L+   T QA +HW LR VALLCD+K
Sbjct: 1595 NRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAV-VSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARD--PRLYCCPIYKKPVRTDLNYIAAVDLK---TAQAPEHWVLRGVALLCDVK 4621          

HSP 2 Score: 213.386 bits (542), Expect = 2.990e-54
Identity = 102/152 (67.11%), Postives = 117/152 (76.97%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD
Sbjct: 1422 TVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGD 1573          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 3870.86 bits (10037), Expect = 0.000e+0
Identity = 1918/3049 (62.91%), Postives = 2375/3049 (77.89%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 2.246e-56
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 3870.86 bits (10037), Expect = 0.000e+0
Identity = 1918/3049 (62.91%), Postives = 2375/3049 (77.89%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 2.246e-56
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 3870.86 bits (10037), Expect = 0.000e+0
Identity = 1918/3049 (62.91%), Postives = 2375/3049 (77.89%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 2.246e-56
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah1 (dynein, axonemal, heavy chain 1 [Source:MGI Symbol;Acc:MGI:107721])

HSP 1 Score: 1856.26 bits (4807), Expect = 0.000e+0
Identity = 1107/3112 (35.57%), Postives = 1735/3112 (55.75%), Query Frame = 2
Query:  467 YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC-GEPH---------REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIY-RYSIQYLIYKMETLEAFVVRQACDLLEGLI-----------PRKDEKD--SSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENG-----------------EWVHWNSKVEEYIYPKDSTPE--YGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVI---GLGHYCKERHFRSSVI------NMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKH--PQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFP-LVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTS--WVESLKLLASTN-FLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTI--DPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAK--KHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEEL--MDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFL-DISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKD---HSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLL-KNMYQCPVYKKPRRTDLTFIAS------VYLRCPPTKQADHWTLRAVALLCDI 9568
            Y  PF++ I    +KL  + E++E+W+  Q  W+YLE +F   DI +QLP E+KR+  +++ W KIM  A+EN  V+  C  D+ L   L    + L++ QK L+ YLE KR  FPRF+F+SD  LLEIL Q  DP  +Q HL   F+NI  + F E     I   YS EGE ++L   +   SNVE WL+ +    + S+H +I  A  +   T       LN +P QV + G Q  WT +  EAL       K+  Q ++Q   L+ L+  +      +++R     LI I VH KD+  +L+ + V S  DF+W+ Q R+Y+ +D     +   + +FIY  E+LG + RLVITPLTDRCY+TL  AL +  GGAPAGPAGTGKTET KD+G+ L    VVFNCSDQ+DF  +G+ FKGL+ +G+W CFDEFNRID+ VLSV AQQI  +   +++R ++F+F +G  + + P   +F+TMNPGYAGR ELP+NLK  FR VAMMVPD  +I  + L S GF +  VLA+K  T +KL  EQL+ Q HYDFG+R + +V+   G  KR NPT  E+   +R +RD+N+ K + +D  LF  +++DLFP I+ ++  Y  L+ AI R  ++  +     +++K IQL+ET  VRHG+M +GP+G+GK+NC  VL  A+T   G+P              +NPK+IT  Q++G  D+ T++WTDGIFS+L R           W + DGPVDA+WIEN+N+VLDDNK L L++G+ I ++ +  ++FEV ++  ASPATVSR GMVY+  S L   P ++ WL KR     P +++ +   F  ++ +Y    + +   T++  +     +L   L+           PR+  K   S ++S I    E  +IFS++WS+GA  +   R     ++R    ++L+  K+    +  ++DY + + G                  WV W     +Y  P    P+  Y +I+VP +D V+  +L+  + +  K VL IG  GT KT+ ++  L    P  ++   L FS+ T     Q  I+S +DKR    +GPP GR    FIDD+NMP +  +G Q   E++RQ ++  G+Y     G F +++D++FV AM  PGGGRN I  RL RHF   +       S  RI+S+I    +     E+ +R  V       ++   L+  T  ++    +++ PTP+K HY FNLRDLS+++QG++  +   +    +LLRLW HE  RV  DRL++E D  WF+  +E  +++  V   +  P +   + DF+         G+D       K YE + S   + + +  + + YN+ +  + + LV F+DAM H+ +ISR +R   GN LL+GVGGSG+ S+TRLAS +A+Y CFQI +++ Y ++ + ED+K +   AG +N    F+F+D +IK+ES+LE INN+L SG I  ++S +E D+I++     M+ +  +     T+ NL   +  RVR N+H+VLC SPIGE FR R   FP+L + CTI+WF +WP EAL +VA   L + P L C + V + ++ +   IHQ V S C++Y  +  R   +T KSYL  ++++  +    K  +     RM++GL KL    E +  + +ELEI    L  A+ +    +  +   T  AE  +  V+  + K      K +     A++ L  A PAL  A  +L  +  ND++ VR +Q+PP  ++ +++ V I+  K I P     E+ G K    W     LL     FL SL  F +D I E +I  +QPY   E++   A  K       +C W +AM K+++V + V P +  L      L   Q  L+ A+  L E E+ +A ++ +Y   + +K+ LE     C +++  A++L+NGL DEK RW       E+ +  + GD++V + FV+Y GPF  Q+R  ++ +W + +  + VP      ++  L NP +I  W + GLPND LSVEN +I   + R++ FIDPQ Q   WI N E E  +     +++ F + +E+A+  G P ++E++ EELDPAL  VL K   K    + +K+GD  +  H+ F +YITTKL NPH+SPEI  K ++I+F+++  GLEDQLLG V+  E+ +LE ++NQL+   +  ++++K++ED +L RL+++EG+ V+D  L+ VL  +K  + ++  ++  A  TE++I+  R EY  ++ R  +L+F ++DL+ V+PMYQ  L+ FLN+F++ I  SE++  +++RI +I   +T ++++ + RSL++  +  F  LL +++ M    + Q E   LL GGS   ++T+  +P P +W+ D  W +++ALS L  F+      V    +++A FD   P  E +P  + A LDEF+KLL++RC   D+     + ++   L   FIE     + ++ +E+++ TPL+ +LS G DP   +   A+  K   +   IS+GQGQ   +  ++  +++ G WV  QNCHL+  +M  L  + + I  + +H DFRLW+T+    KFP+S LQ   K T EPP+G+KA + ++Y S + DFL     +++++ ++ ++   H    ERRKFGPLG+NIPYE+   DL   +  ++  LD+ +    + +K + Y  GEI YGGRVTDD+D+R +      ++N  + + +  +      H IP    LN Y+  I  LP  D PE+FGLH NA+IT+      ++ + IL +QPK +S+ GG++RE +V  + +++L ++P      EV ++  ++   + MN  L QEV R  K++  +  TL D+  AI G ++M+ +L     S+Y+  +P    SK       L  W  +L+ R     +W+  G P  FW++GFF  Q FLT   Q   R     ++DT+     V      EI + P  G Y++GL+LEGA WD  N +L ES+ K L+  + VI +         E +R +  ++ Y CP+YK   R              + +  P  +   HW  R VAL+C +
Sbjct: 1197 YKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVC-SDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDL--EITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIEMAIKAY-PTMLRTEWVLN-WPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLSKQLSDLVALVRGKL----SRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTKD--DLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMF-EGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWL-KR----LPAIIKPYEEQFKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLK--MRLEQVKLGFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVSWVKWM----DYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQMEEFGVAFNKVCPFQPILYGDFM-------SPGSD------VKSYELITSESKMMQVIEEYMEDYNQ-INTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIIN----TMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIM--KGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGGS---IQTMFENPAP-QWLSDRAWRDILALSNLPTFATFSNDFVMYLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYE---DIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPK-SSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVL-YEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFV-ISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLP-------EANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALICAL 4248          

HSP 2 Score: 55.4546 bits (132), Expect = 2.022e-6
Identity = 38/143 (26.57%), Postives = 67/143 (46.85%), Query Frame = 3
Query:   39 VDIEKISNELTEFQNRCRKLPKGLKDWPAFE----DLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            +D E++   + E      K  K  KD PA +    D+R  I++F   +PL++ + NP M+ RHW+ +S+  + +   +++       LE  L    E I  +   A KE  IE  L  ++ EWS+   +   +K     +L+ 
Sbjct: 1033 IDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKAN-LTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKETDTYILKS 1174          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q8TE73|DYH5_HUMAN (Dynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3)

HSP 1 Score: 4014.15 bits (10409), Expect = 0.000e+0
Identity = 1971/3043 (64.77%), Postives = 2418/3043 (79.46%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI------EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG+GHYC +R F   V + V+KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSR+WQG++NT S+VI     LL+LW HEC RV++DR    SD+ WF++ +      EF  +   +V+        TYFVDFLRDAPE   E ++++    PKIYEP+ SF  LKERL+MF + YNE++RG+ +++VFF DAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA YV FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK FP+   T ENL+ YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C+ YF ++RRS  +T KSYLS+I  YK +Y      V  L  RM  GL+KLKEA E++  LSKELE KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKD+  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TI+P+DI+TVR L +PPHLI RIMDCVL+LFQ+K+     D E+     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L +K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P  K +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+ + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLE+NFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+D+TWLNLV LSKL  FS +++QI  +EK W+ WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL LD+M+ELMD +IETE++HD FRLW+TTE H +FPI+ LQMSIKF N+PPQG++AG+KRTY+  +QD LD+S+  QW+PM+YAVA+LH+ VQERRKFG LGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW TI YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD S GG ETRE+VV R+ DDML KLP DYV FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLAIDGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTELIERNSQF++W+F GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E    RD     Y CP+YKKP RTDL +IA+V LR   T   +HW LR VALLCD+K
Sbjct: 1598 NRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDC----GIDTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRD--PRFYSCPIYKKPVRTDLNYIAAVDLRTAQT--PEHWVLRGVALLCDVK 4624          

HSP 2 Score: 218.009 bits (554), Expect = 9.554e-55
Identity = 102/152 (67.11%), Postives = 119/152 (78.29%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD
Sbjct: 1425 TVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGD 1576          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q8VHE6|DYH5_MOUSE (Dynein heavy chain 5, axonemal OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2)

HSP 1 Score: 3989.5 bits (10345), Expect = 0.000e+0
Identity = 1958/3041 (64.39%), Postives = 2421/3041 (79.61%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNE---RTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQA-DHWTLRAVALLCDIK 9571
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG G+YC +R F   V + + KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG++N  S+VI  + +LLRLW HEC RV++DR    SD+ WF++ +   L + E  E + P  +     YFVDFLRDAPE   E  +++   +PK+YEP+ S   L+ERLS+F + YNE++RG+ +++VFFIDAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIK+ES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK  P+ P T +NLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C  YF ++RRS  +T KSYLS+I  YK +Y+     V  L  RM  GL+KLKEA E++  LSKEL  KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D ++     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VT+KGLEDQLLG VI  EK+ELE  R  LL+  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  + +TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+DMTWLNLV LSKL  FS +++QI  +EK WR WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+++ E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G WVLLQNCHL LD+++ELMD + ETE +HD FRLW+TTE+H +FPI+ LQMSIKF NEPPQG++AG++RTY   +QD LD+S   QW+PM+YAVA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD+S GG ETRE+VV R+ DDML KLP DY  FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLA+DGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTEL+ERN QF++W+  GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E   +RD    +Y CP+YKKP RTDL +IA+V L+   T QA +HW LR VALLCD+K
Sbjct: 1595 NRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAV-VSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARD--PRLYCCPIYKKPVRTDLNYIAAVDLK---TAQAPEHWVLRGVALLCDVK 4621          

HSP 2 Score: 213.386 bits (542), Expect = 2.091e-53
Identity = 102/152 (67.11%), Postives = 117/152 (76.97%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD
Sbjct: 1422 TVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGD 1573          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q91XQ0|DYH8_MOUSE (Dynein heavy chain 8, axonemal OS=Mus musculus OX=10090 GN=Dnah8 PE=1 SV=2)

HSP 1 Score: 3870.86 bits (10037), Expect = 0.000e+0
Identity = 1918/3049 (62.91%), Postives = 2375/3049 (77.89%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 1.571e-55
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q96JB1|DYH8_HUMAN (Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2)

HSP 1 Score: 3868.16 bits (10030), Expect = 0.000e+0
Identity = 1910/3049 (62.64%), Postives = 2369/3049 (77.70%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL L++MEEL++ +I TE   D FR+W+TTE H +FPI+ LQ S+KFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA ++L+ I NIQPK++  G GETRE++VYR+ +DML KLP DY+  EV  RL  MG L  MNIFLRQE+DRMQ+VI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP EGVY+YGLY++GA WDRRN KL+ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1453 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4490          

HSP 2 Score: 224.557 bits (571), Expect = 1.075e-56
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1291 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1441          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt
Match: sp|M0R8U1|DYH5_RAT (Dynein heavy chain 5, axonemal (Fragment) OS=Rattus norvegicus OX=10116 GN=Dnah5 PE=1 SV=1)

HSP 1 Score: 2545.38 bits (6596), Expect = 0.000e+0
Identity = 1258/1880 (66.91%), Postives = 1528/1880 (81.28%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNE---RTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQ 6091
            + YN+PFK  IQ+ V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I ++ F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+ TDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT+CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  +  +   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D  DTMFDY V+ +G W HW+  + EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE H  K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG G+YC +R F   V + V KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG++N  S+VI  + +LLRLW HEC RV++DR    SD+ WF++ +   L + E  E + P  +     YFVDFLRDAPE   E  +++   +PK+YEP+ S   L+ERLS+F + YNE++RG+ +++VFF DAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIK+ES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK  PK P T +NLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C  YF ++RRS  +T KSYLS+I  YK +Y+     V  L  RM  GL+KLKEA E++  LS+EL +KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LF ++++    D ++     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q    A A  DLQ A+  L +K+  L +V+ EY+ A+  KQ
Sbjct: 1595 NRYNMPFKAQIQNWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQESGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALQNAKFDKKIMQKTNQSFLELLNMLIEMTTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFTYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASHTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTSCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEILEAFVITQSTHMLQGLIPTKEQ--AGDVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDPGDTMFDYYVAPDGTWRHWSMCIPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHTVKNLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGEGYYCAQRGFSKEVQDAVIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAV-VSLVEEEFGEEKTPVVDCGVDAYFVDFLRDAPEATGETPEETDAEMPKLYEPIASLNHLQERLSVFLQLYNESIRGTGMDMVFFRDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTSIMKKEHPKRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYNIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHVEVQSLANRMNTGLEKLKEASESVAALSQELAVKEKELQVANEKADMVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFHRRVNAVKIDLDKSCTVPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHALAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQ 3470          

HSP 2 Score: 210.69 bits (535), Expect = 1.499e-52
Identity = 99/152 (65.13%), Postives = 117/152 (76.97%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN Y D LW +V+IEKI++EL EFQNRCRKLP+ LKDW AF D++KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+E PLLK+KEEIEDICISAVKE+DIE KLK V  EW    L F +FK RGELLLRGD
Sbjct: 1422 TVNSYQDTLWSEVNIEKINSELLEFQNRCRKLPRALKDWQAFLDMKKTIDDFSECCPLLEYMASNAMVERHWQRITTLTGHSLDVGNETFKLRNIMEVPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTLTFSSFKTRGELLLRGD 1573          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18341641 (tr|A0A267GD23|A0A267GD23_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010548g3 PE=4 SV=1)

HSP 1 Score: 4281.09 bits (11102), Expect = 0.000e+0
Identity = 2096/3041 (68.92%), Postives = 2502/3041 (82.28%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDS---EVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRC--PPTKQADHWTLRAVALLCDI 9568
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETLSQLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLS+FDNIKTVKFHEKQYETILACYS EGE LELEKPVKAE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDST+AL NAKSD+K+M  TN+ FL LLNLLI QTT +L KVERTKFETLITIHVHQ+DIF+ L K  +KSP+DF+WLKQTRFYF+ED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VLSCKKERKKQF+FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GF+DNI LARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP D+EQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYP+LEAAI +Q+ EA +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKALTDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF ++FP+I RY+IQ+L +K++ LEAF+VRQ CDLLEGLIP+++EK+ + +    Y RLY+F++MWS+GALLE EDR KLE  +R    +KLDLP+   DS++TMFD++V E+GEW HW+ KVEE++YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQ +E  GFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+  SID+I+SVIG GHYC+ER F   V  MV+KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG+INT S+V+  S  LL LW HEC RV+SDR     D+ WF + +   L +    +  +  +P +   YFVDFLRDAPE   +  DD++F +P IYEP+P+FE L +RL  F   YNE++RG+ ++LVFF DAM H+VKISR+I   +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+LASG+++ LF ++EMDEI   +   MKK FP+ P T ENL +YFL R R NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ+WP++ALV VA H L  F +VC + VK +++  + V+H  V  +C+ YFN+YRRS  +T KSYLS++  YK +Y         L  RM +GL+KL EAQ+++ +LS+EL +KE+ L++A+ EAE VL  V  Q  AA+ VKNKV+ VKD+  AIV+ I  D+ +AE KL AA+PAL+ AE+ALNTIKP DI+TVRKL KPPHLI RIMDCVL+LFQ+ +D    D ER   K SW ESLKL+++T FLN L+TF +D + EE I+ L PY   EDY+ E A++ CGNVAGL +WTKAM+ F+W+N+EV+PLKD+LA Q + L KA +DL +A++ L EKE  LA  +  YD A+++KQALE DAA CR+KM+ A QL+ GL DEK RWT QS E+++QIG LVGD+++ +AF+SY GPFNQ FRL +  +W+  ++   +P + T++++E L     I EWNLQGLPND+LS EN IIVTQASR+ L IDPQ QGK W+ N+ET + +  T+  +KYF+QHLEDAL+ G PL+IEDI EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F+L++TTKL NP ++PEI+A+TS+IDF+VTMKGLEDQLLG VI  EK ELE  R QL++  +NN + +K LED+LL RL +T+GSLV+D+ L+ VL + K TS DV  +I  A +T+ +I  AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  +W +  R LY+ D+ TFTLLLALK+DM +  V+ EE   L+KGG++LDL  + PKP KWI+D TWLNLV LS LH FSG+++QI   EK W+ WFDK+APE+E IP GY   LD F++LLLIR WCPDRTL  A++YI  +LGD F E V   I ++  E++ +TP++GLLS+G+DPTP IE  AKKH  +   ISMGQGQEVH+RR++A ++Q G WVLLQNCHLSLDYM E+MDQ+IE E +++DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRTYTSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMDIKKG++W T+ YMLGEIQYGGRVTDD+DK LLNTFC+ WF+D MF P F FFK +SIP   KL EY++ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP+DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI  VRTTL DLKLAI+GTIIMNE+LRDALDSMYDA+IP  W K+SW+SS LGFWFTELI RN QFSTW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E++ K+L EPLPV+ I AI+      +S+D  + +Y CP+YKKPRRTDLT++A++ LR   PP    DHW +R VALLCD+
Sbjct:  968 NRYNAPFKKQIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLSQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSIFDNIKTVKFHEKQYETILACYSSEGEQLELEKPVKAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTDALKNAKSDKKVMASTNQSFLDLLNLLINQTTHELTKVERTKFETLITIHVHQRDIFEDLCKMHIKSPTDFEWLKQTRFYFIEDTDKCMISITDVDFEYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLSCKKERKKQFIFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFLDNITLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGTVKRSNPNDSEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPQLEAAIAKQVQEAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTRCIHTLMKALTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPTFERDQLFPLFESTFPEILRYAIQFLTFKIDVLEAFIVRQCCDLLEGLIPKREEKEGA-LRPEFYRRLYVFTIMWSVGALLEWEDRNKLETQMRE---LKLDLPEYAADSDNTMFDFLVGESGEWQHWDEKVEEFLYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLAKFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTIVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCEERGFPEEVRAMVAKLVPLTRRLWQLTKMKMLPTPAKFHYVFNLRDLSRIWQGMINTVSEVVKDSSVLLSLWKHECCRVISDRFTTYDDVNWFVKTMSRVLVEDMGDDAGKLLEPTH---YFVDFLRDAPEATGDEPDDASFEMPHIYEPIPTFEALSDRLRYFMGQYNESIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNVSNLMEDLKFLYRTAGQQGKGITFLFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELIGVMKKEFPRRPPTNENLQEYFLTRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSKFEIVCSETVKHELIQTMGVVHDGVAESCVDYFNRYRRSTHVTPKSYLSFLQGYKKIYTDKLQHYQGLAARMDSGLEKLLEAQDSVKVLSEELVVKEKELAIANREAEEVLKQVAIQQQAAQEVKNKVQVVKDRAQAIVDSIAQDKAIAEGKLEAARPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLMLFQRHLDTVTQDPERPCAKPSWSESLKLMSNTGFLNMLVTFSKDSMTEESIEFLMPYLEMEDYNFETAKRVCGNVAGLLSWTKAMQDFFWINKEVMPLKDNLAKQEVRLHKANEDLAAAQQTLDEKEAELAKARAIYDEAMRKKQALEDDAAACRRKMNAAEQLITGLADEKERWTRQSKEYKAQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNLKERKIPSSDTLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRFPLLIDPQGQGKIWLKNRETANELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLFVTTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGRVIKTEKAELEEQRVQLMEDVTNNNKIMKNLEDTLLYRLTSTQGSLVDDEELIGVLKETKVTSTDVRQKIEIAKETQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMDRSTKSPITAKRITNIIDYMTYEVWKYAARGLYEEDKLTFTLLLALKIDMHSKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRGEKAWKQWFDKEAPEEEIIPDGYSTNLDAFRRLLLIRSWCPDRTLSQAKKYIADSLGDKFAEGVILDIEAVWEESEPRTPMVGLLSMGSDPTPSIELLAKKHKKECKAISMGQGQEVHARRLVATSLQNGGWVLLQNCHLSLDYMLEVMDQLIEAETVNEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTYTSFTQDFLDISNMPQWRPMLYCVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDIKKGVNWNTVRYMLGEIQYGGRVTDDFDKFLLNTFCKVWFSDRMFEPTFEFFKGYSIPKFPKLTEYLEYIQSLPAYDTPQVFGLHANADISYQGRTTKAILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPNDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVITAVRTTLTDLKLAIEGTIIMNENLRDALDSMYDAKIPQVWRKISWDSSALGFWFTELINRNQQFSTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDGVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARPKILNEPLPVVHIYAIN-----SVSKD--EKLYMCPIYKKPRRTDLTYVATIKLRTNQPP----DHWVMRGVALLCDV 3990          

HSP 2 Score: 281.182 bits (718), Expect = 2.023e-71
Identity = 133/153 (86.93%), Postives = 139/153 (90.85%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT HHFDVESDGF LRNILEAPLL++KEEIEDICISA KEKDIEAKLKAV AEWS+HE  FGTFKNRGELLLRGDH
Sbjct:  795 TVNGYYDILFTEVDIEKISTELQEFQNRCRKLPKALKDWPAFADLNKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHHFDVESDGFTLRNILEAPLLQYKEEIEDICISAGKEKDIEAKLKAVIAEWSSHEFRFGTFKNRGELLLRGDH 947          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18339942 (tr|A0A267H528|A0A267H528_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018625g1 PE=4 SV=1)

HSP 1 Score: 4280.71 bits (11101), Expect = 0.000e+0
Identity = 2096/3039 (68.97%), Postives = 2494/3039 (82.07%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI-EFCLDD--SEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDI 9568
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQ +E  GFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+  SID+I+SVIG GHYC+ER F   V  ++++L+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG+INT SDV+     +  LW HEC RV+SDR     D+ WF R +    ++D   EV +  +P +   YFVDFLRDAPE   +  DD+ F +P++YEP+P+F+ L ERL  F   YNE +RG+ ++LVFF DAM H+VKISR+I   +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN+ N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+LASG+++ LF ++EMDEI   +   MKK FP+ P T ENL +YFL R R NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ+WP++ALV VA H L  FPLVC D VK+ ++  + V+H  V  +C +YFN+YRRS  +T KSYLS++  YK +Y+        L  RM +GL+KL EAQE++ +LS+EL +KE+ L VA+ EAE VL  V  Q  AA+ +KN+V+ VKD+  AIV+ I  D+ +AE KL AAKPAL+ AE+ALNTIKP DI+TVRKL KPPHLI RIMDCVLILFQ+++D   PD ER  VK SW ESLKL+++T FL+ L  F +D +NEE I+ L PY   EDY+LE A++ CGNVAGL +WTKAM++F+W+N+EV+PLKD+LA Q + L KA DDL +A+  L EKE  LA V+  Y+ A+++KQALE DAA CR+KMS A QL+ GL DEK RWT QS E++SQIG LVGD+++ +AF+SY GPFNQ FRL +  +W+  +++  +P ++ ++++E L     I EWNLQGLPND+LS EN IIVTQASRY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G PL+IEDI EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F+LY+TTKL NP ++PE+YA+TS+IDF+VTMKGLEDQLLG VI  EK ELE  R QL++  +NN + +K LED+LL RL +T+GSLV+D+ L+ VL + K TS DV  +I  A DT+ +I  AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  +W + VR LY+ D+ TFTLLL LK+DM    V+ EE   L+KGG++LDL  + PKP KWI+D TWLNLV LS LH FSG+++QI  SEK W+ WFDK+APE+E IP GY   LD F++LLLIR WCPDRT+  A+RYI  +LG+ F E V   + ++  E++ +TP++GLLS+G+DPT  IE  AKKH  +   ISMGQGQE+H+RR+++ ++Q G WVLLQNCHLSLDY+ E+MDQ++E E +H+DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRT+TSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMD+KKG++W T+ YML EIQYGGRVTDDYDK LLNTFC+ WF++ MF P F F+K +SIP  ++LNEYI+ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI+ VRTTL DLKLAIDGTIIMNE+LRDALDSMYDA+IP  WSK+SW+SS LGFWFTELI RN QF TW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD+V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E+++K+L E LPV+ I AI+   + E        +Y CP+YKKPRRTDLT++A++ LR   ++ ADHW +R VALLCD+
Sbjct: 1617 NRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEVGKLVEPTH---YFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKKGVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAINGPTKDE-------KLYVCPIYKKPRRTDLTYVAAIKLRT--SQPADHWVIRGVALLCDV 4639          

