Eyes absent homolog

Overview
NameEyes absent homolog
Smed IDSMED30015071
Length (bp)1754
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eyes absent homolog (SMED30015071) t-SNE clustered cells

Violin plots show distribution of expression levels for Eyes absent homolog (SMED30015071) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eyes absent homolog (SMED30015071) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eyes absent homolog (SMED30015071) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015071

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
oviductSMED30015071SMESG000001561.1 SMED30015071smed_20140614PMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
nervous systemSMED30015071SMESG000001561.1 dd_Smed_v4_11372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015071SMESG000001561.1 dd_Smed_v4_11372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015071SMESG000001561.1 dd_Smed_v4_11372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015071SMESG000001561.1 dd_Smed_v4_11372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015071SMESG000001561.1 dd_Smed_v4_11372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015071SMESG000040512.1 SMESG000003282.1 SMESG000001561.1 Contig52495newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015071SMESG000040512.1 SMESG000003282.1 SMESG000001561.1 Contig52495uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015071SMESG000001561.1 Contig46265newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015071SMESG000001561.1 Contig46265uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30015071SMESG000001561.1 dd_Smed_v6_11372_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015071SMESG000001561.1 SMED30015071smed_20140614PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30015071SMESG000001561.1 SMED30015071smed_20140614PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30015071SMESG000001561.1 SMED30015071smed_20140614PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30015071SMESG000001561.1 OX_Smed_1.0.11562ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
optic cupSMED30015071SMESG000001561.1 SMED30015071smed_20140614PMID:21852957
Lapan et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
trail cellSMED30015071SMESG000001561.1 SMED30015071smed_20140614PMID:21852957
Lapan et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx musculatureSMED30015071SMESG000001561.1 dd_Smed_v4_11372_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eyes absent homolog vs. Ensembl Human
Match: EYA1 (EYA transcriptional coactivator and phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:3519])

HSP 1 Score: 465.307 bits (1196), Expect = 4.305e-158
Identity = 232/370 (62.70%), Postives = 265/370 (71.62%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSES---QSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A    VT+         SP     DS+S   +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  211 TSPTTPSTNATYQLQEPPSGITSQA----VTDPTAEYSTIHSPSTPIKDSDSDRLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL 558          
BLAST of Eyes absent homolog vs. Ensembl Human
Match: EYA1 (EYA transcriptional coactivator and phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:3519])

HSP 1 Score: 465.307 bits (1196), Expect = 4.695e-158
Identity = 232/370 (62.70%), Postives = 265/370 (71.62%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSES---QSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A    VT+         SP     DS+S   +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  212 TSPTTPSTNATYQLQEPPSGITSQA----VTDPTAEYSTIHSPSTPIKDSDSDRLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL 559          
BLAST of Eyes absent homolog vs. Ensembl Human
Match: EYA1 (EYA transcriptional coactivator and phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:3519])

HSP 1 Score: 466.077 bits (1198), Expect = 5.921e-158
Identity = 232/370 (62.70%), Postives = 265/370 (71.62%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSES---QSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A    VT+         SP     DS+S   +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  239 TSPTTPSTNATYQLQEPPSGITSQA----VTDPTAEYSTIHSPSTPIKDSDSDRLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL 586          
BLAST of Eyes absent homolog vs. Ensembl Human
Match: EYA1 (EYA transcriptional coactivator and phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:3519])

HSP 1 Score: 466.077 bits (1198), Expect = 7.493e-158
Identity = 232/370 (62.70%), Postives = 265/370 (71.62%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSES---QSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A    VT+         SP     DS+S   +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  245 TSPTTPSTNATYQLQEPPSGITSQA----VTDPTAEYSTIHSPSTPIKDSDSDRLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL 592          
BLAST of Eyes absent homolog vs. Ensembl Human
Match: EYA1 (EYA transcriptional coactivator and phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:3519])