HSP 2 Score: 271.937 bits (694), Expect = 1.242e-68
Identity = 130/153 (84.97%), Postives = 137/153 (89.54%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDH
Sbjct: 1444 TVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDH 1596          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18323226 (tr|A0A267E162|A0A267E162_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010548g1 PE=4 SV=1)

HSP 1 Score: 4280.71 bits (11101), Expect = 0.000e+0
Identity = 2096/3041 (68.92%), Postives = 2502/3041 (82.28%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDS---EVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRC--PPTKQADHWTLRAVALLCDI 9568
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETLSQLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLS+FDNIKTVKFHEKQYETILACYS EGE LELEKPVKAE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDST+AL NAKSD+K+M  TN+ FL LLNLLI QTT +L KVERTKFETLITIHVHQ+DIF+ L K  +KSP+DF+WLKQTRFYF+ED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VLSCKKERKKQF+FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GF+DNI LARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP D+EQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYP+LEAAI +Q+ EA +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKALTDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF ++FP+I RY+IQ+L +K++ LEAF+VRQ CDLLEGLIP+++EK+ + +    Y RLY+F++MWS+GALLE EDR KLE  +R    +KLDLP+   DS++TMFD++V E+GEW HW+ KVEE++YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQ +E  GFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+  SID+I+SVIG GHYC+ER F   V  MV+KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG+INT S+V+  S  LL LW HEC RV+SDR     D+ WF + +   L +    +  +  +P +   YFVDFLRDAPE   +  DD++F +P IYEP+P+FE L +RL  F   YNE++RG+ ++LVFF DAM H+VKISR+I   +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+LASG+++ LF ++EMDEI   +   MKK FP+ P T ENL +YFL R R NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ+WP++ALV VA H L  F +VC + VK +++  + V+H  V  +C+ YFN+YRRS  +T KSYLS++  YK +Y         L  RM +GL+KL EAQ+++ +LS+EL +KE+ L++A+ EAE VL  V  Q  AA+ VKNKV+ VKD+  AIV+ I  D+ +AE KL AA+PAL+ AE+ALNTIKP DI+TVRKL KPPHLI RIMDCVL+LFQ+ +D    D ER   K SW ESLKL+++T FLN L+TF +D + EE I+ L PY   EDY+ E A++ CGNVAGL +WTKAM+ F+W+N+EV+PLKD+LA Q + L KA +DL +A++ L EKE  LA  +  YD A+++KQALE DAA CR+KM+ A QL+ GL DEK RWT QS E+++QIG LVGD+++ +AF+SY GPFNQ FRL +  +W+  ++   +P + T++++E L     I EWNLQGLPND+LS EN IIVTQASR+ L IDPQ QGK W+ N+ET + +  T+  +KYF+QHLEDAL+ G PL+IEDI EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F+L++TTKL NP ++PEI+A+TS+IDF+VTMKGLEDQLLG VI  EK ELE  R QL++  +NN + +K LED+LL RL +T+GSLV+D+ L+ VL + K TS DV  +I  A +T+ +I  AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  +W +  R LY+ D+ TFTLLLALK+DM +  V+ EE   L+KGG++LDL  + PKP KWI+D TWLNLV LS LH FSG+++QI   EK W+ WFDK+APE+E IP GY   LD F++LLLIR WCPDRTL  A++YI  +LGD F E V   I ++  E++ +TP++GLLS+G+DPTP IE  AKKH  +   ISMGQGQEVH+RR++A ++Q G WVLLQNCHLSLDYM E+MDQ+IE E +++DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRTYTSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMDIKKG++W T+ YMLGEIQYGGRVTDD+DK LLNTFC+ WF+D MF P F FFK +SIP   KL EY++ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP+DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI  VRTTL DLKLAI+GTIIMNE+LRDALDSMYDA+IP  W K+SW+SS LGFWFTELI RN QFSTW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E++ K+L EPLPV+ I AI+      +S+D  + +Y CP+YKKPRRTDLT++A++ LR   PP    DHW +R VALLCD+
Sbjct:  498 NRYNAPFKKQIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLSQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSIFDNIKTVKFHEKQYETILACYSSEGEQLELEKPVKAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTDALKNAKSDKKVMASTNQSFLDLLNLLINQTTRELTKVERTKFETLITIHVHQRDIFEDLCKMHIKSPTDFEWLKQTRFYFIEDTDKCMISITDVDFEYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLSCKKERKKQFIFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFLDNITLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGTVKRSNPNDSEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPQLEAAIAKQVQEAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTRCIHTLMKALTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPTFERDQLFPLFESTFPEILRYAIQFLTFKIDVLEAFIVRQCCDLLEGLIPKREEKEGA-LRPEFYRRLYVFTIMWSVGALLEWEDRNKLETQMRE---LKLDLPEYAADSDNTMFDFLVGESGEWQHWDEKVEEFLYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLAKFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTIVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCEERGFPEEVRAMVAKLVPLTRRLWQLTKMKMLPTPAKFHYVFNLRDLSRIWQGMINTVSEVVKDSSVLLSLWKHECCRVISDRFTTYDDVNWFVKTMSRVLVEDMGDDAGKLLEPTH---YFVDFLRDAPEATGDEPDDASFEMPHIYEPIPTFEALSDRLRYFMGQYNESIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNVSNLMEDLKFLYRTAGQQGKGITFLFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELIGVMKKEFPRRPPTNENLQEYFLTRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSKFEIVCSETVKHELIQTMGVVHDGVAESCVDYFNRYRRSTHVTPKSYLSFLQGYKKIYTDKLQHYQGLAARMDSGLEKLLEAQDSVKVLSEELVVKEKELAIANREAEEVLKQVAIQQQAAQEVKNKVQVVKDRAQAIVDSIAQDKAIAEGKLEAARPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLMLFQRHLDTVTQDPERPCAKPSWSESLKLMSNTGFLNMLVTFSKDSMTEESIEFLMPYLEMEDYNFETAKRVCGNVAGLLSWTKAMQDFFWINKEVMPLKDNLAKQEVRLHKANEDLAAAQQTLDEKEAELAKARAIYDEAMRKKQALEDDAAACRRKMNAAEQLITGLADEKERWTRQSKEYKAQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNLKERKIPSSDTLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRFPLLIDPQGQGKIWLKNRETANELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLFVTTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGRVIKTEKAELEEQRVQLMEDVTNNNKIMKNLEDTLLYRLTSTQGSLVDDEELIGVLKETKVTSTDVRQKIEIAKETQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMDRSTKSPITAKRITNIIDYMTYEVWKYAARGLYEEDKLTFTLLLALKIDMHSKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRGEKAWKQWFDKEAPEEEIIPDGYSTNLDAFRRLLLIRSWCPDRTLSQAKKYIADSLGDKFAEGVILDIEAVWEESEPRTPMVGLLSMGSDPTPSIELLAKKHKKECKAISMGQGQEVHARRLVATSLQNGGWVLLQNCHLSLDYMLEVMDQLIEAETVNEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTYTSFTQDFLDISNMPQWRPMLYCVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDIKKGVNWNTVRYMLGEIQYGGRVTDDFDKFLLNTFCKVWFSDRMFEPTFEFFKGYSIPKFPKLTEYLEYIQSLPAYDTPQVFGLHANADISYQGRTTKAILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPNDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVITAVRTTLTDLKLAIEGTIIMNENLRDALDSMYDAKIPQVWRKISWDSSALGFWFTELINRNQQFSTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDGVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARPKILNEPLPVVHIYAIN-----SVSKD--EKLYMCPIYKKPRRTDLTYVATIKLRTNQPP----DHWVMRGVALLCDV 3520          

HSP 2 Score: 280.411 bits (716), Expect = 2.757e-71
Identity = 133/153 (86.93%), Postives = 139/153 (90.85%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT HHFDVESDGF LRNILEAPLL++KEEIEDICISA KEKDIEAKLKAV AEWS+HE  FGTFKNRGELLLRGDH
Sbjct:  325 TVNGYYDILFTEVDIEKISTELQEFQNRCRKLPKALKDWPAFADLNKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHHFDVESDGFTLRNILEAPLLQYKEEIEDICISAGKEKDIEAKLKAVIAEWSSHEFRFGTFKNRGELLLRGDH 477          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18305668 (tr|A0A1I8J1U1|A0A1I8J1U1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 4280.32 bits (11100), Expect = 0.000e+0
Identity = 2096/3039 (68.97%), Postives = 2494/3039 (82.07%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI-EFCLDD--SEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDI 9568
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQ +E  GFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+  SID+I+SVIG GHYC+ER F   V  ++++L+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG+INT SDV+     +  LW HEC RV+SDR     D+ WF R +    ++D   EV +  +P +   YFVDFLRDAPE   +  DD+ F +P++YEP+P+F+ L ERL  F   YNE +RG+ ++LVFF DAM H+VKISR+I   +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN+ N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+LASG+++ LF ++EMDEI   +   MKK FP+ P T ENL +YFL R R NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ+WP++ALV VA H L  FPLVC D VK+ ++  + V+H  V  +C +YFN+YRRS  +T KSYLS++  YK +Y+        L  RM +GL+KL EAQE++ +LS+EL +KE+ L VA+ EAE VL  V  Q  AA+ +KN+V+ VKD+  AIV+ I  D+ +AE KL AAKPAL+ AE+ALNTIKP DI+TVRKL KPPHLI RIMDCVLILFQ+++D   PD ER  VK SW ESLKL+++T FL+ L  F +D +NEE I+ L PY   EDY+LE A++ CGNVAGL +WTKAM++F+W+N+EV+PLKD+LA Q + L KA DDL +A+  L EKE  LA V+  Y+ A+++KQALE DAA CR+KMS A QL+ GL DEK RWT QS E++SQIG LVGD+++ +AF+SY GPFNQ FRL +  +W+  +++  +P ++ ++++E L     I EWNLQGLPND+LS EN IIVTQASRY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G PL+IEDI EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F+LY+TTKL NP ++PE+YA+TS+IDF+VTMKGLEDQLLG VI  EK ELE  R QL++  +NN + +K LED+LL RL +T+GSLV+D+ L+ VL + K TS DV  +I  A DT+ +I  AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  +W + VR LY+ D+ TFTLLL LK+DM    V+ EE   L+KGG++LDL  + PKP KWI+D TWLNLV LS LH FSG+++QI  SEK W+ WFDK+APE+E IP GY   LD F++LLLIR WCPDRT+  A+RYI  +LG+ F E V   + ++  E++ +TP++GLLS+G+DPT  IE  AKKH  +   ISMGQGQE+H+RR+++ ++Q G WVLLQNCHLSLDY+ E+MDQ++E E +H+DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRT+TSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMD+KKG++W T+ YML EIQYGGRVTDDYDK LLNTFC+ WF++ MF P F F+K +SIP  ++LNEYI+ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI+ VRTTL DLKLAIDGTIIMNE+LRDALDSMYDA+IP  WSK+SW+SS LGFWFTELI RN QF TW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD+V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E+++K+L E LPV+ I AI+   + E        +Y CP+YKKPRRTDLT++A++ LR   ++ ADHW +R VALLCD+
Sbjct: 1582 NRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEVGKLVEPTH---YFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKKGVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAINGPTKDE-------KLYVCPIYKKPRRTDLTYVAAIKLRT--SQPADHWVIRGVALLCDV 4604          

HSP 2 Score: 271.937 bits (694), Expect = 1.404e-68
Identity = 130/153 (84.97%), Postives = 137/153 (89.54%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDH
Sbjct: 1409 TVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDH 1561          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|21097051 (tr|A0A2T7NHT2|A0A2T7NHT2_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18861 PE=4 SV=1)

HSP 1 Score: 4227.55 bits (10963), Expect = 0.000e+0
Identity = 2058/3038 (67.74%), Postives = 2482/3038 (81.70%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHER-KGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            + YN PFKK IQ  V+ L+NSSEIIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDETL QLLPHL+EQLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDN K V+FHEK Y+ IL+  S EGE+++   PVKAE NVE+WLM L+  +Q+SLH VIRAA  +I DT F +LEFL+ +PAQVGLLGIQL+WTRDSTEAL +AK DRKIM  TNE F  LLNLLI+QTT DL KVERTKFETLITIHVHQ+DIFD LV+  +KSP+DF+WLKQ+RFYF+ED DRC +SITDVDF YQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQF+FTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLA+ GFIDNI+LARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR +P DTEQT VMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELEAAI++ ++EA +++HP W LKL+QLFETQRVRHGMMTLGPSGAGKT CIH+LMKA+TDCGEPH+E RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT + KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+ +CKIIFE HNIDNASPATVSRNGMVYMSSS LDW P+L+GWL  R ++E  +++ LF NSFP I RY++Q L++KME LEAF++ QA  LL GLIP +D+KD +Q+SR+H+E LYIF VMWS+GA LE++DR KLE +IRS++ I LDLP I  DS+ T+FD+ V  +G W HWN +V+E++YP D  PEY SILVPNVDNVRT+FL++ +A Q KAVLLIGEQGTAKTVMIN Y    NPEYH+ +S+NFSSAT P MFQRTIES+VDKR+GS YGPPAG+KMT+FIDDINMPVINEWGDQ+ANEIVRQ +E  GFYSL+KPGDF ++ D+ F+AAMI PGGGRNDIP+RLKR F I+NCTLP+ ASID+I+SVIG GH+CKER F  +V  +V +L+ +TR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++ T S V++  K L+ LW HEC RV++DR     DL WF + +   + +    E          F +FLRDAPE   E  +D+   +P+IYEP+ SFE L+ERL  F + YNE++RG+ ++LVFF DAM H++KISR+IR  +G+ LLVGVGGSGKQS+TRLASFI  Y  FQIT+TR YN +N LEDLK +YR AG+E KG  F+FTD EIKDE++LEY+NNML+SG++A LF+++EMDEIL  +   MKK FP+ P + ENLY+Y+L RVR NLH+ LCFSP+GEKFR+RAL FP L SGCT++WFQ+WPK+AL+ VA H L +F +VC    K++++  + +IH  V  +C+ YF +YRRS  +T KSYLS+I+ YKT+YQ  +  +  L  RM  GL+KL EA +A+  LSKEL +KE+ L++AS +AEAVL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AE+KL AA+PAL+EAE ALNTIKP DI+TVRKL KPPHLI RIMDCVLILFQ K++P   D E+ +  K SW  SLKL+A TNFL SL+TFP+D IN+E ++L++PYF  EDY L+ A+K CGNVAGL +WTKAM  F+ +N+EV+PLK +LA Q   L  A  DL +A+  L EKE+ LA+V+ EYD A+  KQAL  DA  CR+KM+ A+ L+NGL  EK RWT QS EF++QIG LVGD+++ + F+SY GPFNQ FRL +  +W   ++N  +P++  +++V+ L +P  + EWNLQGLPND+LS +N IIVTQASRY L IDPQ QGK WI N+E ++ +  T+  +KYF+QHLED+++ G PL++ED+ EELDPAL+NVLEKNFIK+G+ LKVKVGDKE DI K F LY+TTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK ELE+ R +L+++ + NK+K+KELED+LL RL +T+GSLV+D++L+ VLN  K T+ DVS ++  AA+TE +IN AREE+R ++ RGS+LYFLI ++S VN MYQ+ L+QFL LF  S+ +S+KSP  Q+RIQ+II  MT  ++ + VR LY+ D+ TFTLLLALK+D++ N ++ +E   L+KGG++LDL  + PKP +WIVD+TWLNLV LS LH FSG+++Q+  +EKQW+ WFDKDAPE+E IP GY   LD F++LLL+R WCPDRTL  A++YI   LG+ F E V   +  +  E++ +TPL+GLLS+G+DPT  IE  AKK  ++   ISMGQGQEVH+RR++ + M +G W+LLQNCHLSLDY++E+MD +IE E I D FRLWVTTE+HPKFPISFLQ+SIKFTNEPPQG+KAG+KRTY    QDFLDISNM QW+PM+Y V +LHT VQERRKFGPLGWNIPYE+NT+D NAS+QFVQNHLDDMDIK+G++W  + YM GEIQYGGRVTDD+DKRLLNTFCR WF+++MF P+F F+K + IP  +K+NE  + IN LP+ D+PE+FGLH+NADITYQSKTA+SILD IL+IQPKDA +GGGETRESVVYR+ DDML KLP DYV FEV ERLQ MG LQPMNIFLRQE+DRMQ+VI  VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIPS W K+SWESSTLGFWFTELI+RN+QF +W F GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALD V+L NDVTK M+D+I QPP+EGVYVYGLYLEGAGWDRR SKL+ESK KVLFEP+PVI I A D +            MY CP+YKKPRRTDLT+IA V LR   T+  DHW LR VALLCDIK
Sbjct: 1644 NRYNAPFKKQIQTWVANLTNSSEIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHETPNVVQCCVGDETLMQLLPHLMEQLELCQKSLTGYLEKKRLAFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNTKNVRFHEKVYDQILSIVSSEGESID---PVKAEGNVEVWLMALMVQSQKSLHSVIRAAAMAIQDTSFQLLEFLDTFPAQVGLLGIQLIWTRDSTEALTHAKYDRKIMSTTNESFQKLLNLLIEQTTKDLSKVERTKFETLITIHVHQRDIFDDLVRKSIKSPTDFEWLKQSRFYFIEDQDRCQISITDVDFTYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLACKKERKKQFIFTDGDNVDMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLAAVGFIDNIILARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGTVKRQSPNDTEQTIVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPELEAAIHKNVEEAKLVNHPAWTLKLVQLFETQRVRHGMMTLGPSGAGKTCCIHMLMKAMTDCGEPHKEWRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTTRVKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMASNCKIIFEPHNIDNASPATVSRNGMVYMSSSGLDWKPILQGWLNTRPAHENEVIMSLFENSFPLILRYAVQNLVFKMEMLEAFIITQATKLLTGLIPIRDDKDHTQMSRLHFEHLYIFCVMWSVGAFLELDDRAKLEEFIRSSSEIHLDLPNIPSDSDSTIFDHFVENDGTWKHWNERVKEFVYPTDHEPEYTSILVPNVDNVRTEFLVDMIARQNKAVLLIGEQGTAKTVMINNYTKLYNPEYHLAESVNFSSATTPLMFQRTIESYVDKRVGSIYGPPAGKKMTIFIDDINMPVINEWGDQVANEIVRQLMENGGFYSLEKPGDFTTIADVQFLAAMIQPGGGRNDIPQRLKRQFVIYNCTLPSNASIDKIFSVIGCGHFCKERGFSENVQQVVKRLVPITRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLKTISSVVTDEKILMYLWKHECCRVIADRFTSVEDLNWFNKTMTRVVHEDTNEELAKLTEPSHCFAEFLRDAPEATGEETEDADLDMPRIYEPIASFEQLEERLLYFLQQYNESIRGAGMDLVFFKDAMTHLLKISRIIRTPRGHALLVGVGGSGKQSLTRLASFICGYRTFQITLTRSYNASNLLEDLKFLYRTAGQEGKGITFIFTDQEIKDEAFLEYLNNMLSSGVVANLFARDEMDEILGELVPVMKKEFPRRPPSNENLYEYYLSRVRKNLHVTLCFSPVGEKFRQRALKFPGLISGCTMDWFQRWPKDALIAVADHFLLEFDIVCSLETKKQVIQTMGIIHDGVAESCIDYFQRYRRSTHVTPKSYLSFINSYKTVYQAKRGEIGELANRMNTGLEKLIEASQAVAELSKELAVKEKELAIASEKAEAVLKTVTVKAQAAEKVKEQVQKVKDKAQAIVDAIETDKAIAEQKLEAARPALEEAEAALNTIKPTDIATVRKLGKPPHLIMRIMDCVLILFQSKLEPVRLDPEKPEFFKPSWSNSLKLMAGTNFLQSLMTFPKDSINDETVELMEPYFESEDYLLDTAKKVCGNVAGLLSWTKAMAGFFVINKEVLPLKANLAVQEGRLNIAMADLNAAQAQLDEKEKELAIVRAEYDKAMAEKQALMDDAETCRRKMTAASTLINGLAGEKERWTEQSKEFKAQIGRLVGDVLICTGFLSYSGPFNQDFRLLLSRNWMKELKNRKIPVSSNLNMVDMLVDPTTVAEWNLQGLPNDELSTQNGIIVTQASRYPLLIDPQGQGKIWIKNREQKNELQVTSLNHKYFRQHLEDSMSLGRPLLLEDVGEELDPALDNVLEKNFIKVGSTLKVKVGDKECDILKGFMLYVTTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKAELESERVKLMEEVTANKKKMKELEDNLLFRLTSTQGSLVDDEDLINVLNVTKVTAQDVSQKLQIAAETEIKINSAREEFRPVATRGSILYFLIVEMSLVNCMYQTSLRQFLQLFDRSMAKSQKSPITQKRIQNIIEYMTFEVFKYAVRGLYEQDKLTFTLLLALKIDLQGNKIKHDEFMTLIKGGASLDLNVVTPKPHRWIVDLTWLNLVELSNLHQFSGILDQVTRNEKQWKLWFDKDAPEEEMIPDGYNNTLDVFRRLLLVRSWCPDRTLPQAKKYIGDALGERFAEGVILDVEKMWEESEPRTPLVGLLSMGSDPTNSIEALAKKLRLECRAISMGQGQEVHARRMLQQGMTQGGWLLLQNCHLSLDYVQEVMDNIIEAESIDDTFRLWVTTEVHPKFPISFLQISIKFTNEPPQGVKAGLKRTYAGITQDFLDISNMPQWKPMLYGVGFLHTIVQERRKFGPLGWNIPYEFNTSDYNASVQFVQNHLDDMDIKRGVNWICVRYMFGEIQYGGRVTDDFDKRLLNTFCRVWFSENMFTPQFVFYKGYVIPKCNKINEIHEYINSLPSADTPEVFGLHANADITYQSKTAKSILDSILSIQPKDAGSGGGETRESVVYRLADDMLDKLPPDYVPFEVRERLQKMGALQPMNIFLRQEIDRMQRVITTVRTTLQDLKLAIDGTIIMSENLRDALDCMYDARIPSLWLKISWESSTLGFWFTELIDRNTQFHSWCFDGRPNTFWMTGFFNPQGFLTAMRQEVTRAHKGWALDNVILQNDVTKQMKDDITQPPAEGVYVYGLYLEGAGWDRRGSKLVESKPKVLFEPMPVIHIYAKDTAPPD-------SKMYVCPIYKKPRRTDLTYIADVMLRS--TQPPDHWILRGVALLCDIK 4669          

HSP 2 Score: 265.774 bits (678), Expect = 1.036e-66
Identity = 124/152 (81.58%), Postives = 136/152 (89.47%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +V+GYYDILW DV+I+KI+ EL EFQNRCRKLPK LKDWPAFEDL+KTIDDFN MVPLLELM N AMKPRHWQR++DLT H FD+ES+ F LRNILEAPLLKFKEEIEDICISAVKEKDIEAKLK V A+WS+ E  FGTFKNRGELLLRGD
Sbjct: 1471 TVHGYYDILWQDVNIDKINTELLEFQNRCRKLPKALKDWPAFEDLKKTIDDFNEMVPLLELMANKAMKPRHWQRIADLTGHAFDIESESFTLRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKQVIADWSSKEFAFGTFKNRGELLLRGD 1622          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 3943.27 bits (10225), Expect = 0.000e+0
Identity = 1939/3053 (63.51%), Postives = 2404/3053 (78.74%), Query Frame = 2
Query:  419 NV*ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            N+ +S  V+ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V FH+K                                        R ++ V+ +     +   F V+       AQVGLLGIQ++WT+DS EAL NA+ DRKIM +T + FL LLN LI  TT DLG +ERTK+ETLITIHVHQKDIFD L    ++SPSDF+WLKQ RFYF+ED+DR +++ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  KD+    ++SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQ +E KGF++L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GHYC +R F   V  +VS+L+ LTR+LWQ TK KM PTP+ FHY+FNLRDLSRIWQG++N  +DVI + K LL LW HEC RV++DR     D+ WF+  +   +++    E+RD   P    YFVDFL+DAPE   E  +++ F +PK+YEP+ SF  L++RL+MF   YNE++RG+ ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N +EDLK++YR AG++ KG  F+ TDNEIKDES+LEY+NN+L+SG ++ LF+++EMDEILS +   MK+ FP+ P T ENL++YF+ RVR NLH+VLCFSP           FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK ++V  +      V   C+ YF +YRRS  +T  SYLS+I  YK +Y+  +  +  +   M  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +A+EKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D E+  +  SW ESLKL+ + NFL SL  FP+D INEE+++LL PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +NREV+PLK +L  Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EKARWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + S W+  +R   +P    +++ E L +   + EWNLQGLPND LS++N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VTM+GLEDQLLG VI  EK+ELE  R  L++    NKRK+KELEDSLL RL +T+GSLV+D++L++VL+  K+TS +V+ ++  AA+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  + N+  R LY+  +  FTLLL LK+DM++N ++ EE   L+KGG++LDLK   PKP KWI DMTWLNLV LSKL  FS +++QI   EKQWR+WFDK+APE+E IP  Y+  LD FK+LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TP++ LLS+G+DPT +I    K+  ++   +SMGQGQEVH+R+++ + M  G W LLQNCHL LD+++ELMD + ET+ IH+ FRLW+TTE H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQ+ LD+SNM+QWRPM+Y+VA+LH+ VQERRK+GPLGW+IPYE+N AD NA++QFVQNHLDDMD+K+G+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MFN +F+F+KD+ IP  + +++Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S+GGGETRE+ V R+ DDML KLP DY  FEVM+RL+ MG L+PMNIFLRQE+DRMQ+V+A VR+TL DLKLAIDGTI+M+E+LRDALD MYDARIP+ W K SW SSTLGFWFTEL+ERN QF  W+F+GRPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VT+ M+D+I QPP EGVYVYGLYLEGAGWDRRN +L++SK KVLFE +PV+ + A     E    +D    +Y CP+YKKP RTD   IA+V LR   +++ ++W LR VALLCD+K
Sbjct: 1184 NMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVFHDKT---------------------------------------RRVNHVLISKQVKHHCILFKVMFKFVFLLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPKDQ--GGELSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYK--EKHLESVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKD--SRLYSCPIYKKPARTDQNIIAAVDLRT--SQRPEYWILRGVALLCDVK 4173          

HSP 2 Score: 223.402 bits (568), Expect = 2.345e-57
Identity = 103/152 (67.76%), Postives = 122/152 (80.26%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYD+LW DV IE+I+NEL +FQ RCRKLP+ LK+W AF DL+KTIDDF+   PLLELM N AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1025 TVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGD 1176          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 3486.04 bits (9038), Expect = 0.000e+0
Identity = 1694/2675 (63.33%), Postives = 2109/2675 (78.84%), Query Frame = 2
Query: 1553 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  K       +SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQ +E KGF++L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+   G GHYC +R F   V  +VS+L+ LTR+LWQ TK KM PTP+ FHY+FNLRDLSRIWQG++N  +DVI + K LL LW HEC RV++DR     D+ WF+  +   +++    E+RD   P    YFVDFL+DAPE   E  +++ F +PK+YEP+ SF  L++RL+MF   YNE++RG+ ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N +EDLK++YR AG++ KG  F+ TDNEIKDES+LEY+NN+L+SG ++ LF+++EMDEILS +   MK+ FP+ P T ENL++YF+ RVR NLH+VLCFSP           FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK ++V  +      V   C+ YF +YRRS  +T  SYLS+I  YK +Y+     V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +A+EKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D E+  +  SW ESLKL+ + NFL SL  FP+D INEE+++LL PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +NREV+PLK +L  Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EKARWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + S W+  +R   +P    +++ E L +   + EWNLQGLPND LS++N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VTM+GLEDQLLG VI  EK+ELE  R  L++    NKRK+KELEDSLL RL +T+GSLV+D++L++VL+  K+TS +V+ ++  AA+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  + N+  R LY+  +  FTLLL LK+DM++N ++ EE   L+KGG++LDLK   PKP KWI DMTWLNLV LSKL  FS +++QI   EKQWR+WFDK+APE+E IP  Y+  LD FK+LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TP++ LLS+G+DPT +I    K+H      +SM     +H+        ++G W LLQNCHL LD+++ELMD + ET+ IH+ FRLW+TTE H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQ+ LD+SNM+QWRPM+Y+VA+LH+ VQERRK+GPLGW+IPYE+N AD NA++QFVQNHLDDMD+K+G+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MFN +F+F+KD+ IP  + +++Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S+GGGETRE+ V R+ DDML KLP DY  FEV + L  MG L+PMNIFLRQE+DRMQ+V+A VR+TL DLKLAIDGTI+M+E+LRDALD MYDARIP+ W K SW SSTLGFWFTEL+ERN QF  W+F+GRPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VT+ M+D+I QPP EGVYVYGLYLEGAGWDRRN +L++SK KVLFE +PV+ + A     E    +D    +Y CP+YKKP RTD   IA+V LR   +++ ++W LR VALLCD+K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPK-------LSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF---GTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRHISTSRLLSMLFFSYIHTH---THTHEQGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEV-KGLNTMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKD--SRLYSCPIYKKPARTDQNIIAAVDLRT--SQRPEYWILRGVALLCDVK 2659          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3250.69 bits (8427), Expect = 0.000e+0
Identity = 1593/2679 (59.46%), Postives = 2045/2679 (76.33%), Query Frame = 2
Query: 1553 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQ-IAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPS---EGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP+++E+T VMRVLRDMN+SKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+H PWVLKL+QL+ETQRVRHGMMTLGPSG GKT CIH L+KA+TDCG PH+E+RMNPKAITA QMFG LDV+TNDWTDG+FSTLWR+TLK KKGE+ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L+W P+L+ WL K  +++  ++L  F N+F     YS    IY  E +                                 RL++F+VMWS+GALLE+EDR ++E ++R N+   LDLP  ++D   T+F+++V+E GEW  W+ KV EY YPKDS P+Y SILVPNVDN RTDFL+ T+  Q KAVLLIGEQGT KTVMI  Y +  +PE H+ KSLNFSSAT+P MFQ+TIES++DKRMGSTYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQ +E  GFYSL++PG+F+SV+DL  VAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C ER F  SV ++   L+   R++WQ+ K KM P+P+KFHY+FNLRDLSRIWQG++   ++V    + L+ L+ HEC+RV++DR ID++D   F+  +E    +    +         YFVDFLRDAPE   +  +D+   +PKIYEP+PSF  L ERL++F + YNE+VRGS ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQI +TR YN  N +EDLK++YR AG + KG  F+F DN+IKDES+LEY+ N++ASG ++ LF+++E+ EI   +   MK+  P+ P T +NLY YFL RVR NLH+VLCFSP+GEK   RA+ FP L SGCT++WFQ+WPK+ALV VAQH L  + L C + VK+ ++  +      V   C +YF ++RR   +T KSYLS+I  Y+T+Y     +V  L ERM  GL +LKEA++A+  LSK L +KE+ L VAS +A+AVL  V  +  AAE VK +V+ VKDK  AIV++I  D++VAE KL AAKPAL  AE AL TIKP DI+TVRKL KPPHLI RIMD VL+LFQ+++D    D ER  ++ SW E+LKL+ ++ FL+ LL F +D INEE+++LL PY + EDY+LEAA++ CGNVAGLC+WT+AM  F+ +N+EV+PLK +L  Q   LA AQD+L  A++ L  K++ L   +  YD A+  KQ+L  DA  CR+KMS A  L++GL  EK RWT  S EF+ QI  L GD+++ + F+SY GPFNQ++R  +   W+  +  N +P +++ +++  L +   +GEWNLQGLPND LS++N IIVT ASRY L IDPQ QGK WI N+E  H +  T+  +KYF+ H+ED L+ G PL+IED+ EELDP L+N+LEKNFI+ G+  KVKVGDKEVD+ K+F LYITTK++NP +SPE+ AKT+++DF+VT+KGLEDQLLG VI  EK+ELE+ R ++L + ++NKRK++ELED+LL RL +T+GSLVED++L+ VL   K T+ +VS++ +  AA+TE +IN+AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F +SI +S KS    +R+ +I+  +T  ++ + VR LY+  +  FTLLL LK+D++  ++   E   L+KGG++LDL +++PKP +WI+DMTWLNLV LS LH FS L  Q+  +++ W++WFD+ APE+  +P GYE++L  F KLLLIR WCPDRT+  AR YI  ++G  + E V   + S+  E D +TP+   LS+G+DPT  IE  AK        ISMGQGQEVH+RR++A++M +G W+LLQNCHL LD+++EL++ +  +E I + FR+WVTTE+HPKFPI+FLQ S+KFTNEPPQGIKAG++RTY+S  QD L+I+NM QWRP+++AVA+LHT VQERRKFGPLGWNIPYE+N AD  +S+QFVQNHL+D+D+K G++W  + YMLGE+QYGGRVTDD DKRLLNTF R WF+++MF  KF F++ ++IP    L EY   I+ LP  D+PE+ GLH NADI+ Q+  A  IL  I+NIQPKD+S GG ETRES V R+ ++ML KLP DYV+ EV   LQ MG++QPM IFLRQE+DRMQ +I  VR+TL DLKLAIDGTIIM+EDLRDALDS+YDAR+P  W + SW+S+TLGFWFTEL+ERN QF +W F GRP+ FW+TGFFN QGFLTAMRQE TR +  KGW LDTVVL NDVT+ M++++  PP+    GVY+YGL+L+GAGWD+RN K++ES  KVLF PLPV+ + A  +S   +  R    ++Y CPVY+KPRRTDLTFI +++LR    +  DHWTLR +ALLCD K
Sbjct:   12 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKPQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPSESEKTVVMRVLRDMNISKLVDEDEPLFMSLINDLFPGIVLDKAGYPDLEAAIVKQAEEAGLIAHQPWVLKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLLKAMTDCGTPHKELRMNPKAITASQMFGTLDVATNDWTDGVFSTLWRKTLKAKKGEYTWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIPMAPTCKVVFEPHNIDNASPATVSRNGMVFMSSSVLNWKPILQAWLKKLPASQAELILNFF-NTF-----YSRLKYIYLTEKVIG-------------------------------RLFVFAVMWSVGALLELEDRSRMEMFLR-NHPAALDLPNTQQDQ--TIFEFVVNEAGEWDPWSVKVPEYHYPKDSVPDYSSILVPNVDNTRTDFLLQTIMKQGKAVLLIGEQGTGKTVMIKGYTTKYDPETHLSKSLNFSSATLPSMFQQTIESYIDKRMGSTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQGGFYSLERPGEFVSVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCSERGFTESVSSLAKALVPTIRRVWQTVKAKMLPSPAKFHYIFNLRDLSRIWQGMLTVGAEVCRDPEVLVSLFRHECTRVIADRFIDQNDRNVFDGILEKISTEEHGSDLVKGVAWEEYFVDFLRDAPEITGDEPEDTEVVIPKIYEPIPSFSALSERLTLFLQQYNESVRGSAMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASFIAGYQSFQIVLTRTYNATNLMEDLKTLYRIAGLQGKGVTFIFADNDIKDESFLEYMTNVVASGEVSNLFTRDEISEITQDLIPTMKQQHPRLPPTIDNLYSYFLSRVRSNLHVVLCFSPVGEKLGSRAVKFPGLISGCTVDWFQRWPKDALVAVAQHFLSGYSLQCSEEVKQSVIGTMGTFQDLVAQTCTEYFQRFRRQTYVTPKSYLSFIKGYQTIYSEKIGNVRTLAERMNTGLDRLKEAEQAVNELSKALAVKEKELEVASKKADAVLQEVAVKAQAAEKVKTQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALAAAEAALQTIKPADIATVRKLGKPPHLIMRIMDAVLLLFQRRVDSVTMDPERPCLRPSWAEALKLMNNSGFLSMLLNFNKDTINEEMVELLLPYLSMEDYNLEAAKRICGNVAGLCSWTEAMADFFGINKEVLPLKANLKLQEARLAVAQDELAKAQEQLDAKQKELDEAQELYDGAVSEKQSLLEDAEACRRKMSNAMALIDGLGGEKIRWTESSTEFQRQIKHLPGDVLLATGFLSYAGPFNQEYRNLLLQQWKKEMSGNHIPYSQSFNLITMLVDNATLGEWNLQGLPNDDLSIQNGIIVTSASRYPLLIDPQGQGKTWIKNREANHDLQVTSLNHKYFRAHIEDCLSLGKPLLIEDVGEELDPVLDNILEKNFIRSGSTYKVKVGDKEVDVMKEFTLYITTKMANPAYSPEVSAKTAIVDFTVTVKGLEDQLLGRVILTEKQELESERVKMLAEVTSNKRKMQELEDNLLYRLTSTQGSLVEDESLIEVLRVTKSTAEEVSLKKLLVAAETEIKINEAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDSSIEKSPKSQITSKRLINIMDFLTYEVFRYTVRGLYEDHKFLFTLLLTLKIDLQAKNISHPEFQALIKGGASLDLNSVEPKPRRWILDMTWLNLVHLSSLHPFSRLPSQVSQNDRGWKSWFDEAAPEEAPLPDGYESLLGAFHKLLLIRSWCPDRTIAQARHYITESIGQRYAEGVILDMDSMCTENDKRTPMTCFLSMGSDPTENIERLAKSKGFPCRPISMGQGQEVHARRLLAQSMADGGWLLLQNCHLGLDFLDELLETINTSENIAESFRVWVTTEVHPKFPINFLQSSVKFTNEPPQGIKAGLRRTYSSITQDQLEITNMPQWRPLLFAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLEDVDVKLGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFTRIWFSENMFGEKFCFYRGYTIPNAKTLPEYHSHIDALPLVDTPEVLGLHPNADISCQTNMASEILSTIINIQPKDSSGGGDETRESTVLRLANEMLEKLPPDYVAHEVRTHLQKMGLVQPMTIFLRQELDRMQNIIGCVRSTLTDLKLAIDGTIIMSEDLRDALDSVYDARVPKLWQRSSWDSATLGFWFTELLERNQQFHSWTFNGRPHQFWLTGFFNPQGFLTAMRQETTRMNLAKGWTLDTVVLLNDVTRMMREDVTGPPTGDVGGVYIYGLFLDGAGWDKRNCKILESLPKVLFTPLPVVHVYA--VSSATDPKRPQGVSLYPCPVYRKPRRTDLTFIFTLFLRT--VQNPDHWTLRGLALLCDCK 2646          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1873.6 bits (4852), Expect = 0.000e+0
Identity = 1090/3070 (35.50%), Postives = 1732/3070 (56.42%), Query Frame = 2
Query:  479 FKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEE-YIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDV--FSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLK-TIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI--QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIE---TEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQD-FLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFN-PKFRF--FKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDAS---AGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNC-FWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQD-EINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD----LTFIASVYLRCPPTKQADHWTLRAVALLCDI 9568
            F+K++      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F +I+ SW  IM R +++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++ +     A   +S +GE +E   PV  E  VE WL  +    + +L   +R    ++        +++  +P Q+ +   Q+ WT D T+ L+  K  +D+  ++   ++ + +L+        +L K+ R K   L+T+ VH +D+ D+L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCSD +D++ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F+F   D+  +    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L   GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++R  P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+  I  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+ K+    +L KAL+     GEP      E  +NPKA++  +++G  D+STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E   +  LF         +   +    +   E   V   C L + L   ++     D+    R+  E  +IFS++WSI A ++ + R K++ ++R    ++   P     ++DT+++Y V ++N  W  +  K+ + + YP ++ P Y  I+VP VD VR  FL+N++   +  VLL G  GT KT +    L   +P      ++N SS T     Q  IES V+KR   TY P  G+KM  F+DD+NMP ++++G Q   E++R  I+   +Y      D    +D+  +A+M  PGGGR  I  RL+  F + N T P  + I  I+   G     K + F+  V  + S L   T +L+ +   +  PTP+K HY+FNLRD+S+++QGL+ +  D   + + + RLW+HEC RV SDRL+D++D + F   +   L     + + +  P  ++  F DFL++                P +YE +  F+ LK  +    + YN T    P++LV F DA+ HV ++ RVI   +GN+LLVG+GGSG+QS++RLA++I +Y+ FQ+ +T+ Y    F ED+K +YR  G +NK TVF+F D +I DES+LE INN+L+SG +  L+  +E +E+ S +    +K      +T + ++ Y ++RVR+NLH+VLC SP+GE FR R   +PAL +  T++WF +WP++AL+ VA+  L    L   + ++ K+  +   +HQ V  FS  +K   + +R   +T  +YL  +  YK +    +A +     +++NGL K+ + +  +  +S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K  A   K +   + A+  L  A PAL+EA  AL ++   D++ ++   +PP L++ +M  V+IL              +G + +W E+ + L  +NF+  L+ F +D I++ ++  +  Y T+ D+  E   +       LC W +AME +  + R V P +  L      LA+ Q  L  AE    E EE L  +K +YD  + +K+ L   +     K+  A +L++GL  E+ RW       E  +G LVGD ++ +AF+SY GPF   +R ++ ++ W    R+  VP +   +    LS P  + +WN+QGLP+D  S EN +IVT+ +R+ L +DPQ Q   WI N E++  +   +     F + LE+A+  G P++++++ EELDP+L  +L K+F  IG  + +K+GDKEV+ +  F  YITTKLSNPH++PEI  KT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   ++ KRK++ELED +L  L    GSL++D  L+  L  +K T+ +VS Q+  +  TE +I+ ARE YR  ++R S+L+F++ D+  ++PMYQ  L  +++LF  SI +S++S  ++ RI ++    T  ++ +  R L++  +  F+  +  K+      +  +E +  L+GG  LD +  +D     W+ D  W N+  L KL  F GL+       K W  W+    PE+  +P  +E + +E +K+L++R    DR       +I   LG  F+E     + ++  ++  KTPL+ +LS G DPT  +   A+   +      +S+GQGQ   + R+I + ++ G WV L NCHLSL +M +L D+++E    E  H DFRLW+++  HP+FPI+ LQ  IK T EPP+G+K+ +KR Y    +  F   S  + +R +++++ + H+ + ER+KF  LGWNI Y +N +D   S   +  +LD+ +    + W  + Y++  + YGG VTDD+D+RLL T+   +F +   N P F+      + IP     + Y + I +LP  + PE+FG H NADI  Q    +++ D +L++QP+  S    G G +RE  V  +  D+  K+P + V +E  ++L +     P+N+ L QE+ R   ++  +RT+L +L+  I G ++M+  L +    ++DAR+P  W K       L  W  +L +R  QF+ W     P   FW++GF    GFLTA+ Q   R H   ++DT+  W  +   + D  +  PP +GV++ GLYLEGAGWD++NS L+E++   L  P+P I  + ++  K+      + KNMY CP Y  P R+      +F+  V L+       +HW  R  ALL  +
Sbjct: 1407 FEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDIC-LVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRM-VELWFIFSLIWSICASVDEDGRKKIDNFLR---EMEGTFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNA-PFY-KIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWY------DRQMKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIF---GTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQQPIFGDFLKE----------------PHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARK--ENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKL--ELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQL-DKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYE---EIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVP-ELVDYESTQKL-LQDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNV-SVDTLS-WEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKK------VAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVS-YEHWIKRGTALLMSL 4405          

HSP 2 Score: 61.2326 bits (147), Expect = 2.829e-8
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 3
Query:   57 SNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRG 437
            S   T ++N   KL + LKD  W   E  +  I+ F   +P++  + +PAM+ RHW ++       FD  S  F L  I+   L +  E I +I  +A KE  IE  L+ +   W    L    +K++G
Sbjct: 1253 STAQTMYKN-LNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKG 1380          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1822.75 bits (4720), Expect = 0.000e+0
Identity = 1083/3071 (35.27%), Postives = 1737/3071 (56.56%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-KQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKS-DRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFV-------VRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRS-------NNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKM-FSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKV-GDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKL--HVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI---QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDM--DIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND---DMFNPKFRFFK----DHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHM-QDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD-----LTFIASVYLRCPPTKQADHWTLRAVAL 9556
            PF   IQ     LS  SE+IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F +IDK + KIMS    +  + +CC+    LS L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI +++F      ET+  A  S EGE +EL++PV AE  VE W+  +L   +R+   + + A       +  V   L+ Y   V L G Q+ WT +  +      S +++ M+Q  ++    ++ L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D   V     +F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+IF GL+Q G+WGCFDEFNRID  VLSV + QI  + +    + K+F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P   E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E      P  V K++Q++ET   RH  M +GP+G GK+  I+ L +A T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   +   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P I    ++ +    + E L+  V       V Q   +L+ L+  +D      +S    E  +I ++  S+GA L    R K +  ++         +   L  P        T+FD+       +W+ W+S V +YI+  D+  ++  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT     +L++ NP++ M  ++NFSS T     QR++E+ V+KR   TYGPP G+ + VF+DD+NMP ++E+G Q    +++  ++  G Y   K  +   + DL F+AAM   GGGRN++  R    F +FN   P   ++  IYS I  GH    R F   + NM  KL   T +L+++    + PTPSKFHY+FNLRDLSR++ GL  T ++   +  + +R+W +EC RV  DRLI+E+D    + +I+  + +    E      +   F D+ R A    E          P++YE +  ++  K       + YNE    + +NLV F DA+ H+ ++ R+IRM +G+ LLVGVGGSGKQS+T+LA+F A    F+I ++R Y+ +NF EDLK++Y   G ENK TVF+FTD  + +E +LE INNML SGM+  LF  +E + +L+ +  +  K    H  ++E+++QYF+++   NLH+VL  SP+G+  R R   FP L +   I+WF  WP +AL  VAQ  L + P++      E ++  + ++H  V      +  + RRS  +T K+YL +I  Y T+ Q     +    +R++ GL KL+EA   +  L+K+L  ++  L+  S+  E++L  ++  T  AE  K        +     + I V+++ AE  L  A PAL+ A  AL  +  +D++ +R   KPP  +Q + +C+L++             R   + +W  +  +++  NFL SL+    D I+   +  ++ +    +   E  +      +G+  + +A+  +  V RE+ P ++ +A       +++ +L+  +  L   ++ L  +  +Y  A+  KQ L+ +A +  +++  A++L++GL  E  RWT    E + +   L+GD ++ +AF+SY G FN  FR +M +  W+  +   G+P+++   I   L++  +I  W  + LP D+LSV+N I+ T+ASR+ + IDPQ Q  +WI  KE ++++  ++F +  F + LE A+  G P + +D+ E +DP ++NVLEKN +K   G +V V GDKEVD    F LY+ TKL+NP +SP ++ K  VI+++VT+KGLEDQLL +++  E++ELE  R +L+++TS NKR +K+LEDSLL  LA + G+++++  L+  L + K  + +V  ++  A  T  +I++ R+ YR  +KRG++L+F++ +++ VN MYQ  L  FL +F  S+ +S  +  + +R+ +I++ +T+N++N+    L++  +  F+  + +K++       QEEL   LKG  +L+ K+   KP  W+ D  W ++V L++L  + F  L+E I  + K+W+ WFD D+PE    P  Y   L  F+KLLL+RC+  DR       Y+  T+G+ +++       ++  ++   +P++ +LS G +P   +   A++      ++  ++MGQGQE  + +++  A+  G W++LQNCHL + ++++L   +      H DFRLW+TT+    FPI  LQ S+K   EPP G+K  ++ TY     + L       +R +VY +A+ H  VQERRK+G +GWN+PY++N +D    ++ +  +L       +  + W ++ Y++GE+ YGGR  D +D+R+L  +   +  D   D F P F FF     D+ IP       Y++ I  LP  ++PE+FGLH NA+I Y ++ A+ +   ++ +QP+   +GGG +R+  + ++  D+  KLPS +   +V+ R ++   + P ++ L QE++R  +++ ++  +L +L+ A+ G + M+ +L +   ++++ +IP+           +LG W      R+ Q+S+W+  G P   W++G    + +LTA+ Q   R   GW LD   L+  VT +  +DE+ + P +G YV GLYLEGA WD     L+ SK K L   LP++ +  I      E  R  L+N  + PVY    R +     L F A ++     T+   HW L+ V L
Sbjct: 1325 PFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLD-YQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQF-EGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPED------LSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIHNPDT--KFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH---TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAMRDPILFGDY-RTALSESE----------PRVYEDIQDYDACKALFQEILEEYNEN--KTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGH--SKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAH-SETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVM-------------RGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKN-VKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLE-KSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQP-FHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAF-DLDVI-RKKLGPDVSPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCR-RNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPI------EAHRLRLQNTLRTPVYTTSMRRNAMGVGLVFEADLF----TTEHHSHWVLQGVCL 4335          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2539.99 bits (6582), Expect = 0.000e+0
Identity = 1255/1970 (63.71%), Postives = 1560/1970 (79.19%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQ--SITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIR 6325
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+ VIG GHY   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS + LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK   V+ +   N+ L+   G   Q  ++  +    A ++ F +T +  Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+     V  L  RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDWAVPGVVRHDAQHIQFDLTFSTSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2021          

HSP 2 Score: 68.5514 bits (166), Expect = 2.947e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2534.21 bits (6567), Expect = 0.000e+0
Identity = 1257/1972 (63.74%), Postives = 1556/1972 (78.90%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSI----TRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIR 6325
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+ VIG GHY   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS + LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK   V+ +   N+ L+   G   Q I     R  S  A         +R Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+     V  L  RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDILSASLRTDSDPAVLTPVVTPASRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2023          

HSP 2 Score: 68.5514 bits (166), Expect = 2.826e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001365.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2514.18 bits (6515), Expect = 0.000e+0
Identity = 1260/1979 (63.67%), Postives = 1561/1979 (78.88%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFG-LRNIL-SVLRTLGQQK--RANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKI-SRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCF-QITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLL---NERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIR 6325
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G L NIL S++ +L      R           +R LR+  LS  +D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+ VIG GHY   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS + LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK  ++++     +  + GV     Q I    +F   +  F QIT++R Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+  +  V ++    +RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILENILLSLIHSLSDSVIIRHLTAKPWAKRTLRALRNTGLSTPIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKKEAKLLVTAYCDWAVPGVVRHDAQHIQFDLTFSTLFPVFTQITLSRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKRLCVCVIYTWGDRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2032          

HSP 2 Score: 68.5514 bits (166), Expect = 3.102e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2485.68 bits (6441), Expect = 0.000e+0
Identity = 1236/1919 (64.41%), Postives = 1508/1919 (78.58%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAE----SNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEK 6172
            +S  V+A+  S+ YNVPFK  IQ  V KLSN++EIIE WM VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE   ++ CCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDPHTIQ+HLL +FDN+  V FHEK YE IL+  S EGE++ L +PV A+     NVE WL  LL   + ++H VIR A   I D  F + EF   +PAQVGLL  Q++WTRDS  AL NAK+DRKIM  TN++FL LLN LI  TT DL K ER K+ETLITIHVHQKDIFD LV+  +KS +DF+WLKQ+RFYFVE+ D+C++ ITDVDF Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK ++ QFVFTDGD+V+M+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELE AI  Q   A ++ HPPWVLK+IQL+ETQRVRHGMM LGPSGAGKT CIH+LMKA+TDCGEPHREMRMNPKAITAPQMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+++ WL    + +  ++     + F D+  +    +  KM+ LE   ++QA +LL+GL+P  DE+   ++   H +RL +FS+MWS+GALLE+EDR ++EA++R++ +  LDLP    D  D++F+Y+V ++G W HWN++V E+ YP+D+ PEY +ILVPNVDNVRTDFLM  +  QEKAVLLIGEQGTAKTVMI  Y++  + E H+ KSLNFSSAT P MFQRT+ES+VDKRMG+TYGPPAGRKMT+FIDDINMP+INEWGDQI NEIVRQ +E  GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+     GH+C ER F   V  +   L+  TR+LWQ+TK KM PTP+KFHY+FNLRDLSRIWQG++   S+V  SS  LL L+ HEC RV++DR   + D  WF   +   + D              YFVDF+RDAPE   E  DD+    PK+YEP+PSF  L ERL  F   YNE+VRG+ ++LVFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT++R YN++N +EDLK +YR  G++ KG  F+FTDNEIKDE++LEY+NN+LASG ++ LF+++E+DEI   +   +KK  P+ P T ENLY YFL RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ WP++AL  VA H L ++ + C   VK  +VD +AV    V   C++YF ++RR   +T KSYLS+I  YK++Y    ++V+LL+ERM+ GL KL+EA++++  LS+ELE+KE+ L+VAS  A+ VL  VT +  AAE+VK +V+ VKDK  AIV++I  D+ VAE+KL AAKPAL+EAE AL TIKP DI TVRKL KPPHLI RIMDCVL+LF++++D  +P+ ER  ++ SW E+ KL+    FLNSLLTF +D INEE++DLL PY   EDY+LE AR  CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   LA AQ +L  A+  L EK+  L  V+  YDTA++ KQ L  DA  CR+KM+ A  L++GL  EK
Sbjct: 1557 DSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLLPEADER---RLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPS-HLDLPGSAND--DSIFEYVVGDSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHGTAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGEK 3468          

HSP 2 Score: 224.557 bits (571), Expect = 1.884e-58
Identity = 101/152 (66.45%), Postives = 127/152 (83.55%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            SV+GYY+ILW D+DIEKI+NEL +FQN+CRKLPK LK+W AFEDL+K ID+FN   PLLE+M N AM  RHW+R++++T H FD+ESD FAL+NI+EAPLL FK++IEDICISA KE+DI+AKLKAV +EWS+    F  FK+RGELLL+G 
Sbjct: 1395 SVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGS 1546          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001375.1 (pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2483.75 bits (6436), Expect = 0.000e+0
Identity = 1247/1983 (62.88%), Postives = 1543/1983 (77.81%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNL-----SKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKK--------------------LLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFR 6289
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T G      P  ++      V R + +     + L+D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+  +    +   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS ++                    LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK   V+ +   N+ L+   G   Q +  L           I + R Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+     V  L  RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCG------PPISDARDRYNVFRPLAVNAETKANLIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGSLANSRFIAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPEESTAVDLCPVIRPAPPDRPQLLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDM--LCDIDVRSANHTIYLLRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFR 2026          

HSP 2 Score: 68.5514 bits (166), Expect = 2.828e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 343.584 bits (880), Expect = 5.496e-101
Identity = 254/838 (30.31%), Postives = 427/838 (50.95%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGG-DIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEI--WLMGLLNMAQRSLHGVIRAANNSIND-TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFY----FVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTE----QTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIIS----HPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC-GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRT---LKGK-KGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPL 2893
            + + ++  Y   F++D  D+ SKL+  SEI   W+ VQ  W+ L  +     DI   LP E  +F ++   +  I +RA +    ++  +        L   ++ L++ + SL+ +LE++R  FPRF+F+ +  LL+I+G       +   +  +F +I+++ F E   + I    S+EGE L L + ++ + +++   WL  L    + S+    R     + D T+  V+  ++ Y  Q  LL  Q++WT    + L   +  +   +   +   LL  L             + K E L+  ++H  ++  QL     K  +   W K  +FY     ++D++   +S +     Y+ E++G  ERL+ TPL    + TL  +L    GG   GPAGTGKTETVK  G+ LG+ VVVFNC D  D++ L R+  G++Q G+WGCFDEFNR+D  VLS  +  I  + +  +  K      + +   ++P   +F+T+NPGY GR ELPENLK +FR  +M  P    I  + L   GF D+  LA K     +L   + +   HY FGLR +  VLR        +P  +E    + TV+  L+ + L  L D DE +F   ++ +F     D  G P    AI + + +A   S       ++ K +Q +  Q+ +  ++ +G +G GKT     ++ A+    G  +    ++ K +T   ++G +  +T +W DG+F+++ RR    + G  K   IW+V D  +D  ++E +NSVLDDNK LTL NG+R+P+ P+ +I+FE  N+D+ +PAT++R G+++ S+   D C +
Sbjct: 1412 LVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEV-IHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLE---DFITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVV--VSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNV------KKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEE-TPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRN------CSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIF-----DSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFST---DVCSI 2222          

HSP 2 Score: 45.0542 bits (105), Expect = 5.496e-101
Identity = 32/134 (23.88%), Postives = 63/134 (47.01%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRM-SDLTSHHFD---VESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEW 395
            V   ++  W  VD+  + ++L  F  R  +LP+ +K +  ++ L   ++   S+  +L  + + A+KPRHW  +  D+         ++   F+L++++   L   +  +  I   A KE  IE  L  +K  W
Sbjct: 1245 VQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFW 1378          

HSP 3 Score: 305.064 bits (780), Expect = 5.735e-83
Identity = 303/1344 (22.54%), Postives = 606/1344 (45.09%), Query Frame = 2
Query: 3362 ILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIE---SFVDKRMGSTYGPPAG-RKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGL---INTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIH-----QDVFSNCLKYF--NQYRR-SVQITQKSYLSYIDLYKTMYQTTKASVSLL--NERMQN-GLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFP---------RDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVEN-AIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSV--IDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQR-RIQHII 7288
            I++P +D ++ + +   + + ++ ++L G  G+ KT+++N  L  +N   +    +NFS  T        +    ++V    G T  P +  + + +F D+IN+P ++++G Q     +RQ +E +GF+   +   ++++  +H V A   P   GR  + ER  RH  I     P+  S+ +IY +     +     FRS            +  L+   K +   T  + HY+F+ R+L+R+ +G+   INT      + + L+RLW +E  R+ +DRL+   +   FE+ +   +D       +  PN+              +   +   +  +   ++ V   +L   ++ER   F     E      + +V     + H+++I R ++  +G+++L+G   +GK  +TR  +++      Q  I R  NL++F   LK        +   T  +  ++ I + ++LE +N +LA+  I  LF  EE D++L+ +  +  +       T++ LY +F+  +  NLH+V              +  PAL + C INW   W  + +  VA + +   P+   DF+  ++   L         +D   N L +F  N Y++  V +  +S   +ID  + + +   A    L  N+R  N GL+KL E+   +  L+K L  K   L+    EA + L  +  +   +E  +     +K       E IR  ++V  + +   +P + EA+  +  IK   ++ +R +  PP  ++ +M+ V  +   +              ++W +  + +   +F+++++ +          R  + EE +    P FT E   +  A K+CG    L  W  A   F  V   V PL+  +        K + +L +AE++  + E  + + K +Y   I+  +A++++ +  +  +  +  L+  L  EK RW   + +F      L+G+ ++ S + +Y G  N++ R  M    + ++    V  +     ++ L   ++  +W   GL  +   +EN +I++         +DP S     I N      ++ + F  + F + LE+A+  G  +II+D  E  DP ++ ++ + F   G  + V++GD EVD+   F L+I +   +P     I+ ++ V  + F    + +E ++  I +  E  E++  R  L+K  +  K K+K LE  LLE L N++G+++E+  L++ LN  K+ + ++  +++++ +   + +   EEY  I K    ++ ++      +  Y   + QFL+ F    I+  +     R R+  I+
Sbjct: 2390 IVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNAL--RNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPE-NKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKAIFKLVPEFRS----YTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPR--QTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVD-------KYLPNQDL----------GNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKTFCDEELE------VPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLR-NKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQF-------------SNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLS--DPNFTYET--INRASKACG---PLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLS-FLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHS--CDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEIL 3675          

HSP 4 Score: 66.2402 bits (160), Expect = 1.044e-10
Identity = 48/215 (22.33%), Postives = 100/215 (46.51%), Query Frame = 2
Query: 7859 AKKHHIQIGTISMGQGQEV-HSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVI---HDDFRLWVTTEIH-PKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWF 8488
            AK     +  I +G  + + +++  I+K+  EG W+LLQN  +SL +++  + + +E       H+ F++++T  +   K P   LQ + +F  E   GI   +K  + S  Q F    + +      + +++ H  +  R +  P G++  Y +N  D   +  +++N L   +    + W  +   +  I YGG++ ++ D  ++   C   F
Sbjct: 3804 AKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGS--QFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVL-ATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVF 4015          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 4012.22 bits (10404), Expect = 0.000e+0
Identity = 1958/3048 (64.24%), Postives = 2422/3048 (79.46%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFKK+IQ  V KLSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRF NIDK W+KIM+RAHEN NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ I+A  S EGE +E+ KPV A+ NVEIWL  LL M+++SLH VIR A  +IND+ FN+LEFLN +PAQVGLLGIQ++WTRD+TEAL NAK D+K+MQQTN  F  LLN+LI+QTT +L +V RTKFETLITIHVHQ+DIFD L +  +++PSDF+WLKQ RFYF +D D C V+ITDV FIYQNEFLGCTERLVITPLTDRCYITLAQAL MSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI ++L+ KKERKKQF+F+DGD+VDMNPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLASCGFIDNI L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E TTVMRVLRDMNLSKL+D+DEPLF+SLINDLFPGI LDK GYPELE AI  + +E  +I+HPPW LKLIQLFETQRVRHGMM LGPSGAGKT CIHVLMKA+TDCG PH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGE IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CKI+FE HNIDNASPATVSRNGMVYMSSS LDW P+++ W+ KR   E  I+   F  S+ ++  +  + L+ KM+ L+   + Q   LL+GLIP+KD  D  Q S  H E LY+FS+MWSIGALLE++DR K+E ++R N    LDLP++ ++  + +F++MV++ GEW HWN++VEEY+YPKD  P++ SILVPNVDNV  D+L+ TV+ Q KA LLIGEQGTAKTVMI  Y+S  +PE H+ KS NFSSA+ P +FQRTIESFVDKRMGSTYGPPAG+KMTVF+DDINMP+INEWGDQ+ NEIVRQ +E KGFY+L+KPGDF ++ D+ F++AMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+SVIG G++CKER F + V +   KL+  TRKLWQ TK KM PTP+KFHY+FNLRDLSRIWQG++NT ++VI+S + L+ LW HEC RV+SDR  ++ D  WFE+ ++  + D    +++   +   YFVDFLRDAPE   +  +D+ F  PKIYEP+PSF+ L+ERL+M+   YN+++RG+ ++LVFF DAM+H++++SR+IR  +GN LLVGVGGSGKQS+TRL+SFIA Y  FQIT+TR YN +N +EDLK +YR AG+  +G  F+FTDNEIKDE +LEY+NN+L+SG ++ LF+++E+DEI   +   MKK FP+ P T ENLY+YFL R + NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPK+AL+ VA H L  F +VC   +K ++V  + VIH  V + C  YF ++RR+  +T KSYLS+I+ YK++Y   +  +  L +RM  GL KL EA +++  LSKEL +KE+ L+VAS +A+ VL  V+ +  AAE VK +V+ VKDK  AIV++I VD+ VAE KL  AKPAL+EAE AL TIKP  ISTVRKL KPPHLI RIMDCVL+L  KK+DP + D ER  +K SW ESLKL++ ++FLN+LL F +D IN+E ++LL  Y   +DY++E A++ CG+VAGLC+WT+AM  F+ +N+EV+PLK +LA Q   L  AQ DL  A+  L EK+  L   +  Y+ A+K KQ L  DA  CR+KM  A+ L++GL  EK RWT QS EF  QIG LVGD++V + F+SY GPFNQ+FR  + S+W+  +++  +P    +++   + +   +GEWNLQGLPND+LSV+N IIVT+A+R+ L +DPQ QGK WI N+E ++ +  T+  +KYF+ HLEDAL+ G PL+IED+ EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT+KGLEDQLLG+VI  EK ELE+ R +LL+  S+NKRK+KELED+LL RL +T+GSLV+D++L+ VL+  K T+ +VS ++  AADTE +IN AREE+R ++ RGS+LYFLI ++S VN MYQ+ LKQFL LF  S+  S  SP   +RI +II  +T  +W +  R L++  +  FTLLLA K+D++N  ++  E   L+KGG++LDLK   PK  +WI DMTWLNLV LSKL  FS ++ QI  +EKQW+ WFDKDAPE+ +IP GY   LD F+KLLLIR WCPDRT+  AR+YI  ++G  + E V  ++     E+D +TPL+  LS+G+DPT +IE  AKKH      ISMGQGQEVH+R+++   MQ G W LLQNCHL L++M EL+D ++E+E IH+DFRLW+TTE H +FPI  LQMSIKFTNEPPQG++AG+KRTY   +QD LD+SN+ QWRPM+Y+VA+LH+ VQERRK+GPLGWNIPYE+N AD  AS+QFVQNHLDDMDIKKG+SW T+ YMLGE+QYGGRVTDD+DKRLLNTF + WF++ MF+P F F+K + IP  + + ++++ I+ L   DSPE+FGLH NADITYQS  A+  LD IL+IQPKD+S+GGGETRES+V++M DDML KLP DY+  EV  RLQ MG L PMNIFLRQE+DRMQ+VI  VR TL DLKLAIDGTIIM+E LRD+LD MYDARIP+ W KVSWESST+GFWFTELIERN+QF TW F GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL NDVT+  +D+I  PP+EGVYV+GL+L+GAGWDRR  KL+E  +KVLF P+PVI I AI+ S  G  +R     +YQCP+YKKPRRTDLT+IA V L+    +  DHW LR VALLCDIK
Sbjct: 1581 DSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKDYDRIMAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAFQELLNVLIEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAWINKRPIPEGEILNGFFEKSYEELLTFLRESLVSKMDILDHNYIIQTLTLLDGLIPKKD--DGGQFSSQHLEHLYVFSLMWSIGALLELDDRAKMETFMREN--FDLDLPQVSEN--ENIFEFMVNDAGEWAHWNTRVEEYVYPKDHVPDFLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGYFCKERGFINDVQDFALKLVPCTRKLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDYQPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVSIKAQAAEKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLMSNWQKEMKSRKIPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELSKLSQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKYDCRAISMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEFMLELIDTVVESEHIHEDFRLWMTTEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDVSNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHLDDMDIKKGVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNFYKGYVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGGGETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWESSTIGFWFTELIERNAQFRTWCFDGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAIN-STGGRDNR-----LYQCPIYKKPRRTDLTYIACVDLKT--NQNPDHWILRGVALLCDIK 4614          

HSP 2 Score: 237.269 bits (604), Expect = 6.320e-62
Identity = 110/153 (71.90%), Postives = 129/153 (84.31%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDILW DV+IEKI+ EL +FQNRCRKLP+ LKDW AF DL+KTIDDFN   PLLELM N AMK RHW R+++LT H FD+ESD F+LRNI+EAPLLK KE+IED+CI+AVKEKDIEAK+K V A+WS  +L F  FKNRGELLLRGD+
Sbjct: 1419 TVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFKNRGELLLRGDN 1571          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO32004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB3])

HSP 1 Score: 3365.47 bits (8725), Expect = 0.000e+0
Identity = 1649/2611 (63.16%), Postives = 2045/2611 (78.32%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQ 8260
            +S  V+ +  S+ YN PFKKDIQ  V KLSN+S+IIE WM VQNLWVYLEAVFVGGDIAKQLPKEAKRF NIDKSW+KIM+RAHE +NV+ CCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDN+KTV FHEK Y+ IL+  S EGE + LE  V A+ NVEIWL  LLN A  SLHGVIR A ++IND  F ++ F+N +PAQVGLLGIQ++WTRD+ EAL +A+ D+KIM  TN++FL LLN LI  TT +L K+ERTKFETL+TIHVHQ+DIFD LVK  ++S +DF+WLKQ+RFYF ED+D CIVSITDVDF YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ KK+RK QF+F+DGD+VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGFI+N++LA+KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+P D+E TTVMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELEAAI +  ++A +I HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI+VLMKA+ +CG+PHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGE+IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CK++FE HNIDNASPATVSRNGMVYMSSS +DW P+LK WL  R   E  +  +LF   F +++ Y  Q L  KM+ LE  V+ Q  D+L+GLIP K+E     +S  H  RL++F++MW +GALLE+EDR K+E ++  +   KLDLPK+ + S +T+F+++V   GEW HWN++VEE++YP DS P+Y SILVPNVDNVRT+FL++T+A Q KAVLLIGEQGTAKTVMI  Y+S+ NPE HM KS NFSSAT P +FQRTIES+VDKR+G+TYGPPAGRKMT FIDDINMP+INEWGDQI NEIVRQ +EMKGFY+L+KPG+F  ++D+ F+AAMIHPGGGRNDIPERLKR F IFNCTLP+  SID+I+ VIG G +C ER F S V +++ +L+  TR LWQ TK KM PTP+KFHY+FNLRDLSRIW+G++N   D I S K  L LW HE +RV++DR  +E D +WFE+ I   L D+   +         +FVDFLRDAPE   E  +D+    PKIYE VPS E L E+L M+   YN+TVRG  ++LVFF DAM+H+VK+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N ++DLK +YR AG + +G  F+FTDNEIKDE++LE++NN+L+SG ++ LF+++E+DEI   +   MKK  P+ P TQ+NLY YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPK+AL+ VA + L  F +VC   +K+K+V  + V+H  V   C++YF+++RR   +T KSYLS++D YKT+Y   K  +  L  RM+ GL KL EA  ++  LSKEL +KE++L+VAS +A+ VLA VT    AAE VK  V+ VKDK   IV++I  D+ VAE KL AAKPAL+EAE AL TIK  DISTVRKL KPPHLI RIMDCVL+LF++ I   +PD +R     SW E+ KL++S+ FL +L+ F +D INEE ++LLQPY   EDY+LE A+K CGNVAGLC+WT+AM  FY VN+EV+PLK +L  Q   L  A  DL  A+  L EK+  L  V+  YD A+  KQ L  DA  C+ KM  A+ L+NGL  EK RWT QS EF++QIG LVGD+++ + F+SY GPFNQ FR  + + W+  +  N +P  + +++   L++P  IGEWNLQGLP D LS++N IIV +A+RY L IDPQ+QGK W+LN+E  + +  T+  +KYF+ HLED+L+ G P++IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKE D+   F +YITTKL NP ++PEI A+T++IDF+VTMKGLE+QLLG VIN EKEELE  R +L++  ++NKRK+KELED+LL RL +T+GSLVED++L+ VL   K+T+ +VS ++A AA+TE +IN AREE+R ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+  SEKSP   +RIQ+II  +T  ++ +  R LY+  +  FTLLLALK+++++  V+ +E   L+KGG+ALDLK    KP KWI DMTWLNLV LSKL  FSG+++Q+  ++  WR WFDKDAPE+  IP GY+  LD F+KLLL+R WCPDRTL  AR+YI   +G+ + E V   + +   E+D KTPL+  LS+G+DPT  IE  AK+  I+   +SMGQGQEVH+RR+I ++   G WVLLQNCHL L++M+EL++ +  TE  H+ FR W+T E HP+FPIS LQ SIKFTNEPPQG+K G+KRTY    QD LDI+NM QW+P++YAVA+LHT VQ
Sbjct:  874 DSLMVLGSLLSNRYNAPFKKDIQSWVQKLSNTSDIIENWMVVQNLWVYLEAVFVGGDIAKQLPKEAKRFGNIDKSWVKIMTRAHETSNVVTCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNVKTVDFHEKDYDRILSIVSSEGETVPLETAVMAKGNVEIWLGDLLNQAMSSLHGVIRDAFHAINDPAFALMSFMNTFPAQVGLLGIQMIWTRDAEEALKHARHDKKIMASTNQKFLNLLNSLIDVTTQELTKMERTKFETLVTIHVHQRDIFDDLVKMHIRSVTDFEWLKQSRFYFKEDIDDCIVSITDVDFSYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTAKKDRKTQFIFSDGDVVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFIENVILAQKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPQDSESTTVMRVLRDMNLSKLVDEDEPLFLSLINDLFPGITLDKAGYPELEAAIQKNTEDAGLIFHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTACINVLMKAMGECGQPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGENIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKVVFEPHNIDNASPATVSRNGMVYMSSSVMDWKPILKAWLNSREPQEHDVFEQLFDCVFDELHTYMKQSLHPKMDVLECNVIAQCLDILQGLIPSKEEH--GILSASHLSRLFVFALMWGVGALLELEDRAKMEEFLVDHG--KLDLPKLAEGSHETIFEFVVDSKGEWEHWNNRVEEWVYPTDSKPDYASILVPNVDNVRTNFLVDTIAKQSKAVLLIGEQGTAKTVMIKGYMSTYNPELHMTKSSNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGRKMTAFIDDINMPIINEWGDQITNEIVRQLMEMKGFYNLEKPGEFTHIVDIQFLAAMIHPGGGRNDIPERLKRQFSIFNCTLPSNTSIDKIFGVIGCGWFCPER-FNSEVSDIIKQLVVCTRILWQQTKIKMLPTPAKFHYIFNLRDLSRIWEGMLNVTGDEIDSRKLALALWKHEVTRVIADRFTNEVDREWFEKQITKSLVDTVGDDAAGELMAEPFFVDFLRDAPEVTGEEPEDADLDAPKIYELVPSLEFLNEKLGMYMMMYNDTVRGGHLDLVFFKDAMIHLVKVSRIIRTPCGNALLVGVGGSGKQSLTRLASFIAGYKMFQITLTRSYNATNLMDDLKYLYRVAGSDGQGITFIFTDNEIKDEAFLEFLNNVLSSGEVSNLFARDELDEITQNLISVMKKELPRVPPTQDNLYNYFISRARKNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFTRWPKDALIAVADYFLSKFEIVCSAEIKQKVVQTMGVVHDMVAEACIEYFDRFRRQTHVTPKSYLSFLDGYKTIYAENKGHIGELANRMKTGLDKLVEATMSVNQLSKELVVKEKDLAVASVKADKVLAEVTVSAQAAEKVKASVQKVKDKAQIIVDEINADKVVAEGKLAAAKPALEEAEAALQTIKAADISTVRKLAKPPHLIMRIMDCVLLLFRRSISNVVPDFDRGCPTPSWGEAQKLMSSSGFLQALMNFQKDTINEETVELLQPYLEMEDYNLETAKKVCGNVAGLCSWTQAMSFFYGVNKEVLPLKANLIVQEARLKVAMGDLNKAQGQLDEKQAELDKVQAMYDAAVGEKQTLLDDAESCKNKMVAASALINGLGGEKERWTQQSKEFQAQIGRLVGDVLLATGFLSYSGPFNQTFRTLLSARWQQELEANKIPFTENLNLTSMLADPATIGEWNLQGLPTDDLSIQNGIIVNKATRYPLLIDPQTQGKAWLLNREKANDLQVTSLNHKYFRNHLEDSLSLGRPMLIEDVGEELDPALDNVLEKNFIKSGSTYKVKVGDKECDVMSGFTMYITTKLGNPAYTPEISARTAIIDFTVTMKGLEEQLLGRVINTEKEELEAERVKLMEDVTSNKRKMKELEDNLLYRLTSTKGSLVEDESLVAVLKITKETAEEVSEKLAIAAETETKINLAREEFRPVATRGSILYFLIVEMSMVNIMYQTSLRQFLGVFDMSMARSEKSPIPAKRIQNIIEFLTYEVFKYSCRGLYENHKFLFTLLLALKIEIQDGKVKNQEFQTLIKGGAALDLKACPAKPFKWITDMTWLNLVELSKLPQFSGILDQVRRNDSGWRGWFDKDAPEEHPIPDGYQTSLDTFRKLLLVRSWCPDRTLPQARKYIADAMGERYAEGVILNLEATWEESDTKTPLICFLSMGSDPTGSIESLAKRKGIECRAVSMGQGQEVHARRLIQQSCATGGWVLLQNCHLGLNFMDELLETVTNTENAHETFRTWITCEAHPQFPISLLQSSIKFTNEPPQGVKPGLKRTYAGITQDQLDITNMPQWKPILYAVAFLHTVVQ 3479          

HSP 2 Score: 229.95 bits (585), Expect = 9.190e-60
Identity = 107/151 (70.86%), Postives = 125/151 (82.78%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
             VNGYYDILW +VDIEKI+NEL +FQNRCRKLPK LK+W AF +L+K IDDFN   PLLELM N AMK RHW+R+++LT H FDVE++ F LRNI+EAPLLK KE+IEDICISAVKEKDIEAKL  V A+W + E  F +FKNRGELLL+G
Sbjct:  712 GVNGYYDILWTEVDIEKINNELLDFQNRCRKLPKALKEWDAFNELKKKIDDFNECCPLLELMANKAMKERHWERLANLTGHKFDVENENFLLRNIMEAPLLKHKEDIEDICISAVKEKDIEAKLSQVVADWKSQEFSFASFKNRGELLLKG 862          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO42024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L5])

HSP 1 Score: 3042.68 bits (7887), Expect = 0.000e+0
Identity = 1515/2382 (63.60%), Postives = 1879/2382 (78.88%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDD---SEVVEFRDPPNERTYFVDFLRDAPE-TVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIV 7561
            +S  V+ +  S+ YN PFK +IQ  V+KL+ S+EIIE W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRFS IDKSW+KIM RAHEN NV+QCCVGD+TL QLLPHLLEQLEICQKSL+GYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL VFDN+KTV F EK+Y+ ILA  S E E + LEKPV A+ NVE+WL  LL  A  SLH VIR A+  I D  F ++EFL+ YPAQVGLLG+Q++WTRD+ +AL +A+SD+KIM Q N+ FL +LN LI+ TT +L KVER KFET ITIHVHQ+DIFD LV+  +K+PSDF+WLKQ+RFY+ E+ D+C+VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGM+MGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERKKQF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLA+CGFI NIVL+ KF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KRANP D+E   VMRVLRDMNLSKLVD+DEPLF+SLI+DLFPG+QLDK GYP++E AI + ++EA +I+HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI++LMKA+T CG PH+E RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKG+HIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP+CK++FE HNIDNASPATVSRNGMVYMSSSALDW P+L+ WL  R+S E  I+  LF   F D+  +    ++ +ME LE   + QA +LL GLIP +D    +  S  H E+L+IFS+MWSIGALLE+ DR K++  + +  ++K   P +    +DT+F+Y+V++ G+W HW+ +VE Y YP DS PEY  ILVPNVDNVRTDFL+N +A QEKAVLLIGEQGTAKTVM   Y    +PE H+FK++NFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMT FIDDINMP+INEWGDQI NEIVRQ +EMKGFYSLDKPG+F S++D+ F++AMI PGGGRNDIP RLKR F +FNCTLP+ ASID+++S IG G++ K R F   V+NM+S L+  TRKLWQ TK KM PTP+KFHY+FNLRDLSRIWQG++   S+++ + K LL LW HEC RV++DR  ++ D  WFE+++   +++   +EV    DP     YFVDFLRDAPE T +   +D+ F  PK+YEPV +FE L ERL  F + YNETVRG  ++LVFF DAM H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N ++DLK +Y+ AG E KG  F+FTDNEIKDE++LEY+NN+LASG ++ LF+++E+DE+ + +   MK  +P+ P T ENLY YF+ RV++NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPK+AL+ VA + L  F + C+  VKE +V+ + + H  V   C +YF ++RR   +T KSYLS+I  YK +Y    + + LL  RM  GL KL EA E++  LS+EL IKE+ L+VAS +A+ VL  VT   TAAE VK++V+ VKDK  AIV++I  D+Q+AE KL AAKPAL+EAE AL TIKP  ISTVRKL KPPHLI RIMDCVL+LF KKIDP   D +R  VK SW ESLK+++   FL +LL FP+D INEE ++LL PY   EDY +E A+K CG+VAGL +WT+AM  FY +N+EV+PLK +L  Q   L KA  +L  A+  L EK++ L  V+ +YD A++ KQ L  DA  CR+KM+ A  L++GL  EK RWT QS +F+ QI  LVGD+++ + F+SY GPFNQ+FR  + S W+  +R   +P ++ I++   L++   IGEWNLQGLPND+LS++N IIVT+ASRY L IDPQ QGK WI  KE  + +  T+  +KYF+ H+EDAL+ G PLIIED+ EELDPAL+N+LEKNFIK G   KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R +L+++ + NKR++K+LED+LL RL +T+GSLVED++L+ VL+  K TS +VS ++  AA+TE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ LKQFL +F  S+  S+KSP   +RIQ+II  +T  ++ +  R  Y+  +  FTLLL LK+D++   ++ EE  VL+KGG+ALDL  ++PKP KWI+D+TWLNLV LSKL  F+ ++ Q++
Sbjct: 1547 DSLMVLGSLLSNRYNAPFKAEIQKWVAKLTGSTEIIENWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFSQIDKSWVKIMQRAHENANVVQCCVGDDTLGQLLPHLLEQLEICQKSLSGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLGVFDNVKTVTFDEKEYDKILAINSRENEQIMLEKPVVAQGNVELWLFALLKEAMNSLHAVIRMASVGIKDPSFKLIEFLDAYPAQVGLLGLQMIWTRDAEDALSSARSDKKIMAQRNQYFLDMLNELIEVTTRELTKVERIKFETFITIHVHQRDIFDDLVRKNIKTPSDFEWLKQSRFYWREETDQCLVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMAMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKKQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKLAACGFIRNIVLSAKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRANPEDSEDRIVMRVLRDMNLSKLVDEDEPLFLSLIDDLFPGLQLDKAGYPDIEQAIAQCVEEAKLINHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTKCINILMKAMTICGAPHKEFRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGDHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPTCKVVFEPHNIDNASPATVSRNGMVYMSSSALDWKPILQSWLKTRSSTESEILFNLFEQLFDDVQNFLTVSVVPRMELLECNYIVQASNLLNGLIPGEDAPKQADAS--HLEKLFIFSIMWSIGALLELSDRKKVKFMMETFPDLK--WPPV--SGQDTIFEYVVNDQGDWQHWSERVEAYDYPTDSVPEYSGILVPNVDNVRTDFLINCIAKQEKAVLLIGEQGTAKTVMTKGYCERYDPELHVFKAMNFSSATTPNMFQRTIESYVDKRMGTTYGPPAGKKMTSFIDDINMPIINEWGDQITNEIVRQLMEMKGFYSLDKPGEFTSIVDIQFISAMIQPGGGRNDIPSRLKRQFTVFNCTLPSNASIDKVFSTIGCGYFHKARGFPVEVVNMISPLVASTRKLWQKTKVKMLPTPAKFHYIFNLRDLSRIWQGMLVVTSEILKTPKVLLNLWKHECHRVIADRFTNQPDRDWFEKSLMAVVEEDFGAEVSAMIDP---EPYFVDFLRDAPEPTGKSHPEDAEFEAPKVYEPVETFESLNERLDSFVEMYNETVRGGRMDLVFFKDAMTHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSYNVSNLMDDLKVLYKTAGHEGKGITFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEMTNDLISVMKAEYPRRPPTNENLYDYFITRVKNNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVASYFLSSFDVKCKPEVKEAMVNTMGIFHDTVAEFCTQYFERFRRQTHVTPKSYLSFISGYKQIYSQQHSDIDLLATRMNTGLAKLVEATESVAKLSEELVIKEKELAVASRKADVVLQEVTVSATAAEKVKSQVQKVKDKAQAIVDEIAEDKQIAEGKLEAAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLFMKKIDPVQQDPDRPCVKPSWGESLKVMSQGGFLTTLLNFPKDTINEETVELLAPYLEMEDYTMENAKKVCGDVAGLASWTRAMAIFYGINKEVLPLKANLVIQEARLNKATTELNVAQAQLDEKQKELDAVQAKYDQAMRDKQTLVDDAEACRRKMANATALIDGLGGEKIRWTEQSKKFDQQIQRLVGDVLLATGFLSYSGPFNQEFRNLLQSTWKKDMRKAKIPFSEDINLTNMLTDAATIGEWNLQGLPNDELSIQNGIIVTKASRYPLLIDPQGQGKAWIRTKEQPNELQITSLNHKYFRNHMEDALSLGRPLIIEDVGEELDPALDNILEKNFIKSGKTYKVKVGDKEVDVMDGFRLYITTKLGNPSYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEAERTKLMEEVTANKRRMKDLEDNLLYRLTSTQGSLVEDESLIEVLSSTKATSEEVSEKLIVAAETELKINTAREEYRPVANRGSILYFLIVEMSYVNVMYQTSLKQFLGVFDISMARSQKSPIPAKRIQNIIDYLTFEVFRYTTRGFYEEHKFLFTLLLTLKIDLQEKKIKHEEFQVLIKGGAALDLNAVEPKPKKWILDLTWLNLVELSKLPQFTSILGQVI 3919          

HSP 2 Score: 209.92 bits (533), Expect = 1.063e-53
Identity = 99/151 (65.56%), Postives = 117/151 (77.48%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            +VNGYYDILW ++DIEKI+ EL +FQNR RKLPKGLK+W AF +L+KTIDDF+   PLLE+M N AMK RHW R+S +     DVES+ F LR ++ APLL  KEEIEDICI+AVKEKDIE+KLK V  EWSA    F  FKNRGELLL+G
Sbjct: 1385 NVNGYYDILWQEIDIEKINQELLDFQNRIRKLPKGLKEWQAFLELKKTIDDFSECCPLLEMMANKAMKERHWGRISQMVGVTLDVESETFQLRQLMSAPLLPNKEEIEDICIAAVKEKDIESKLKGVIGEWSAQSFSFAGFKNRGELLLKG 1535          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 1819.28 bits (4711), Expect = 0.000e+0
Identity = 1104/3081 (35.83%), Postives = 1718/3081 (55.76%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAA-NNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK-SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKR-NSNERPIMLELFTNSFPDIYRYSIQYLI-----YKMETLEAF----VVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDL-------PKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLD----DSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMF-SHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLK-VKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKL--HVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI---QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNH----LDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND---DMFNPKFRFFK----DHSIPAVSK------LNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTK-HMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVY-LRCPPTKQADHWTLRAVAL 9556
            PF + +      LS+  E++E WM VQ  W+YLE++F+GGDI  QLP+EA++F +IDK++ KIM+   +N  VL+ C     L QL   +    + CQKSL  YL+ KR  FPRFFF+SD  LL ILG + DP  +Q H++ +FDNI +++F E   +  LA    S EGE+++  + V AE  VE W+  +L   +R+   + + A  N  N  +   +E++  Y   V L G Q+ WT +  +     K  D+  M+    +    ++ L+ +  ++L K +R KF T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D  ++     +F Y  E++G   RLVITPLTDR Y+T+ QAL M +GGAPAGPAGTGKTET KD+ + LG   VV NC + MDF+ +G+IF GL+Q G+WGCFDEFNRID+ VLSV + QI  + +      K+  F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V  +VPD Q I  + L S GF+   VLA+K   LYKL   QL+KQ HYDFGLR + +VL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI DLFPG+   +  YP    A+   + +   I  P    K++Q++ET   RH  M +GP+G GKT  I+ L  A T  G   +   MN KA T  +++G LD  T DWTDG+ S ++R   K   K E  ++V DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMVY+    L + P  + W   R N+ ER  +  LF    P      ++ ++      K++T+       +V Q   +L+ L+P  +   S+ +     E ++I S++WS GA L  + R   +  I+    I  +        P     ++ T+++Y   S+   WV W   V EY++  D   +Y  ILVP VD VRT +L+  + +  + VLL+GE GT+KT     YL   + +  +  ++NFSS T     Q  +E+ V+KR   TYGPP G+++ VF+DD+NMP ++E+G Q    +++  +E  G Y   K   + +V D+ FVAAM  PGGGRN++  R    F +FN T P+  S+ RIYS I  GH    + F  ++ ++V  +   T +L+ +    + PTPSKFHY+FNLRDLSR++QGL  T  D   S  K +R+W +EC RV  DRL +E+D +     I   +D    +   +  RDP      F D+     E             P++YE V  ++  K       + YN  +  +P+NLV F DA+ H+ +I RVIRM +G+ LLVGVGGSGKQS+T+LA+F A    F+IT+TR Y+ N+F EDLK +Y   G ENK  VF+FTD  +  E +LE INNML SGM+  L+  +E + I+  V  +  K     P  +E+++QYF+++  +NLH+VL  SP+G+  R R   FP L          K P                    D  +E +VD +  +HQ V +    +  + RR    T K+YL +I  Y  + +     V     R++ GL KL  A E +  L+++L +++  ++  S   E +L  + + T  A   K      K + A   + I V++  AEE L AA PAL+EA+ AL  +  +D++ +R   KPP  +Q + +C++ L             R   + SW  +  +++  NFL SL     D I    +   +      +  +E  ++     AGL  +  A+  +  V RE+ P ++ +A        ++ +L+  EK L   EE L  +  +YD A++ K +L+ +A +  +++  A++L++GL  EK RWT    + + Q   L+GD ++ +AF+SY G F   FR  M    WE+ +    +P++K   +   L+N  ++ +W  +GLP D LS+EN I+ TQASRY L IDPQ Q  +WI  KE ++++    F +  F + LE A+  G P++ +D+ E +DP ++NVL+KN IK   G + V +GDKEVD    F LY+ TKLSNP ++P  +++  V++++VTMKGLEDQLL +++ +E++ELE  R +L+++TS NKR +K+LED+LL  LA ++G+++++  L+  L   K  + +VS ++   A T  +I++ R+ YR  +K G++L+F+++++S VN MYQ  L  +L +F  S+ +S     + +R+++I+  +T+N++N+    L++  +  F+  + +K+   +  ++QEEL+  LKG  AL+ K+   KP  W+ D  W +++ L ++   VF  L + I  +EK WR W D DAPE    P  YE  L +F++LLL+RC+  DR  +    ++   +G+ ++        S+  ++   +P++ +LS G+DP   +   A++      ++  ++MGQGQE  + +++  A+  G W++LQNCHL + ++  L   +      H DFRLW+TT+  P+FPI  LQ S+K   EPP G+K  ++ TY   +   L       + P+V+ + + H  VQERRK+G +GWNI Y++N +D    +  +  +    L + D+K  + W ++ Y++GE+ YGGRV DD+D+R++ T+   +  D   D F P F F+     D+ IP   +       + Y+D I ELP  ++P++FGLH NA+I Y +  A+ +   ++ +QP+ A   GG +RE  + ++  D+ GKLP     F+V    + +  + P  + L QE+DR   +I ++ T+LI+L+ A+ G + M+ +L +   S+++  IP+           +LG W     +R  Q++ W+  G P   W++G      +LTA+ Q   R H GW LD   L+  VTK H  DE+ +    G +V GLYLEGA WD   S L   K KVL E LPV+ +  I      E  R  L+N ++ PVY   +R +   +  V+      T+   HW L+ V L
Sbjct: 1312 PFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEK-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCN--QITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQF-EGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAE--SSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDL--KYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHL---QPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIAMRDP----CLFGDYRNTLTED------------PRLYEDVVDYDATKAIFEEILEEYN--MDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANK--AGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGLND--------KIP--------------------DQYRETVVDHVVFVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVAL-------------RGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKN-IKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALE-KSSRQKPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYLTKSLQNTDVK--IPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQP-FHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSGGISREEFITKIASDIQGKLPP---LFDVDRVRKNLSEITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGEPAVIWLSGLHIPDSYLTALVQATCRKH-GWPLDRSTLYTTVTKYHNADEVTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPI------ESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHWVLQGVCL 4304          

HSP 2 Score: 81.6481 bits (200), Expect = 6.952e-15
Identity = 38/135 (28.15%), Postives = 72/135 (53.33%), Query Frame = 3
Query:   21 DILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTF 425
            + LW ++D+  +S+ +  +  + ++LP+ +K  P    L + + +F + +PL   + N A++ RHW+++ D+T   FD+  + F L+N+    L  F + I DI  SA KE  IE  +  V   W+A +     +
Sbjct: 1139 NTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKY 1273          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 1761.89 bits (4562), Expect = 0.000e+0
Identity = 1056/3078 (34.31%), Postives = 1713/3078 (55.65%), Query Frame = 2
Query:  479 FKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGG-DIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETI----LACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLE-FLNMYPAQVGLLGIQLLWTRDSTEALVNAKSD-RKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETL-EAFVVRQACDLLEGLI-PRKDEKDSSQISRIHYERLYIFSVMWSIGALL----EIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD-----PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAI-----ILLSKELEIKERXXXXXX--XXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTN-FLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVI--RNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQ-----LLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGT-----ISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIE-TEVIHDDFRLWVTTEIHPK-----FPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDI-SNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGG--ETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFK-GRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALL 9559
            F +++     KLS +  +I  W  VQ  W +LE++F+G  DI  QLP+++KRF  ID  + ++ +   +  NV++CC     L + L +L E+L +C+K+L  YLE KRL FPRF+FVS   LL+IL   + P  +  HL  +FDN+  +KF E     +    +  YS EGE +E +     +  VEIWL  +++   R    V +  + S+   E    E +L  +PAQV L G Q+ WT +   A    +      ++   ++ +  L+ LI     DL K +R K  T+ TI VH +D+  +L++ KV S   F WL Q R  + +    C  +I D  F Y  E+LG T RLVITPLTDRCYITL Q+L ++M GAPAGPAGTGKTET KD+GR LG  V VFNCS+QMD++  G I+KGLSQ+G+WGCFDEFNRI + VLSV A Q+  +    +++K++F+F   D+  + P  G+F+TMNPGYAGR ELPENLK  FR  AM+VPD ++I  + L + GF++   LARKF TLY LC+E L+KQ HYD+GLR I SVL   G  KR++    E   +MR LRD N+ K+V  D P+F+ LI DLFP + + +   P+ EA + + + +  +     ++LK++QL E   VRH +  LGP+G GKT  I  L K   +         +NPKA+TA ++FG ++ +T +W DG+FST+ R           W+VLDG +D +WIE+LN+V+DDNK LTLA+ +R+P++PS +++FE+ ++  A+PATVSR G+++++ + + W P +  W+  R        L++  + +  +    ++    K+  + +  +V   C LLE L+ P     D    ++  YE  ++F+ +W+ G  +     ++ R +   +  +      +   I+  S  T+FDY + SE  ++V W  KV++  +  D      ++LV   +  R  F M+ +    + V+L+G  GT KTV++N Y  S +P+  M  ++ F+  T   M Q+ +E  ++K+ G  YGPP  +K+  FIDD+NMP+++ +G    + ++RQ ++   ++   K      + +  ++A M +P  G   I  RL+RHF +F  + P   ++  IY  I  GH  K  +F S+V     K+      + Q   +   PT  KFHYVFNLRDLS I+QG++    + I +     RLW+HEC+RV  D+LID+ D++ F++ I+  +      E  +      PN  ++F                 S    PK Y  VP +E+L + L+   ++YNE    + +NLV F DAM HV +I+R++   +GN LLVGVGGSGKQS+ RLA+FI+    FQIT+ + Y + +   DL ++   AG +N GTVF+ TD ++ +E++L  IN++LASG I GL+  +E++ I+S V  ++K        T+EN + +F++RVR NL +VLCFSP+G   R R+  FPA+T+   I+WF +WP+EALV+V++  + D   +  ++ K  + + ++ +H  V      Y    RR    T KS+L  I+LY+ + +     ++   ER++NGL KL+   + +      L S+E+E+K++N        +       V+K+   A+  + KV+        I + +   Q+  EE L  A+PAL  A++ALNT+   +++ ++    PP  +  +   V++L        IP         SW  +  ++   + FL+ L+ + ++ I+E  +  +QPY    ++  +  +       G+CAW   + +FY++  +V P +  L + N  LA A++ L   +  + E +E LA +   ++ A   K   + +A    K +  AN+L+ GL  E  RW      F+ Q   L GD+++ +AFVSY G F +++R  + +  W   +  +N  +PI + +D +  L++   I  WN + LP D++S ENA I+T   R+ L IDPQ QG  WI  +E  + +       K +   +E A++NG  ++IE++ E +DP L+ ++ +N IK G    +K+GDKEV+ H  F + + TKL+NPH+ PE+ A+T++I+F+VT +GLEDQLL  V++ E+ +LE ++       L +Q +    K+KELEDSLL RL+   G+ + D  L+  L   K+T+ ++ +Q+ +A  TE +IN ARE YR  + R SLLYF++ DL+ +NPMYQ  LK F  +F  +I  +E +  ++ R+ ++I C+T +++ +  R L++ D+  FT  +A +V +    +   EL+ LL+  + +++ +    P+ ++ +++W  + ALS +  F  L   I  S K+W+ + + + PE E  P  ++      +KL ++R   PDR       ++   LG  ++ED P        E+   TP+  +LS G DP   +E H KK            +S+GQGQE+ + + +  A +EG WV+LQN HL  +++ +L  ++   +E  + D+R++++ E          P   L+ SIK TNEPP G+ A + +   +FNQD L++ +   +++ +++++ Y H  V ERRKFGP GWN  Y +NT DL  S+  + N+L   +    + W  + Y+ GEI YGG +TDD+D+RL  T+   +   +M   +        +P  S    Y   I+E    +SP ++GLH NA+I + + T+ ++   +L +QP+DA  G G  +TRE  V ++ DD+  KLP ++   E+M R++      P  +   QE +RM  +  +++T+L  L L + G + +  ++ D  ++++   +P S   +       L  WF +L+ R  +   W      PN  W++GFFN Q FLTA+ Q + R ++ W LD + L  DVTK  +++ N PP EG YV+GL++EGA WD +   + +SK K L   +PV+ I+AI + K+        KN+Y+CPVYK  R+   T++ + +L+    +    WTL  VALL
Sbjct: 1472 FLEEVTSWQKKLSTADSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDVDFKELTNEGAKIPNVVECC-NRPGLFEKLENLQERLSLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPVEVARHLSKLFDNMARLKFKEDDAGNVTKDAVGMYSKEGEYVEFDSVCDCDGQVEIWLNRVMD---RMRATVRKEQSESVVSYEEKPREQWLFDFPAQVALCGTQIWWTTEVGIAFGRLEEGYENAIKDYYKKQVSQLSTLINMLIGDLSKGDRQKIMTICTIDVHARDVVAKLIQQKVDSAQAFLWLSQLRHRWDDQQSHCFANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVIAVQVKSIQDAIRDKKERFIFQGEDIC-LVPTVGLFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARALARKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRDPDFEALVKKSVTDLKLQPEDSFILKIVQLEELLAVRHSVFVLGPAGTGKTQVIRSLNKTYMNQKRKPMMFDLNPKAVTADELFGFINPATREWKDGLFSTIMRDLSNIASDSPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERVPLTPSMRLLFEIGHLKTATPATVSRAGILFLNFADVGWNPYVSSWIDTREVQSEKANLQILFDKYVPVCLDLLRVRFKKITPIPDITMVTTLCYLLECLLTPANTPPDC---NKELYELYFVFAAVWAFGGAMFQDQLVDYRTEFSKWWVT------EFKTIKFPSAGTVFDYYIDSETKKFVPWTDKVQK--FELDPEVPLQAVLVHTAETTRVRFFMDLLMENRRPVMLVGGAGTGKTVLVNDYFQSLDPDVSMVGNVPFNYYTTSAMLQQVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPMVDTYGTVQPHTLIRQHLDYSHWFDRTKLT-LKDIRNTQYIACM-NPTAGSFTINPRLQRHFAVFAISFPGLDALKTIYLSILNGH-MKVHNFASAVSKFTEKVTDAALAMNQKVTSTFLPTAIKFHYVFNLRDLSNIFQGILFATHECIKTPVDFARLWMHECNRVYRDKLIDDKDMEVFDK-IQIDMTKKFFEELDEEAMYAKPNMFSHF----------------SSGIGEPK-YLAVPDWEVLSKLLTEALENYNEV--NAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDEVENIISGVRNEVKG--AGLQDTRENCWMFFIERVRRNLKVVLCFSPVGATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLEQLEAEY-KPPVAEFMSYVHTSVNEESQMYLANERRYNYTTPKSFLEQINLYRNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKVGVETEKVSKEKAIADDEEKKVQV-------IAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLAPA--NKIPKDR------SWKAAKIMMGKVDAFLDQLINYDKENIHESNLKAVQPYLDNPEFEPDFIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKWLVFLASQNPKIPITEGLDPLSLLTDNATIATWNNENLPADRMSTENATILTNCERWPLMIDPQLQGVKWIKTREG-NDLRIVRLGQKGYLDTIERAVSNGECVLIENMGENVDPVLDALIGRNTIKKGRA--IKMGDKEVEYHADFRMILHTKLANPHYKPEMQAQTTLINFTVTREGLEDQLLADVVSKERPDLEETKASDRIFPLTQQQNAFTIKLKELEDSLLARLSAAGGNFLGDYALVENLEITKRTAAEIEVQVTEAKQTEIKINDAREAYRPAAARASLLYFILNDLNKINPMYQFSLKAFSVVFQKAIERAEPAEEVKARVVNLIDCITYSVFIYTTRGLFEKDKIIFTAQVAFQVLLMKKEIIPHELDFLLRFPAVMNVTS----PVDFLSNLSWGGIKALSNMEEFRNLDRDIEGSAKRWKKFAESECPEKEKFPQEWKNKT-ALQKLCMMRALRPDRMTYAVSNFVEEKLGHKYVEDAPTPFAMSFEESGPATPIFFILSPGVDPLKDVEAHGKKIGFTFDAKNFHNVSLGQGQEIVAEQCLDLAAKEGHWVILQNVHLVKNWLPKLEKKLEAFSEGSNPDYRVYISAEPAGTPDAHIIPQGILETSIKITNEPPTGMMANLHKALNNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVDVLYNYL---EANAKVPWTDLRYLFGEIMYGGHITDDWDRRLCKTYLEEYMKPEMLEGELNLAPGFPLPPNSDFKGYHLYIDETLPPESPYLYGLHPNAEIGFLTTTSDNLFRTLLEMQPRDAGGGEGASQTREEKVKQVLDDIFEKLPEEFNVPEMMARVEDR---TPYTVVAFQECERMNMLTNEMKTSLKQLDLGLKGELTITSEMEDLSNALFLDDVPESWTRRAYPSMFGLAAWFVDLLLRIKELEQWTSDFCLPNVVWLSGFFNPQSFLTAIEQSMARKNE-WPLDKMALQVDVTKKNKEDFNSPPREGAYVHGLFMEGARWDTQTGMIADSKLKDLTPAMPVMFIRAIPVDKQD------TKNVYECPVYKT-RQRGPTYVWNFFLKT--RENPSKWTLAGVALL 4468          

HSP 2 Score: 67.0106 bits (162), Expect = 1.917e-10
Identity = 41/135 (30.37%), Postives = 64/135 (47.41%), Query Frame = 3
Query:   30 WGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSA----HELHFGT 422
            W ++D+E +  E   F    R L K ++ W  F  L  T+ +  + +  +  + NPA++ RHWQ++   T   F V  D   L ++L   L  F++E+  I   A KE  +E  LK +   WS     HE H  T
Sbjct: 1304 WAEIDVENMEMECKRFVKEIRSLDKEMRAWDGFTGLDSTVKNMVTSLRAVGELQNPAIRERHWQQLMQATKVKF-VMDDDTTLADLLALNLHNFEDEVRGIVDKATKELGMEKVLKELDVTWSQMEFEHEEHVRT 1437          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3904.75 bits (10125), Expect = 0.000e+0
Identity = 1924/3051 (63.06%), Postives = 2402/3051 (78.73%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFR---DPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+ +  S+ YN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTDRCYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQ +E KGFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GH+C +R F   V   + +L+ LTR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++ T ++VI+S   LL LW HEC RV++DR     D++WF++ +   ++     E +   D   ER YFVDFLRD PE   E  ++S F +PK+YEP+ SFE LK+RL+MF   YN+++RG+ +++VFF DAM+H++K+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR+YN  N +EDLKS+YR AG + KG  F++TDNEIK+ES+LEY+NN+L+SG ++ LF++ EMDEILS +   MK+ FP+ P T ENLY YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+ H L  F + C   VK ++V  +      V   C+ YF +YRRS  +T KSYLS+I  YKT+Y   +A V      M  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  A+E VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PP LI + MDCVL+L +++++P   + E   + +SW ESL L+ S +FL+ L  FP+D INEE ++LLQPYF   +Y++E AR +  NVAGL +WTKAM  F+ +N+EV+PLK +LA Q   LA A  DL+ A+  L  K+  L +V+ EY+ A+  K  L  DA  CR+KM  A+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +DI E L + + + EWNLQGLPND+LS+ N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLE++L+ G PL+IED+ EELDP L+NVLEKNFIK G+  KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT++GLEDQLLG VI  EK E+E  R  LL+  + NKRK+KELED+LL RL +T+GSLV+D++L++VL   KQT+ +V+ ++  A DT+ +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  S KS     RI+ II  MT  ++ +  R LY+  +  FTLLL LK+DM+  +V  +E   L+KGG++LDLKT   KP +WI+DM+WLNLV LSKL  FS +++QI   EK W++WFDK+APE+E +P  Y++ LD F++LLLIRCWCPDRT+  AR+YI   +G+ + E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL L++M+ELMD +IETE I+D FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD+SN  QW+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD K+ +SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WFN +MF   F F+K + IP  S +++Y+  I  LP YD+PE+FGLH NADIT+QSK A+ +LD IL+IQPKD+S+GGGETRE+ V RM DDML KLP DY+ FEV +RLQ MG L+PMNIFLRQE+DRMQ+VI  VR+TLIDLKLAIDGTIIM+E+LRDALD MYDARIP +    SW SSTLGFWFTEL+ERN QF TWLFKGRPNCFWMTGFFN QGFLTAM+QE+ RA+KGWALD +VL N+VTK M+D+I  PP++GVYVYGLYLEGA WDR N +L ESK KVLFE +PVI + A     E  + +D    +Y CP+YKKP RTD+  IASV L+   T+  +HW LR VALLCD+K
Sbjct: 1084 DSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVER-YFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEV------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIP-ARWMKSWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-----ENNVVKD--PRLYSCPIYKKPTRTDINCIASVGLKT--TQPPEHWVLRGVALLCDVK 4113          

HSP 2 Score: 213.772 bits (543), Expect = 1.906e-54
Identity = 99/152 (65.13%), Postives = 122/152 (80.26%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYDILW +++IEKI+NEL +FQ RCRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++++T H+ DVES+ F LRNI+EA  LK+KEEIEDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD
Sbjct:  922 TVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGD 1073          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3588.89 bits (9305), Expect = 0.000e+0
Identity = 1822/3043 (59.88%), Postives = 2272/3043 (74.66%), Query Frame = 2
Query:  467 YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFR---DPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVS-SEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLI-MARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFE--VMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            YN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLT YLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTD                           ET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFK L+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KK EHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+    WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQ +E KGFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GH+C +R F   V   + +L+ LTR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++ T ++VI+S   LL LW HEC RV++DR     D++WF++ +   ++     E +   D   ER YFVDFLRD      E  ++S F +PK+YEP+ SFE LK+RL+MF   YN+++RG+ +++VFF DAM+H++K+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+T +YN  N +EDLKS+YR AG + KG  F++TDNEIK+ES+LEY+NN+L+SG ++ LF++ EMDEILS +   MK+ FP+ P T ENLY YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV  + H L  F + C   VK ++V  +      V   C+ YF                                      M  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  A+E VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PP LI + MDCVL+L +++++P   + E   + +SW ESL L+ S +FL+ L  FP+D INEE ++LLQPYF   +Y++E AR +  NVAGL +WTKAM  F+ +N+EV+PLK +LA Q   LA A  DL+ A+  L  K+  L +V+ EY+ A+  K  L  DA  CR+KM  A+ L++GL  EK RWT QS EF +Q   LV D+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +DI E L + + + EWNLQ                                              T+  +KYF+ HLE++L+ G PL+IED+ EELDP L+NVLEKNFIK G+  KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT++GLEDQLLG VI  EK                                     SLV+D++L++VL   KQT+ +V+ ++  A DT+ +IN AREEYR  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S + S KS     RI+ II  MT  ++ +  R LY+  +  FTLLL LK+DM+  +V  +E   L+KG S LDLKT   KP +WI+DM+WLNLV LSKL  FS +++Q +S  EK W++WFDK+APE+E +P  Y++ LD F++LLLIRCWCPDRT+   AR+YI   +G+ + E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL L++M+ELMD +IETE I+D FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD+SN  QW+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD K+ +SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WFN +MF   F F+K + IP  S +++Y+  I  LP YD+PE+FGLH NADIT+QSK A+ +LD IL+IQPKD+S+GGGETRE+ V RM DDML KLP DY+ FE  V ERLQ MG L+PMNIFLRQE+DRMQ+VI  VR+TLIDLKLAIDGTIIM+E+LRDALD MYDARIP+    + SW SSTLGFWFTEL+ERN QF TWLFKGRPNCFWMTGFFN QGFLTAM+QE+ RA+KGWALD +VL N+VTK M+D+I  PP++GVYVYGLYLEGA WDR N +L ESK KVLFE +PVI + A +  K+          +Y CP+YKKP RTD+  IASV L+   T+  +HW LR VALLCD+K
Sbjct: 1292 YNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEK-YDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT-CGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKK-EHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE-HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVER-YFVDFLRDP-PEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLT-LYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYF--------------------------------------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQ---------------------------------------------ITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKR------------------------------------SLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLS-LASSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGAS-LDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY-GINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVKD--------PRLYSCPIYKKPTRTDINCIASVGLKT--TQPPEHWVLRGVALLCDVK 4159          

HSP 2 Score: 153.295 bits (386), Expect = 3.409e-36
Identity = 79/152 (51.97%), Postives = 96/152 (63.16%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYDILW +++IEKI+NEL +FQ  CRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++                               EDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD
Sbjct: 1150 TVNGYYDILWTNINIEKINNELLDFQT-CRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRIT-------------------------------EDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGD 1269          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3407.08 bits (8833), Expect = 0.000e+0
Identity = 1663/2689 (61.84%), Postives = 2098/2689 (78.02%), Query Frame = 2
Query: 1535 TPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKK-----LLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFR---DPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKN--MYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            T L   CYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K     +Q    H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQ +E KGFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GH+C +R F   V   + +L+ LTR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++ T      SS+      LL LW HEC RV++DR     D++WF++ +   ++     E +   D   ER YFVDFLRD PE   E  ++S F +PK+YEP+ SFE LK+RL+MF   YN+++RG+ +++VFF DAM+H++K+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR   L   +  LKS+YR AG + KG  F++TDNEIK+ES+LEY+NN+L+SG ++ LF++ EMDEILS +   MK+ FP+ P T ENLY YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+ H L  F + C   VK ++V  +      V   C+ YF +YRRS  +T KSYLS+I  YKT+Y   +A V +L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  A+E VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PP LI + MDCVL+L +++++P   + E   + +SW ESL L+ S +FL+ L  FP+D INEE ++LLQPYF   +Y++E AR +  NVAGL +WTKAM  F+ +N+EV+PLK +LA Q   LA A  DL+ A+  L  K+  L +V+ EY+ A+  K  L  DA  CR+KM  A+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +DI E L + + + EWNLQGLPND+LS+ N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLE++L+ G PL+IED+ EELDP L+NVLEKNFIK G+  KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT++GLEDQLLG VI  EK E+E  R  LL+  + NKRK+KELED+LL RL +T+GSLV+D++L++VL   KQT+ +V+ ++  A DT+ +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  S KS     RI+ II  MT  ++ +  R LY+  +  FTLLL LK+DM+  +V  +E   L+KGG++LDLKT   KP +WI+DM+WLNLV LSKL  FS +++Q+   EK W++WFDK+APE+E +P  Y++ LD F++LLLIRCWCPDRT+  AR+YI   +G+ + E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL L++M+ELMD +IETE I+D FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD+SN  QW+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD K+ +SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WFN +MF   F F+K + IP  S +++Y+  I  LP YD+PE+FGLH NADIT+QSK A+ +LD IL+IQPKD+S+GGGETRE+ V RM DDML KLP DY+ FEV +RLQ MG L+PMNIFLRQE+DRMQ+VI  VR+TLIDLKLAIDGTIIM+E+LRDALD MYDARIP+ W K SW SSTLGFWFTEL+ERN QF TWLFKGRPNCFWMTGFFN QGFLTAM+QE+ RA+KGWALD +VL N+VTK M+D+I  PP++GVYVYGLYLEGA WDR N +L ESK KVLFE +PVI + A + +   E  + ++K+  +Y CP+YKKP RTD+  IASV L+   T+  +HW LR VALLCD+K
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQ----HLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTN----HSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVER-YFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-ENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKT--TQPPEHWVLRGVALLCDVK 2687          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1562.36 bits (4044), Expect = 0.000e+0
Identity = 1038/3121 (33.26%), Postives = 1664/3121 (53.32%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPV---KAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPE-LEAAINRQIDEALIISH--PPWVL--KLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGE-PHREMR------MNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLK-----RNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLI--PRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR---SNNNIKLDLPK-IEK-----DSEDTMFDYM--VSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMI-NKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFER----------NIEF-----CLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKS-IYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFS---KEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFN-QYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAI-VEKIRVDQQVAEEKLTAAKPALQEAEDALNTIK-PNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKT--SWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYF-TREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSI--QIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKH--HIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEEL--MDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQ--------WRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDM-------FNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLG-KLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRT--------DLTFIASVYLRCPPTKQADHWTLRAVALLCDI 9568
            PF+ +++    +L +  E I++W+ +Q  W+YLE +F   DI +Q+P+E + F  +D++W +IM    +++ VLQ       L +L        +I  K L  YLEKKRL FP                                                  YS EGE +EL + +   +A   VE WL+ L +    S+  +I  +  +   T  N  +++  +P QV L   Q+ WT +  +AL   K  +++  Q NE   L+   L         K  RT    L+TI VH +D+   L+ +KV   +DF+WL Q R+Y++ D  R  V I + D  Y  E+LG + RLVITPLTDRCY TL  A  +++GGAP GPAGTGKTET KD+ + L    VVFNCSD +D+  +G+ FKGL+ SG+W CFDEFNRI+L VLSV AQQ+  +      + + F F +G ++ +NP   + +TMNPGYAGR ELP+NLK+ FR VAMMVP+  +I  + L S GF++   L+ K    Y+LC EQL+ Q HYD+G+R + +VL   G  K   P + E   ++R ++D+N  K +  D PLF  + +DLFPG+ L    Y   LEAA     +E   I +  P  V   KLIQ +E   VRH M+ +G S AGKT  +HVL   L+   E  H E        +NPK+IT  Q+FG+ D+ +++WTDG+ +  +R     +  +  W+V DGP+D +WIE++N+VLDDNK L L +G+ I MS    +IFE +++  ASPATVSR GM+YM  S L W PL+  W+       ++ + R ++L+LF    P   +   ++    + T  +  V   C L + ++  P K   D   I R      +  S++WS+G   + + R K   +IR   S  N +  +P+ IE+     + +  ++DY     E G W+HWN  +E  I   +   +   I+VP +D VR  +LM+   SQ   +L +G  GT K+V + +K L++ + + ++   +NFS+ T     Q  I S +DKR    +GPP G++  +F+DD+NMP   ++G Q   E++RQ ++  G Y L K    IS++D+ F+AAM  PGGGRN +  R  RH  I +    +  ++  I+S I +    K+  F    + + ++++    ++++     + PTP+K HY FNLRD SR+ QG +  +   +   + L+RL+VHE  RV  DRL+D+ D  W  +          N+ F      L   + +E +D  N    F D++    E  E           ++Y  VPS E   E +    + YN+  +   +NLV F   + H+ +ISRV++   GN LLVGVGGSG+QSITRLA+ +A    FQ  I++ Y +  + +DLK  + R AG + + TVF+ TD +IKDE++LE I+++L +G +  LF+   K+E+ E +  +    KK     P T   L+ +F+ R ++NLH+V+ FSPIG+ FRKR   FP+L + CTI+WFQ WP+EAL  VA   L    +   +  +++++ +    H    +N L  F  +  R   IT  SYL  I  ++ +    + ++    +R  NGL +L  A+  +  + KEL   +  L  A  +   ++  +  ++   EA K++V  V ++ AA+   + +  +   E  L  A PAL+ A  AL+T+K P+DIS V+ ++ PP  ++ +M  V ++   K D  IPD    G K    W  S KLL   NFL  L  + +D I   ++  ++  F T  D+       +     GLC W  AME +  V + V P K  LA     LA  +  L      L E E+ L  ++  ++   + K  LE     C +K+  A +L+ GL  EK  W+  + + ++    L GD+++ +  ++Y GPF   FR      W ++ ++  +P +    + + L NP +I  WN+ GLPND  S++N +IV + SR  L IDPQ Q   W+ N E ++++     T+  + + LE+ +  G PL++E++ EELDP+L  +L K   K G    +K+G++ ++    F  Y+TT+L NPH+ PE+  K S+++F +T +GLEDQLLGIV+  E  ELE  R  L+ Q++NNKR++KE+EDS+LE L +++G+++ED++ + +L+ AK  S +++   QI  A  TE +I ++RE YR ++K  S+L+F I DL+ ++PMYQ  L  F+NL++NS I+  KS  +++R++++    T N++  + RSL++ D+  F+ LL   + +    +   +L  LL GG  L     +P P  W+ D +W  +   S+L  F GL E  + + + ++  +D   P   D+P  +   L + +K+++ RC  PD  +    +++ R LG  F++   F +     ++++  PL+ +LS GADP  L++  + K     +  +IS+GQGQ   + ++I  AMQ G+WV LQNCHL++ +M  L  + +       H DFRLW+T+   PKFP+  LQ  +K TNE P G++  + ++Y +   D +   N           W  +++ + + H  VQER+KFGPLGWNIPY +N +DL+ S++ +Q  +++ D    + ++ I Y+ GE  YGGRVTDD+D+RLL T    ++ +D+        +P  ++F     P  S   +YI  I  LP    PE+FGLH N DI+   +  + + D +L  Q   A  G     ++ +Y + +++L  +LP  +    V+ +  ++   + MN  L QE++R   + + +  +L +L  A+ G ++M+ +L     ++   ++P             LG + T+ + R      W   G+P  FW++GFF  Q FLT + Q   R ++   +   +L  D      D+   PP +GVYV GL+L+GA WD+    L E   ++LF+ +P+I ++     K+  I  D   ++Y CP+YK   R            F+ ++ L     K+  HW  R VA+L  +
Sbjct:  694 PFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKI-MKGLNAYLEKKRLFFP-------------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSR-AYEKTARN--QWVKEWPGQVVLCTSQIFWTLEVHKALGLKKYYQQLQNQLNEIVELVRGELP--------KQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVR--VHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDF-EGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAA-----EECCKIHNVQPTKVFTDKLIQTYEMMIVRHFML-VGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDDESI-RTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIEN-INLGEINTKGQEIIVPTIDTVRYTYLMDLCISQ-GPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLD-HGHYDL-KDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSI-VAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQN--LLFGDYMNPDLEGDE-----------RLYTEVPSIETFAEVVKSCLEEYNQMHKNR-MNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLT---LFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENE--RQEVITICKTFHTS--ANQLSDFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEA-KSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPD-RIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIV-RNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVE-SIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKEP-ELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINS-IQDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNL-LARKEIEHSDLMFLLTGGIGLQNTVANPDP-SWLQDKSWDEICRASELPGFQGL-EAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLT---DPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYD---KVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFA----PPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVL-YEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQ---IPIDLLTFDFEVLPIDKSETPPEDGVYVNGLFLDGARWDKEGV-LTEQHPRILFDSMPIIWVKP---EKKNMIQTD---SLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLST--KKRPQHWIKRGVAMLLQL 3680          

HSP 2 Score: 60.8474 bits (146), Expect = 3.633e-8
Identity = 30/98 (30.61%), Postives = 52/98 (53.06%), Query Frame = 3
Query:  147 IDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESD-GFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRG 437
            I  F   +P++ ++ NP ++ RHW++MS +    FD+  + G +LR +L+  L  F EE E I ++A KE  +E  ++ +   W     H    K+ G
Sbjct:  567 IQKFKDYIPVVSILCNPGLRGRHWEKMSQIAG--FDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTG 662          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1497.64 bits (3876), Expect = 0.000e+0
Identity = 981/3067 (31.99%), Postives = 1610/3067 (52.49%), Query Frame = 2
Query:  467 YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFH-EKQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHY-ERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIK-LDLPKIEKDSED-----TMFDYMVSENGE-WVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI-----EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKM-FSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHI-MTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKL--HVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMS---WKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNP--KFRFFKD----HSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFK-GRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD-----LTFIASVYLRCPPTKQADHWTLRAVAL 9556
            +  PF   IQ     L+  SE IE W+ VQ+ W+ LE +F G DI  QLP+EAK+   I K + +IM       N+ +CC     LS L     +   I QK+L  +L+ KR  FPRFF +SD  LL +LG   DP  IQ H++ ++DNI++++   +   +T++ A  S EGE +E  KPV  E+ VE W+M +L   +R+   + + A        ++ ++++  Y   + L   ++ WT +   A+ N  K D+  +++  EQ    ++ L+        + +R K   ++   VH +DI D  V   +K   DF+W  Q RFY+V++ D   V   +    Y  E++G   RL ITPLT R Y+TL QAL M +GGA AGPAG GKTETVKD+ + LG + VV +C++ MD   LG+I  GL++ G WGCFDEFNRI   VLSV + QI  + +      K F F +G  + ++   GI++TMNP Y  R ELPE++K+ FR V ++ PD Q I  + L S GF+    LA+K   LYK    QL+KQ HYDFGL +  SVL+  G+ KR +   +E   +MR LRD+NL KLV +D P+F+ LI+D+FPG+   + G+P     +   + ++     P  V K++Q++E    +   M +G +  GK+  I+ L +A T  G   +   +NPKA +  +++G  D  T DWTDGIFS L+R   +    +  +++ DG VD+ W+EN+NSVLDDNK LTLANGDRI +   C ++FEV ++ +ASPATVSR  +V++    L + P  + W+  R       +  LF    P     ++        T +  +V Q C +L+ L+  K+   S+++   ++ E LY      S+GA L    R K +  ++S + +  +D  K      +     T++D+   E  E WV W+S V EYI+  +   ++  IL P VD  RT +++  +   ++ VLL+GE GT+KT +I   L + + +  +  ++NFSS T     QR +E+ ++KR   TYGPP G+K+ VF DDINMP ++++G Q    ++R  ++  G Y   +   F ++ DL ++AAM   GGGRN++  R    F +FN   P   S+  IY+ I  GH    R F++++  +   +   T KL+ +    + PTPSKFHY F+ R+LSRI+ GL  T+ D    + ++ +R+W +EC R   DRL DE+D      +I     E+   DSE V   DP      F D+ R A E  E+          ++YE +  +++ K    +F                   DA+ H+ ++ R++R  +G+ LL+G  GS  Q++T+LA+F AD   F+I + R YN  NF  DLK++Y   G EN+ TVF+FTD  I +E +LE INNML S M+  LF+ +E + I+  +  +  +       ++E+++QYFL +  +NLH+VLC S  G+  + R   FP L S   I+W+  W  +AL  VAQ  L +  +    F    ++D + ++H  +     +   +++R    T KS+L +I  Y T+ +     V L  + ++  L +L+EA+E I     EL +K                                                DQ+V   K TA   A  E  D   TI            KPP  +Q + +C+L+L  KK             + +W+ + K+++   FL+SL+    D I+   I  ++ +       +E  +      +G+  + ++   ++ + +EV P KD +        +++ +L+  +  L   ++  + +K +Y+ A   K+    +A +  ++++ A++L+ GL  E+  WT    E + Q   L+GD ++ +AF+SY G FN  FR  M +  W   ++  G+P+++   I   L+N  +I  W  +GLP D+ SV+N I+ T+ SR+ L IDPQ Q  +WI NKE ++++   ++  +  F + LE ++  G+P +++D+ E++DP + NVLE+N +       + +GDKEV+    F L++ T L+NP +SP ++ K  VI++S T++GLEDQLL +     ++  +     L+++ S NK  +K L DSLL  L  + G+++++  L+  L K K  + +   +++ A     E    RE YR ++KRG++L+F ++D++ VN MYQ  L  +L+LF  S+ ES   P +Q+R+++II+ +T N+ N+    L+   +  F++ + +K++     V Q+EL+ L+K  S    K    KP +WI D  W ++  L++L    FS L   I  +   W++W+D  APE    P  Y   L  F+KLLL+RC   DR       Y+  T+G+  +        ++   + A +P++ ++S G+DPT  +   A+K   +   I++GQGQE    +++ KA+  G+W++LQNCHL + ++++L   + +    + +FR+W+TT     FPI  LQ S K   EPP+ IK  +K TY+  +Q  L       +  +VY +A+ H  VQER K+G  GW++P  +N +D +ASL+ +  +L     ++G S   W+++ Y++GE+ YGGR  D +D+R+L  +   +F D +F+P   F FF++    + IP   + + Y + I ++P   +PE+ GL S  +I Y ++  + +   +  +QP +   G G   +  +  +  D+  +LP  +    V E L     L P ++ L QE+ R  K++  ++ ++++L  A+ G + M+++  D   +  +  +P+           +L  W + L  R  Q+S W  + G P   W++G    + +L A+ Q   R  KGW LD      +VT++  ++      +  Y+ GL+LEGA WD  N  L  SK KVL   LP+  ++ I + K        L+N  + PVY    R +     L F A ++     T    HW L  V L
Sbjct: 1277 FGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERI-QKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEA-------VYHYVDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQF-EGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQT-LGLCTKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR-------LNRLFEKYVPSCIDVTLNSETIVPRT-DVNMVSQLCLMLDVLLESKN--SSAEVLECYFLEALYC-----SLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYIH--NPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH---TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAV-LADP----ILFGDY-RAAREECEQ----------RVYEDIGDYDVSKAIFQLFE------------------DAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLIS-MVPTLFADDEKESIIKQINSEALQ--EGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHF--GAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHV-LQCKCLEGSLNRLREAREQI----DELNLK----------------------------------------------LADQKVVLAKKTATCTAFLEEIDKNQTI---------SFAKPPKQVQVVCECILVLRGKK-------------ELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSGDGTKV--QKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGN-CVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCH-EQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGRKHVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQP-ETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGT--DLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRK-KGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPI--LKVIPVQKNSL----RLRNTLRTPVYTTSLRRNASGAGLVFEADLF----TTMHTSHWVLSGVCL 4171          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 4915.9 bits (12750), Expect = 0.000e+0
Identity = 2411/3040 (79.31%), Postives = 2682/3040 (88.22%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDD---SEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            + YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQ +E+KGFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ +SID+I+S+IG GHYCKER F   V  +V  LI +TR+LW  TK KM PTP+KFHYVFNLRDLSRIWQG+INTQ DVI+++K LL LW HEC RV+SDR +   D+ WF + ++ CL +    ++V          +F+DF+RDA E   E  DD+ F +PK+YEP+ SF+ LK+RL MF   YNE++RG+ +++VFF DAM H++KISR+IR  +GN LLVGVGGSGKQ++T+LAS+IA Y  FQIT+TR YN++N LEDLK +YR AG++ KG  F+FTD EIKDE +LEY+NN+L+SG+++ LF+++EMDEI   +   MKK +P+ P T +NL +YFL R + NLH+VLCFSPIGEKFR RAL FP L SGCT++WFQ+WPK+AL+ VA H L  F +VC   VK++++  + V+H  V  NC+ YF ++RR   +T KSYLS++  YK++Y+      S L +RM +GLQKL EAQE++  L + L  KE+ L++A+ EAE VL  VT Q  AA  VKNKV+ VKDK  +IVE+I  D+++AE KL AA+PAL+EAEDALNTIKP DI+TVRKL +PPHLI RIMDCVLI FQ+++D    D ER   K SW ES+KL+++  FLN+L+ FP+D INEE ++L+ PY   EDY ++ AR+ CGNVAGL +WT+AM  F+ +N+EV+PLKD+L  Q +   K+ +DL +A+ VL EK++ L  V+  YD A+++KQ L  DA  CR+KM+ A +L+ GL  EK RWT QS EF++QI  LVGD++  +AF+SYCGPFNQ+FR  + + W+  +R   +P + +++I++ L++P  +GEW+LQGLPND+LSV+N IIVT+ASRY L IDPQ QGK WI N+E +  +  T+  +KYF+QHLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LYITTKL NP ++PEI+A+TS+IDF+VTMKGLEDQLLG+VI  EK+ELE  R QL++    NK+K+KELED+LL RL +T+GSLV+D++L+ VL   K TS +VS ++  A+DTE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL LF  S+  S+KSP  Q+RIQ+II CMT  +W + VR LY+ D+ TFTLL+ALK+DM    ++ EE +  +KGG++LD+  + PKP  WI DMTWLNLV LS LH FS +++Q+  +EKQWR WFDK+APE+E IP GY   LD F++LLL+RCWCPDRTL  A++YI  +LG+ F E        +  E+  +TP++GLLS+G+DPTP IE  AKKH ++   ISMGQGQE+HSRR++A  +  G WVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK
Sbjct: 1635 NRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4674          

HSP 2 Score: 324.709 bits (831), Expect = 3.762e-88
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH
Sbjct: 1462 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 1614          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 4912.82 bits (12742), Expect = 0.000e+0
Identity = 2415/3038 (79.49%), Postives = 2680/3038 (88.22%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI-EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            + YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQ +E+KGFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ +SID+I+S+IG GHYCKER F   V  +V  LI +TR+LW  TK KM PTP+KFHYVFNLRDLSRIWQG+INTQ DVI+++K LL LW HEC RV+SDR     D+ WF + +     +D   V      +ER YFVDFLRDA E   E  DD+ F +PK+YEP+ SF+ LK+RL MF   YNE++RG+ +++VFF DAM H++KISR+IR  +GN LLVGVGGSGKQ++T+LAS+IA Y  FQIT+TR YN++N LEDLK +YR AG++ KG  F+FTD EIKDE +LEY+NN+L+SG+++ LF+++EMDEI   +   MKK +P+ P T +NL +YFL R + NLH+VLCFSPIGEKFR RAL FP L SGCT++WFQ+WPK+AL+ VA H L  F +VC   VK++++  + V+H  V  NC+ YF ++RR   +T KSYLS++  YK++Y+      S L +RM +GLQKL EAQE++  L + L  KE+ L++A+ EAE VL  VT Q  AA  VKNKV+ VKDK  +IVE+I  D+++AE KL AA+PAL+EAEDALNTIKP DI+TVRKL +PPHLI RIMDCVLI FQ+++D    D ER   K SW ES+KL+++  FLN+L+ FP+D INEE ++L+ PY   EDY ++ AR+ CGNVAGL +WT+AM  F+ +N+EV+PLKD+L  Q +   K+ +DL +A+ VL EK++ L  V+  YD A+++KQ L  DA  CR+KM+ A +L+ GL  EK RWT QS EF++QI  LVGD++  +AF+SYCGPFNQ+FR  + + W+  +R   +P + +++I++ L++P  +GEW+LQGLPND+LSV+N IIVT+ASRY L IDPQ QGK WI N+E +  +  T+  +KYF+QHLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LYITTKL NP ++PEI+A+TS+IDF+VTMKGLEDQLLG+VI  EK+ELE  R QL++    NK+K+KELED+LL RL +T+GSLV+D++L+ VL   K TS +VS ++  A+DTE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL LF  S+  S+KSP  Q+RIQ+II CMT  +W + VR LY+ D+ TFTLL+ALK+DM    ++ EE +  +KGG++LD+  + PKP  WI DMTWLNLV LS LH FS +++Q+  +EKQWR WFDK+APE+E IP GY   LD F++LLL+RCWCPDRTL  A++YI  +LG+ F E        +  E+  +TP++GLLS+G+DPTP IE  AKKH ++   ISMGQGQE+HSRR++A  +  G WVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK
Sbjct: 1635 NRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFTAHEDISWFNKVLLRIVNEDLGEVHVGSLQDER-YFVDFLRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4671          

HSP 2 Score: 324.709 bits (831), Expect = 3.698e-88
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH
Sbjct: 1462 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 1614          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000039073.1 (SMESG000039073.1)

HSP 1 Score: 3890.5 bits (10088), Expect = 0.000e+0
Identity = 1904/3050 (62.43%), Postives = 2389/3050 (78.33%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE--RPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S   + A  S+ YN PFK  IQ+ V KL+ ++EIIE W+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  NV+QCC+GD+TLSQLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLSVFDN KTV F EK Y+ ILA  S E EA++L++P+ A+ NVEIWL  LL M+++SLH VIR+A+ +IND++F + EF   +P+QVGLLGIQ++WTRDS EAL  +K+D+KIMQ TN++FL +LN LI  TT +L K+ERTKFETLITIHVHQ+DIFD LV  K+ +P DF+WLKQ+RFYF ED D+CIVSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERK QF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDR IIIRVKLASCGF+ N VL++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E   VMRVLRDMNLSKLVD+DE LF+SLI DLFP +++    YP++ AAI++QI++A +I+H PW LKLIQLFETQRVRHGMMTLGPSGAGKT CI+VLM+A+TDCGEPH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT K KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+ KIIFEVHNIDNASPATVSRNGMVYMSSS LDW P+L+ WLL   + +     +L  F   F + YRY  Q L  KM TLE   +RQA DLL GL+   D K   +I   H E+L +FS+MWS+GALLE+EDR KL+ +I     + + + K     +DT+F+Y+V++ GEW HW ++V EY+YP D  PEY SILVPNVDN RTDFL+NT++ Q KAVLLIGEQGTAKTV++  Y    NPE  +FKSLNFSSAT P MFQRT+ES+VDKRMG+T+GPP GRKMT+FIDDINMPVINEWGDQI NEIVRQ +EM G YSL+KPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ ++G G++C ER F+  V + V+ L+  TRKLWQ TK KM PTP+KFHYVFNLRDLSRIWQG++   SDVI+S  KL+ LW HEC RV++DR  +++D  WFE+ ++   ++    E         YFVDFL+DAPE   E  +++    PKIYEP+ S+E L +RL  +   YNETVRG  ++LVFF DAM H+VKISRVIR  KG+ LLVGVGGSGKQS+TRLASFI+ Y  FQIT+TR YN++N +EDLK +YR +G+  KG  F+FTDNEIKDES+LE++NNML+SG IA LF+++EMDEIL  +   MKK +P+ P + ENL +Y++ RV   LH+VLCFSP+GEKFR R+L FP L SGCTI+WFQ+WPK+AL+ V+ + L  F +V    VK+ +V+ + +    V  NC+ YF ++RR   +T KSYLS+I  YK +Y   +  +  L  RM  GL+KL EA E++  LSKEL +KE+ L VA  +A  VLA V  + +AA+ VK +V+ VKD+  A+V  I  D+ +AEEKL AAKPALQEAE+AL TIKP  I+TV+KL +PPHLI RIMDCVLILF+K++D    D ER   K +W E++KL++ +NFL SLL FP+D IN+E++DL++PYF  ED++L +A+   G+VAGLC+WTKAM  F+ +N+EV+PLK +LA Q   L  A  +L +A+++L  K++ L +V+ EY+ A+  KQALE DA  CR+KM+ A  L+ GL  E+ RWT  S  F+ QI  LVGD+++++AF+SYCGPFNQ FR  +   W+  +  NG+P    +  +  L++   I EWN+QGLPND+LSV+N +IVT+A RY L IDPQ QGK WI NKE  H +  T   +KYF+ HLEDAL+ G PL+IED+ EE+DPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LY+TTKL NP ++PE++AKTS+IDF+VT+KGLEDQLLG+VI  EK+ELE  R +L+++ + NKRK KELED+LL RL +TEGSLVED++L+ VL   K+T+ DV  ++    DTE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ LKQFL LF  S+  S+KSP   +RI +II  +T  ++ +  R  Y+ D+ TFT+LL +K+ M++  ++ EE  + +KGG+ALDL  ++PKP KWI D+TWLNLV LSKL  F  + EQ+  ++K W+ WFD DAPE+  IP GY+  L+ FKKLLLIR WCPDRT+ MA++YI  T+G  F E V   +  +  E D  TP++  LS+G+DPT  IE  AKK +++ G+ISMGQGQEVH+R++++ +MQEG W+LLQNCHL L++M+E ++ +  TE IH+ FR WVTTE HPKFPI+ LQ+ IKFT +PP GI+AG++RTY    QD LDI+N  QW+PM++ VA+LHT VQERRKFGP+GWNIPYE+N +D  +++QFVQNHLDDMD+K+G+SWKT+CYM+GE+QYGGRVTDDYDKRLLNT+ + WF+ +MFNPKF F+K + IP+   L+EY   I++LP  DSPE FGLH+NADI Y++  A  +L  I+NIQPKD+  G GETRESVVYR+ DDML +LP DY  FEV E+LQ MG L+P+NIFL+QEVDRMQKVI+ VR+TL+DLKLAIDGTIIM+E+L+DALD+++DARIPS W K+SWES+TLGFWFT+L++RN QF +WL++GRP CFWMTGFFN QGFLTAMRQE+TR HKGWALD VVL NDVTK M++++N  PSEGVYV+GLYL+GAGW+ R++KL E   KVL+ PLPV+ + A+ ++          +  Y+CPVYKKPRRTDL +I  + L+    +  DHW LR VALLCDIK
Sbjct: 1575 DSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTLSQLLPHLLEQLELCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK---EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICK----DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPEATGEENEETELEAPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTRSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNELSKELAVKEKELEVARKKAGEVLAQVEVKASAAQKVKEQVQVVKDRAEALVNNISRDKAIAEEKLEAAKPALQEAEEALETIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKT--NEAPDHWILRGVALLCDIK 4614          

HSP 2 Score: 204.142 bits (518), Expect = 1.277e-51
Identity = 97/152 (63.82%), Postives = 122/152 (80.26%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN YYDI W +++I+ I+ +L +FQN+CRKLPK LK+W A++DLRKTIDDFN   PLLE M++ AM PRHW+R+  +T H F+V+SD F LRN++EAPLL  KEEIEDICISAVKEKDIEAKLK V  +WSA    F +FK+RGELLL+GD
Sbjct: 1413 TVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQSFSFSSFKSRGELLLKGD 1564          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 3856.6 bits (10000), Expect = 0.000e+0
Identity = 1929/3053 (63.18%), Postives = 2368/3053 (77.56%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+++  S+ YN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQT+EMKGFYSL++PG+F +++D+ F++AMIHPGGGRNDIPERLKRHF IFNCTLP+  SID+                  S++ +V  +I   RK   S K  +    +KFHYVFNLRDLSRIWQG+INT SDVI++ + LL LW HEC RV+SDR +   D QWF + I+  + +    +  +   + +YFVDFLRDAPE   E  +D  F+ PKIYEP+   + LK RL MF   YNE++RG+ ++LVFF DAM H+VK+SR+IR   GN LLVGVGGSGKQS+TRLA+ IA Y          YN++N LEDLK++YR AG+E KGT F+FTDN+IKDE +LEY+NN+L+SG+++GLF K+E+DE+ + +   MKK FPK P T ENL +YF  RVR NLH+VLCFSP+G+KFR RALYFP L SGC  +WFQKWPK+AL+ VA+H L +F +VC+   K  I+  ++ IH DV + C +YF++YRR   +T KSYLS++  Y+ +Y   K  +  L  RM +GLQKL EAQ++I  LS EL  KE+ L VA+ EAE VL  VT+QT AA+ VK+KV+ VKD+C  IV  I  D+ +AE KL AAKPAL EAE+ALNTIKP DISTVRKL KPPHLI RIMDCVL+LFQ+ +D  + D ER   K SW ESLKL+A++ FLN+LL F RD INEE++DL+ PY   EDY+LE A+K CGNVAGL  WT+AMEKFYWVNREV+PLKD+LA Q I L  A  DL  AE +L EKEE+LA+V+ +Y+ A+KRKQ L  DA  CR++M+TA QL++GL  EK RWT QS  F+ Q   L                    FR+K+ + W   +    +P    +D+++ L++   I EWNLQGLPND+LS++N IIVT A+RY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G P++IEDI EELDPAL+ VLEKNFIK+GTGLKVKVGDKEVD+ K F LYITTKL NPH++PEIYAKTS+IDF+VT+KGLEDQLLG VI  EKEELE SR +L++  +NNKR+++ELEDSLLERLANT+GSLV+DQ+LL VL+  K TS +VS+Q++QA +TE+EIN AREEYR ++ RGS+LYFL T++S VN MYQ GLKQFL LF  S+ +S+KSP   RRI  II  MT ++W F VR +YK DR T TL+LALK+D+++ ++RQEE +VL+KGGS LDLKT+ PKP KWI D+TWLNL ALS L+ FS ++EQ+V +EK W+ W+DK+ PE+E IPCGYE+ LD F++LL++R WCPDRTL  A++YI  +LG+ F E+V   +  L  ++D ++ L+ LLS+G+D TPLIE  AKK HI    +SMGQGQE+HSR++I+K MQEG WVLLQNCHL LDY+EEL  Q+IE E +H+ +RLW+TTE H KF I+ LQ+SIKFTNEPP+GIKA + RTYT   QDFLD      W+ M++ +A+LH  VQERRKFGPLGWNIPYEYN +D NAS+QF+QNHLD ++ KK     G+ WK + YM+ EIQYGGRVTDDYDK+                               K      I   LP  D+PE FGLH NADITY +KT + ILD IL+IQPKDA++GGGETRESVV R C DML KLPS+Y+ ++V E+LQ MG L PMNIFLRQEVDRM KVI  VR TL DL+LAI GTIIMNE+LRDALD++YDA+IP  W K+SW+S+TLGFWF+ELI+RN+QFS+WL  GRP  FWMTGFFN QGFLTAMRQEVTR+H GWALD+VVL + VTKH+ DE+ +PP EGVYVYGL++EGA WD+RNS+L E K K L++ LPVI I AI  + + +I       +Y  P+YKKPRRTDLT++ASV L C  +K  DHW +R VALLCDIK
Sbjct: 1597 DSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK------------------SLVLLVWDII--VRK-EVSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDLAESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYSS--------YNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKK-------------------------------KCLHRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDTS---KLYTTPIYKKPRRTDLTYVASVELVC--SKTPDHWVMRGVALLCDIK 4557          

HSP 2 Score: 152.525 bits (384), Expect = 4.274e-36
Identity = 71/153 (46.41%), Postives = 98/153 (64.05%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD+    FA ++                                   +W+  +L   +FKNRGELLL+GD 
Sbjct: 1470 TVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDMMLKTFACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDR 1587          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 3856.6 bits (10000), Expect = 0.000e+0
Identity = 1929/3053 (63.18%), Postives = 2368/3053 (77.56%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9571
            +S  V+++  S+ YN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQT+EMKGFYSL++PG+F +++D+ F++AMIHPGGGRNDIPERLKRHF IFNCTLP+  SID+                  S++ +V  +I   RK   S K  +    +KFHYVFNLRDLSRIWQG+INT SDVI++ + LL LW HEC RV+SDR +   D QWF + I+  + +    +  +   + +YFVDFLRDAPE   E  +D  F+ PKIYEP+   + LK RL MF   YNE++RG+ ++LVFF DAM H+VK+SR+IR   GN LLVGVGGSGKQS+TRLA+ IA Y          YN++N LEDLK++YR AG+E KGT F+FTDN+IKDE +LEY+NN+L+SG+++GLF K+E+DE+ + +   MKK FPK P T ENL +YF  RVR NLH+VLCFSP+G+KFR RALYFP L SGC  +WFQKWPK+AL+ VA+H L +F +VC+   K  I+  ++ IH DV + C +YF++YRR   +T KSYLS++  Y+ +Y   K  +  L  RM +GLQKL EAQ++I  LS EL  KE+ L VA+ EAE VL  VT+QT AA+ VK+KV+ VKD+C  IV  I  D+ +AE KL AAKPAL EAE+ALNTIKP DISTVRKL KPPHLI RIMDCVL+LFQ+ +D  + D ER   K SW ESLKL+A++ FLN+LL F RD INEE++DL+ PY   EDY+LE A+K CGNVAGL  WT+AMEKFYWVNREV+PLKD+LA Q I L  A  DL  AE +L EKEE+LA+V+ +Y+ A+KRKQ L  DA  CR++M+TA QL++GL  EK RWT QS  F+ Q   L                    FR+K+ + W   +    +P    +D+++ L++   I EWNLQGLPND+LS++N IIVT A+RY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G P++IEDI EELDPAL+ VLEKNFIK+GTGLKVKVGDKEVD+ K F LYITTKL NPH++PEIYAKTS+IDF+VT+KGLEDQLLG VI  EKEELE SR +L++  +NNKR+++ELEDSLLERLANT+GSLV+DQ+LL VL+  K TS +VS+Q++QA +TE+EIN AREEYR ++ RGS+LYFL T++S VN MYQ GLKQFL LF  S+ +S+KSP   RRI  II  MT ++W F VR +YK DR T TL+LALK+D+++ ++RQEE +VL+KGGS LDLKT+ PKP KWI D+TWLNL ALS L+ FS ++EQ+V +EK W+ W+DK+ PE+E IPCGYE+ LD F++LL++R WCPDRTL  A++YI  +LG+ F E+V   +  L  ++D ++ L+ LLS+G+D TPLIE  AKK HI    +SMGQGQE+HSR++I+K MQEG WVLLQNCHL LDY+EEL  Q+IE E +H+ +RLW+TTE H KF I+ LQ+SIKFTNEPP+GIKA + RTYT   QDFLD      W+ M++ +A+LH  VQERRKFGPLGWNIPYEYN +D NAS+QF+QNHLD ++ KK     G+ WK + YM+ EIQYGGRVTDDYDK+                               K      I   LP  D+PE FGLH NADITY +KT + ILD IL+IQPKDA++GGGETRESVV R C DML KLPS+Y+ ++V E+LQ MG L PMNIFLRQEVDRM KVI  VR TL DL+LAI GTIIMNE+LRDALD++YDA+IP  W K+SW+S+TLGFWF+ELI+RN+QFS+WL  GRP  FWMTGFFN QGFLTAMRQEVTR+H GWALD+VVL + VTKH+ DE+ +PP EGVYVYGL++EGA WD+RNS+L E K K L++ LPVI I AI  + + +I       +Y  P+YKKPRRTDLT++ASV L C  +K  DHW +R VALLCDIK
Sbjct: 1593 DSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK------------------SLVLLVWDII--VRK-EVSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDLAESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYSS--------YNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKK-------------------------------KCLHRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDTS---KLYTTPIYKKPRRTDLTYVASVELVC--SKTPDHWVMRGVALLCDIK 4553          

HSP 2 Score: 149.058 bits (375), Expect = 5.152e-35
Identity = 71/153 (46.41%), Postives = 97/153 (63.40%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD     FA ++                                   +W+  +L   +FKNRGELLL+GD 
Sbjct: 1470 TVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDT----FACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDR 1583          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH51.989e-5564.77dynein axonemal heavy chain 5 [Source:HGNC Symbol;... [more]
DNAH82.238e-5762.64dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH82.617e-5762.64dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH81.552e-5762.22dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH11.192e-635.27dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-16.128e-728.01Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-16.159e-728.01Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-16.159e-728.01Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-30.000e+027.10Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-36.449e-2325.41Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94922.702e-6258.67gene:FBgn0037726 transcript:FBtr0309029[more]
CG94922.656e-6258.67gene:FBgn0037726 transcript:FBtr0309028[more]
CG94922.530e-6258.24gene:FBgn0037726 transcript:FBtr0309027[more]
CG94922.776e-6258.24gene:FBgn0037726 transcript:FBtr0344344[more]
kl-33.743e-4754.99gene:FBgn0267432 transcript:FBtr0346771[more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah51.639e-5664.40dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah5l8.871e-5861.45dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah5l0.000e+060.64dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah24.322e-935.52dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah24.514e-935.52dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021690.19.498e-5965.00dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021565.19.637e-5964.93dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000035049.19.223e-5964.81dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021598.11.228e-5864.86dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
nifk2.905e-5662.50nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah52.990e-5464.39dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah82.246e-5662.91dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah82.246e-5662.91dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah82.246e-5662.91dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah12.022e-635.57dynein, axonemal, heavy chain 1 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TE73|DYH5_HUMAN9.554e-5564.77Dynein heavy chain 5, axonemal OS=Homo sapiens OX=... [more]
sp|Q8VHE6|DYH5_MOUSE2.091e-5364.39Dynein heavy chain 5, axonemal OS=Mus musculus OX=... [more]
sp|Q91XQ0|DYH8_MOUSE1.571e-5562.91Dynein heavy chain 8, axonemal OS=Mus musculus OX=... [more]
sp|Q96JB1|DYH8_HUMAN1.075e-5662.64Dynein heavy chain 8, axonemal OS=Homo sapiens OX=... [more]
sp|M0R8U1|DYH5_RAT1.499e-5266.91Dynein heavy chain 5, axonemal (Fragment) OS=Rattu... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183416412.023e-7168.92tr|A0A267GD23|A0A267GD23_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183399421.242e-6868.97tr|A0A267H528|A0A267H528_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183232262.757e-7168.92tr|A0A267E162|A0A267E162_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183056681.404e-6868.97tr|A0A1I8J1U1|A0A1I8J1U1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|210970511.036e-6667.74tr|A0A2T7NHT2|A0A2T7NHT2_POMCA Uncharacterized pro... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah52.345e-5763.51dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah50.000e+063.33dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000016401.20.000e+059.46pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
dnah22.829e-835.50dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+035.27dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001372.12.947e-1163.71pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000001370.12.826e-1163.74pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000001365.13.102e-1163.67pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000006497.11.884e-5864.41pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
ENSPMAT00000001375.12.828e-1162.88pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 ge... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN15.496e-10130.31Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356036.320e-6264.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320049.190e-6063.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420241.063e-5363.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358526.952e-1535.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479201.917e-1034.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah51.906e-5463.06dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah53.409e-3659.88dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah50.000e+061.84dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah123.633e-833.26dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
si:dkeyp-86b9.10.000e+031.99dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049144.13.762e-8879.31SMESG000049144.1[more]
SMESG000049144.13.698e-8879.49SMESG000049144.1[more]
SMESG000039073.11.277e-5162.43SMESG000039073.1[more]
SMESG000056575.14.274e-3663.18SMESG000056575.1[more]
SMESG000056575.15.152e-3563.18SMESG000056575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015079 ID=SMED30015079|Name=Dynein heavy chain 5, axonemal|organism=Schmidtea mediterranea sexual|type=transcript|length=9719bp
ATTCGGTTAACGGTTACTATGACATCCTCTGGGGGGACGTGGACATCGAA
AAAATATCAAATGAATTGACAGAATTCCAAAACCGGTGCCGGAAATTGCC
TAAAGGACTAAAGGATTGGCCAGCATTTGAAGACCTCCGGAAGACGATTG
ATGATTTCAATTCAATGGTTCCTCTGTTGGAGCTGATGACAAACCCGGCA
ATGAAACCGAGACATTGGCAGAGGATGAGTGACCTCACCAGCCACCATTT
CGATGTCGAATCAGATGGATTCGCGCTCAGGAATATCTTAGAGGCGCCGC
TGCTGAAGTTCAAGGAGGAAATCGAGGACATTTGCATCTCGGCCGTGAAA
GAAAAAGATATCGAAGCAAAATTGAAAGCAGTCAAAGCTGAATGGAGTGC
TCACGAGTTGCATTTTGGAACGTTTAAGAATCGTGGGGAGTTGTTGCTGC
GTGGAGATCACACGAGTACAACGTGCCGTTCAAGAAAGACATCCAGGATA
TGGTATCAAAACTGTCGAATTCCAGTGAAATCATCGAGCAATGGATGACT
GTACAGAACCTTTGGGTGTATCTTGAAGCGGTATTCGTCGGTGGGGACAT
AGCAAAACAGTTGCCAAAGGAAGCGAAACGATTCAGCAATATTGATAAGA
GCTGGATCAAGATCATGTCGAGGGCTCATGAGAATACCAACGTGCTGCAG
TGCTGTGTGGGCGACGAAACTCTCAGTCAATTGTTGCCTCATTTGCTGGA
GCAGCTAGAGATTTGCCAGAAGAGTTTGACTGGGTATCTGGAAAAGAAAC
GACTTTTGTTTCCGCGATTTTTCTTCGTTTCCGACCCAGCACTACTGGAA
ATCCTTGGCCAAGCGTCAGATCCGCACACAATTCAATCCCATTTGCTGTC
GGTATTCGATAACATCAAGACCGTGAAATTCCACGAGAAACAATACGAAA
CGATTCTGGCGTGCTATTCAATGGAGGGAGAGGCATTGGAGCTGGAGAAG
CCCGTGAAAGCAGAAAGCAACGTGGAGATATGGCTAATGGGATTGCTGAA
CATGGCCCAGCGATCTCTTCATGGCGTTATCAGGGCGGCCAATAATTCCA
TCAACGATACTGAATTCAATGTTTTGGAATTCCTGAACATGTATCCTGCA
CAAGTGGGCCTCCTAGGAATCCAGTTACTGTGGACAAGGGATTCAACAGA
GGCACTAGTCAATGCAAAATCCGACAGGAAGATCATGCAGCAAACCAATG
AACAGTTTCTCCTCCTCCTTAATCTGCTCATTCAACAGACAACAACGGAT
CTCGGCAAGGTGGAGAGAACGAAATTCGAAACCTTGATAACGATCCATGT
GCATCAGAAAGACATATTTGATCAGCTGGTCAAGGACAAGGTCAAATCGC
CAAGCGATTTTGATTGGCTCAAACAAACTCGGTTTTATTTTGTGGAGGAT
GTGGACAGATGCATCGTTTCTATCACTGATGTGGATTTCATCTACCAGAA
TGAGTTTCTCGGCTGTACGGAGCGATTGGTCATAACGCCACTGACTGACA
GGTGCTACATCACGCTAGCGCAAGCCCTCGGAATGTCCATGGGAGGCGCA
CCCGCCGGACCAGCTGGAACAGGGAAAACTGAAACTGTGAAAGATATGGG
TCGTTGCCTTGGCAAATATGTTGTCGTATTCAATTGCTCAGATCAGATGG
ATTTCAGAGGATTGGGCAGGATATTCAAAGGTCTCTCTCAGTCGGGCTCA
TGGGGCTGCTTTGACGAGTTCAATCGAATCGATTTACCGGTGTTATCAGT
TGCCGCGCAGCAAATCGCTGTCGTGTTGTCGTGCAAGAAGGAACGAAAGA
AACAATTTGTTTTCACTGATGGCGACTTGGTGGACATGAATCCGGAATTC
GGAATATTTCTGACAATGAATCCTGGATATGCTGGTCGACAGGAGTTGCC
GGAAAACTTGAAAATCAATTTCAGAAACGTTGCAATGATGGTGCCAGATA
GGCAGATAATTATCCGTGTGAAGTTGGCCTCATGCGGTTTCATTGACAAT
ATCGTATTGGCGAGGAAGTTCTATACGCTTTACAAGCTCTGTGAAGAACA
GTTAACGAAACAAGTGCACTATGACTTCGGGTTGAGGAACATTCTCTCGG
TGCTGAGAACTCTCGGCCAGCAGAAGAGAGCTAATCCTACGGACACGGAA
CAAACGACTGTCATGCGAGTACTAAGGGACATGAATTTGAGCAAACTTGT
TGACCAGGATGAACCGCTATTTATCTCTCTGATCAATGATCTGTTTCCAG
GAATCCAGTTGGACAAAGGAGGATATCCGGAACTGGAAGCCGCTATTAAC
AGGCAAATTGATGAAGCGCTTATCATATCTCATCCACCTTGGGTGCTGAA
ACTCATTCAATTATTTGAAACCCAGCGGGTAAGACATGGAATGATGACGC
TTGGTCCGTCTGGGGCCGGGAAAACCAATTGTATACATGTGCTAATGAAG
GCGCTGACCGATTGTGGGGAACCTCACAGGGAAATGAGAATGAATCCGAA
GGCAATAACAGCTCCGCAAATGTTTGGTCGGTTGGATGTGTCAACAAATG
ATTGGACAGACGGAATATTTTCCACTTTGTGGAGGAGGACATTGAAGGGA
AAGAAAGGCGAACATATATGGTTGGTTCTAGATGGACCTGTTGATGCCAT
TTGGATTGAGAACCTCAATTCGGTACTAGATGATAACAAAACGTTGACCT
TAGCCAATGGAGACCGGATACCGATGTCACCATCTTGCAAGATCATATTT
GAGGTTCACAACATCGATAACGCCTCTCCAGCAACAGTTTCAAGGAATGG
TATGGTCTACATGAGCAGCTCGGCCCTCGATTGGTGTCCATTGCTGAAAG
GATGGTTACTAAAAAGAAATTCTAATGAAAGGCCAATAATGCTGGAGCTG
TTTACTAATTCATTCCCAGATATTTACAGATATTCCATCCAATATCTTAT
ATACAAAATGGAGACGCTAGAAGCATTCGTGGTTCGCCAGGCATGCGATT
TGCTGGAAGGATTGATACCGAGGAAGGACGAGAAAGATTCCTCACAGATT
TCTCGAATTCATTATGAACGGCTGTATATATTCTCTGTCATGTGGAGCAT
TGGAGCTTTGCTGGAAATTGAGGACCGTGGGAAACTAGAAGCATATATTC
GATCAAATAACAATATCAAGCTTGATCTACCGAAAATTGAAAAGGATTCC
GAAGATACCATGTTTGATTATATGGTCAGTGAGAATGGTGAATGGGTCCA
TTGGAATTCAAAGGTCGAAGAATATATATATCCTAAAGATTCGACTCCCG
AATATGGATCCATTCTTGTGCCGAATGTTGACAATGTTCGAACAGACTTT
CTAATGAATACTGTGGCATCTCAGGAGAAGGCAGTTCTACTTATTGGCGA
GCAGGGAACTGCCAAAACGGTCATGATCAATAAATACCTTTCCTCAAAGA
ATCCAGAATATCACATGTTTAAATCTCTTAATTTCTCCAGTGCAACGGTA
CCGTTTATGTTCCAAAGAACAATCGAAAGTTTCGTTGATAAGCGTATGGG
AAGCACATATGGGCCACCAGCGGGACGCAAAATGACCGTGTTCATAGATG
ATATAAACATGCCGGTGATAAATGAATGGGGAGATCAAATAGCAAATGAG
ATTGTGAGACAAACAATAGAAATGAAAGGATTTTACAGTTTGGATAAACC
TGGAGATTTTATTAGTGTATTGGATTTGCATTTTGTTGCAGCCATGATCC
ATCCCGGAGGAGGACGAAATGATATTCCAGAAAGATTGAAAAGACATTTC
CGAATCTTCAACTGTACTTTGCCAACATTCGCCAGCATTGATCGTATATA
TTCTGTTATCGGCTTAGGCCATTATTGCAAAGAAAGACATTTTCGAAGCA
GTGTTATAAATATGGTCAGTAAATTGATAGGTTTGACAAGAAAACTCTGG
CAGTCTACAAAAAATAAAATGAAACCAACCCCATCAAAATTTCATTACGT
TTTTAATTTAAGAGATTTGAGTAGGATTTGGCAAGGGTTAATTAATACTC
AATCGGACGTTATAAGTTCTTCAAAAAAGTTATTGAGGTTGTGGGTCCAT
GAATGCTCAAGGGTTCTATCGGATAGATTGATTGATGAATCTGATTTACA
ATGGTTTGAAAGAAATATCGAATTTTGTCTGGATGATTCTGAAGTCGTTG
AGTTCAGAGATCCCCCAAATGAACGAACGTATTTTGTTGATTTCCTCAGA
GATGCACCAGAAACAGTAGAAGAGGGTGCAGATGACTCGGCATTCGCAGT
TCCTAAAATATACGAACCAGTACCATCTTTCGAGTTGCTAAAAGAGAGAT
TGAGTATGTTCAATAAGAGCTATAATGAAACAGTTCGAGGATCACCTATT
AATCTTGTTTTTTTCATCGACGCAATGCTGCACGTCGTTAAAATATCTCG
AGTAATCCGAATGCAGAAAGGAAATATTTTATTGGTTGGCGTTGGCGGTT
CCGGTAAACAATCAATAACGCGATTGGCTTCTTTTATCGCTGATTATGTT
TGTTTTCAAATTACAATTACTCGAATTTATAATTTGAATAACTTTCTTGA
AGATCTAAAATCTATTTACCGATTTGCTGGCAAAGAAAACAAGGGCACGG
TTTTCATGTTTACGGATAACGAAATTAAGGACGAGTCGTACCTGGAATAC
ATTAACAACATGTTGGCGTCAGGAATGATTGCTGGATTGTTTTCGAAAGA
AGAAATGGATGAAATACTCTCATTTGTTGGATATGATATGAAAAAGTTTT
TCCCAAAACATCCTCAGACCCAGGAAAATCTTTATCAATATTTCTTAGAT
AGAGTTCGAGATAATTTGCATTTAGTATTGTGCTTTTCTCCAATCGGTGA
AAAGTTTCGTAAACGTGCTTTATATTTTCCGGCCCTGACCTCTGGCTGTA
CCATAAACTGGTTTCAGAAATGGCCTAAAGAAGCTCTTGTAACGGTTGCT
CAACATAAACTTCATGATTTTCCTTTGGTCTGTGAAGATTTTGTTAAAGA
GAAAATTGTAGACCTGCTAGCTGTAATTCATCAGGATGTATTCTCGAATT
GCCTTAAGTATTTCAATCAGTATAGGAGGTCAGTGCAAATAACCCAAAAA
TCGTATTTATCATATATTGACTTGTATAAAACCATGTACCAAACTACGAA
AGCTAGCGTATCTTTATTAAATGAACGAATGCAAAATGGTTTGCAAAAGT
TAAAAGAAGCCCAAGAGGCAATTATTCTACTTAGCAAAGAATTAGAAATT
AAAGAAAGAAACCTTTCAGTTGCCAGTGCTGAAGCTGAAGCTGTATTAGC
CAATGTTACTAAACAAACAACAGCAGCTGAAGCCGTTAAAAATAAAGTTA
GAACGGTAAAAGATAAATGTGCTGCAATCGTTGAGAAAATACGTGTAGAT
CAGCAAGTTGCCGAAGAAAAGTTAACCGCGGCGAAACCAGCTCTTCAAGA
AGCCGAAGATGCATTAAATACCATTAAACCAAATGATATTTCAACTGTAA
GAAAATTACAGAAGCCTCCTCATCTTATTCAACGAATCATGGATTGCGTC
TTAATTTTATTCCAAAAGAAAATAGATCCATATATTCCCGATCATGAAAG
AAAGGGTGTCAAAACATCTTGGGTTGAATCGTTGAAATTGTTAGCGTCTA
CCAATTTCCTGAACAGCTTGCTGACATTTCCTAGAGATTTGATCAATGAG
GAAATTATAGACTTGCTGCAACCATATTTTACAAGAGAAGACTATCATCT
TGAAGCAGCTCGGAAATCCTGTGGAAATGTAGCAGGGTTGTGTGCATGGA
CGAAAGCCATGGAAAAGTTTTATTGGGTGAATAGAGAAGTTATACCTTTG
AAAGATCATTTGGCATCACAGAATATAATTCTCGCAAAAGCACAGGATGA
TTTGCAATCTGCTGAAAAGGTTCTCACAGAAAAAGAAGAGGTATTGGCTC
TTGTCAAATTGGAATACGATACTGCAATTAAAAGAAAACAAGCTCTTGAA
AGTGATGCTGCCATGTGTCGCAAGAAAATGTCTACAGCCAATCAGTTAAT
GAATGGACTAAAAGATGAAAAGGCTCGTTGGACATTGCAGAGTATAGAGT
TTGAATCTCAAATAGGTTTATTAGTTGGGGATATGGTGGTATTGTCAGCT
TTTGTTTCCTATTGTGGACCTTTCAATCAACAATTCCGTCTCAAAATGTT
CAGCCATTGGGAATCTGTAATTCGGAACAACGGGGTACCAATAAATAAGA
CTATTGACATTGTTGAAAAATTATCCAATCCTAATCAAATTGGTGAATGG
AATCTCCAAGGACTCCCTAATGACAAGCTATCCGTTGAGAATGCTATCAT
CGTCACCCAAGCTTCAAGATATTCACTGTTCATTGACCCTCAAAGTCAAG
GTAAACATTGGATTCTTAATAAAGAAACCGAGCATCATATAATGACGACA
AATTTTACGAATAAATATTTCCAACAGCATTTAGAAGATGCTCTGACAAA
TGGTCACCCTTTGATCATTGAGGATATTACAGAAGAATTGGATCCAGCAT
TGAATAATGTTTTGGAAAAGAACTTTATAAAGATTGGAACCGGACTAAAG
GTTAAAGTCGGTGATAAAGAAGTTGACATTCACAAAAAATTTAACTTATA
TATAACAACAAAGTTATCTAATCCACATTTTTCTCCTGAAATCTATGCAA
AGACATCAGTGATTGATTTTAGTGTAACTATGAAGGGGTTAGAAGATCAA
CTTTTAGGAATTGTTATAAACATTGAAAAAGAAGAATTGGAGAACTCTAG
AAATCAACTACTTAAGCAGACTAGTAACAATAAAAGAAAAGTTAAAGAAT
TAGAAGATAGTTTATTGGAAAGATTAGCAAATACGGAAGGGTCTTTGGTT
GAAGATCAAAATTTGTTAATGGTTTTAAACAAAGCCAAACAAACATCTTA
TGACGTGAGCATTCAAATAGCTCAAGCGGCTGACACCGAAAGAGAGATTA
ATCAGGCTAGGGAAGAATATCGTTCAATTTCAAAACGAGGATCTCTACTC
TATTTTTTAATAACTGACCTAAGCGGTGTCAATCCGATGTATCAGTCTGG
TCTAAAGCAATTTCTTAATCTTTTTGTCAATTCCATAATTGAATCGGAAA
AGTCTCCTTTCATCCAGCGAAGAATTCAGCACATTATATCATGCATGACT
GTAAATATTTGGAATTTTATTGTTCGAAGTCTTTATAAAATCGATCGTAC
TACGTTTACCCTTTTGCTTGCACTAAAGGTCGATATGGAAAACAACTCAG
TGCGTCAGGAAGAACTAAATGTTTTATTAAAGGGTGGATCAGCTCTAGAC
CTAAAGACAATAGATCCAAAACCAATTAAATGGATTGTAGATATGACATG
GCTTAATCTAGTGGCATTGTCAAAGCTACATGTATTCAGTGGACTAGTGG
AACAGATAGTATCGTCAGAAAAACAGTGGCGGGCTTGGTTTGATAAAGAT
GCTCCTGAAGATGAAGACATCCCATGCGGCTATGAAGCAATTCTTGATGA
ATTCAAAAAGTTATTACTAATCCGATGCTGGTGTCCAGACCGAACATTAA
TAATGGCTAGACGATATATTTGCAGGACGCTGGGCGATCATTTCATTGAA
GATGTTCCGTTCAAGATTGGATCACTGTCTCGCGAAGCCGATGCAAAAAC
TCCCTTACTTGGATTGCTTAGTCTAGGAGCTGATCCTACACCACTGATTG
AGCATCATGCTAAAAAGCATCATATTCAAATAGGAACTATTTCAATGGGA
CAAGGTCAGGAAGTGCATTCTAGAAGAGTCATAGCGAAAGCAATGCAAGA
AGGAACTTGGGTGCTGTTACAGAATTGTCATTTATCCTTGGATTATATGG
AGGAATTGATGGATCAAATGATCGAAACGGAAGTCATTCACGATGATTTC
AGGCTCTGGGTTACAACTGAGATACACCCAAAATTCCCAATATCTTTCCT
GCAAATGAGTATCAAGTTTACCAATGAACCGCCTCAAGGAATCAAGGCTG
GAATCAAAAGAACATACACGAGTTTTAATCAGGATTTCCTGGATATCAGC
AACATGATGCAATGGCGCCCAATGGTCTATGCGGTGGCATACTTGCACAC
TTGCGTACAGGAACGCAGGAAATTCGGCCCGCTTGGATGGAATATTCCCT
ATGAATACAATACGGCTGACTTGAACGCTAGTCTCCAATTCGTGCAGAAT
CATCTCGACGACATGGACATCAAAAAGGGCATGAGTTGGAAAACAATCTG
TTACATGCTCGGTGAAATACAATATGGGGGCCGGGTTACTGATGACTATG
ACAAAAGGCTTTTGAACACCTTCTGCCGCCGCTGGTTCAATGATGACATG
TTCAACCCAAAATTCAGATTTTTTAAGGATCACAGCATTCCAGCAGTGTC
AAAGCTCAATGAGTACATAGATATCATAAATGAATTACCGAATTATGACA
GTCCAGAAATGTTTGGGTTGCACTCCAATGCTGACATTACCTATCAAAGT
AAGACAGCACAATCAATATTGGACTGTATTTTAAACATCCAACCGAAGGA
CGCCAGTGCCGGAGGAGGTGAGACGAGAGAAAGTGTAGTGTATCGAATGT
GTGACGACATGCTGGGGAAATTGCCATCTGATTACGTGTCATTTGAAGTG
ATGGAACGCTTGCAAATAATGGGAATCCTGCAACCGATGAATATCTTTCT
GAGACAAGAAGTTGATAGAATGCAGAAAGTGATCGCTAAGGTGCGTACAA
CGCTGATCGATTTAAAACTCGCAATTGACGGAACGATAATTATGAATGAG
GATCTCAGAGACGCGCTGGATTCGATGTATGACGCGAGAATTCCGAGCTC
TTGGTCTAAGGTTTCATGGGAGTCTTCAACGCTTGGGTTTTGGTTCACGG
AATTGATCGAAAGGAATTCACAATTCTCAACATGGCTGTTCAAAGGTCGA
CCAAACTGCTTCTGGATGACAGGGTTCTTTAATGTTCAAGGGTTCCTGAC
GGCTATGCGACAGGAGGTGACTCGGGCTCACAAGGGCTGGGCCTTGGATA
CGGTTGTGCTATGGAATGATGTCACCAAGCACATGCAGGATGAGATCAAC
CAACCACCCTCGGAGGGCGTCTACGTGTACGGATTATATTTGGAAGGTGC
AGGCTGGGACCGGAGAAACAGCAAGTTGATCGAATCTAAATCAAAAGTCC
TATTCGAGCCGTTGCCAGTCATTTTGATCCAGGCCATTGACATATCGAAA
GAAGGTGAAATCTCCAGAGATCTCCTGAAGAACATGTATCAATGCCCTGT
GTACAAAAAACCAAGGAGAACGGATCTGACATTTATTGCCTCAGTTTATC
TCAGATGTCCTCCAACTAAGCAAGCCGACCATTGGACTTTGCGAGCAGTG
GCGCTCTTGTGCGATATTAAATAGGTCTGTGGTGGAAAACATTTCTGACA
TGTGATTTGATTGACTGTTTACTTTTTATCGATTATTTTCCCCTTTATAT
GCCTGTGCCATTATTGATTTGTAAAAATATGCTCTTATTTGATTGGCTGT
TTGCTTTTTATCGATAATA
back to top

protein sequence of SMED30015079-orf-1

>SMED30015079-orf-1 ID=SMED30015079-orf-1|Name=SMED30015079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=182bp
SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTID
DFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPL
LKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLR
GDHTSTTCRSRKTSRIWYQNCRIPVKSSSNG*
back to top

protein sequence of SMED30015079-orf-2

>SMED30015079-orf-2 ID=SMED30015079-orf-2|Name=SMED30015079-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3025bp
MVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDK
SWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKK
RLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYE
TILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNS
INDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTN
EQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKS
PSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTD
RCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQM
DFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERK
KQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPD
RQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILS
VLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFP
GIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMT
LGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTN
DWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLT
LANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLK
GWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACD
LLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYI
RSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTP
EYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSK
NPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFID
DINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMI
HPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRS
SVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINT
QSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVV
EFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKER
LSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGG
SGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGT
VFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKF
FPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGC
TINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSN
CLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQK
LKEAQEAIILLSKELEIKERNLSVASAEAEAVLANVTKQTTAAEAVKNKV
RTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTV
RKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLAS
TNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAW
TKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSAEKVLTEKEEVLA
LVKLEYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIE
FESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINK
TIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQ
GKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPA
LNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYA
KTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKE
LEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREI
NQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESE
KSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNS
VRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLV
EQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTL
IMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLI
EHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLSLDYM
EELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKA
GIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIP
YEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDY
DKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYD
SPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRM
CDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRT
TLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFT
ELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALD
TVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKV
LFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVY
LRCPPTKQADHWTLRAVALLCDIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR043157Dynein_AAA1S
IPR035699AAA_6
IPR042222Dynein_2_N
IPR042228Dynein_2_C
IPR041466Dynein_AAA5_ext
IPR026983DHC_fam
IPR013602Dynein_heavy_dom-2
IPR013518K_chnl_inward-rec_Kir_cyto
IPR003593AAA+_ATPase
IPR024317Dynein_heavy_chain_D4_dom
IPR024743Dynein_HC_stalk
IPR027417P-loop_NTPase
IPR011704ATPase_dyneun-rel_AAA
IPR004273Dynein_heavy_D6_P-loop
Vocabulary: molecular function
TermDefinition
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0003777microtubule motor activity
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0003341cilium movement
GO:0007368determination of left/right symmetry
GO:0007507heart development
GO:0008150biological_process
GO:0021670lateral ventricle development
GO:0030317flagellated sperm motility
GO:0036158outer dynein arm assembly
GO:0060271cilium morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0005575cellular_component
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005858axonemal dynein complex
GO:0005874microtubule
GO:0005929cilium
GO:0005930axoneme
GO:0036157outer dynein arm
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.472.130coord: 838..939
e-value: 2.0E-7
score: 32.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 955..1058
e-value: 3.9E-30
score: 106.9
NoneNo IPR availableGENE3DG3DSA:1.20.58.1120coord: 201..346
e-value: 2.9E-41
score: 143.1
NoneNo IPR availablePFAMPF12775AAA_7coord: 946..1058
e-value: 2.3E-36
score: 125.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 610..837
e-value: 8.4E-79
score: 266.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 347..498
e-value: 2.1E-67
score: 227.8
NoneNo IPR availablePANTHERPTHR10676:SF361DYNEIN HEAVY CHAIN 8, AXONEMALcoord: 2..1059
IPR043157Dynein heavy chain, AAA1 domain, small subdomainGENE3DG3DSA:1.10.8.710coord: 499..606
e-value: 5.5E-33
score: 115.8
IPR035699Dynein heavy chain, hydrolytic ATP-binding dynein motor regionPFAMPF12774AAA_6coord: 332..659
e-value: 4.1E-143
score: 476.2
IPR042222Dynein heavy chain, domain 2, N-terminalGENE3DG3DSA:1.20.140.100coord: 1..101
e-value: 3.6E-36
score: 126.1
IPR013602Dynein heavy chain, domain-2PFAMPF08393DHC_N2coord: 3..197
e-value: 9.7E-70
score: 235.7
IPR042228Dynein heavy chain, domain 2, C-terminalGENE3DG3DSA:3.20.180.20coord: 103..200
e-value: 9.1E-25
score: 88.8
IPR041466Dynein heavy chain, AAA 5 extension domainPFAMPF17852Dynein_AAA_lidcoord: 816..936
e-value: 2.2E-19
score: 69.8
IPR026983Dynein heavy chainPANTHERPTHR10676DYNEIN HEAVY CHAIN FAMILY PROTEINcoord: 2..1059
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 349..563
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 579..783