HSP 1 Score: 466.077 bits (1198), Expect = 7.493e-158
Identity = 232/370 (62.70%), Postives = 265/370 (71.62%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSES---QSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A    VT+         SP     DS+S   +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  245 TSPTTPSTNATYQLQEPPSGITSQA----VTDPTAEYSTIHSPSTPIKDSDSDRLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL 592          
BLAST of Eyes absent homolog vs. Ensembl Celegans
Match: eya-1 (Eyes absent homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:O17670])

HSP 1 Score: 98.5969 bits (244), Expect = 1.253e-21
Identity = 76/304 (25.00%), Postives = 144/304 (47.37%), Query Frame = 3
Query:  840 RIFVWDLDETIIIFHSLLTGI-YAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELY--NSYRNNVGGL----------------LGTQKREHWLQLRQDIETLTD---NWLTLALKALTLISQRNNC-----VNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHAL 1670
            R+F+WD+D+  +I  + L  + +  ++   A+ +V+    ME +     +N    N+  E D  +I+D   D+                          T +  GP+      ++RG +D MR++A +Y   ++ Y  NS +N+V G                  G ++     Q    ++TL +    W   A + + L+ +++        NV+++   LV   A++++ GL     +ENIYS +K GKES FE+I SRFG+K +++ +  G D   +A++++ P W ++S++D+  L+ AL
Sbjct:  232 RVFIWDIDDIAVISRNYLASVTHTNEFYARAANSVSH--LMERIAL---NNFADVNEFLEGDITNIEDAVVDE--------------------------TTMDSGPID-----NLRG-LDVMRRVAPKYSAFRQFYTENSTKNDVAGFKQEQNGFNFELLERVGFGAREATELYQSAIQLQTLPNFGQRW-PCAQRCMDLVVEKSKLSAEKYANVVLSNDGLVLGAAQLMISGLNSSVPVENIYSISKQGKESVFEKIQSRFGKKCSFICITSG-DTANSAKRLNIPVWPLNSNTDLDKLYSAL 496          
BLAST of Eyes absent homolog vs. Ensembl Celegans
Match: eya-1 (Eyes absent homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:O17670])

HSP 1 Score: 98.2117 bits (243), Expect = 1.443e-21
Identity = 76/304 (25.00%), Postives = 144/304 (47.37%), Query Frame = 3
Query:  840 RIFVWDLDETIIIFHSLLTGI-YAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELY--NSYRNNVGGL----------------LGTQKREHWLQLRQDIETLTD---NWLTLALKALTLISQRNNC-----VNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHAL 1670
            R+F+WD+D+  +I  + L  + +  ++   A+ +V+    ME +     +N    N+  E D  +I+D   D+                          T +  GP+      ++RG +D MR++A +Y   ++ Y  NS +N+V G                  G ++     Q    ++TL +    W   A + + L+ +++        NV+++   LV   A++++ GL     +ENIYS +K GKES FE+I SRFG+K +++ +  G D   +A++++ P W ++S++D+  L+ AL
Sbjct:  198 RVFIWDIDDIAVISRNYLASVTHTNEFYARAANSVSH--LMERIAL---NNFADVNEFLEGDITNIEDAVVDE--------------------------TTMDSGPID-----NLRG-LDVMRRVAPKYSAFRQFYTENSTKNDVAGFKQEQNGFNFELLERVGFGAREATELYQSAIQLQTLPNFGQRW-PCAQRCMDLVVEKSKLSAEKYANVVLSNDGLVLGAAQLMISGLNSSVPVENIYSISKQGKESVFEKIQSRFGKKCSFICITSG-DTANSAKRLNIPVWPLNSNTDLDKLYSAL 462          
BLAST of Eyes absent homolog vs. Ensembl Fly
Match: eya (gene:FBgn0000320 transcript:FBtr0306113)

HSP 1 Score: 422.55 bits (1085), Expect = 4.042e-140
Identity = 202/343 (58.89%), Postives = 250/343 (72.89%), Query Frame = 3
Query:  657 AGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +G  + ++T  + K   + G  +    S ++S  S  GNSE    P              ER+FVWDLDET+IIFH+LL+G YA +Y KD S+ + +  RMEE++F++AD H FFN++EECDQVHIDDVSSDDNGQDLS YNF  DGF          +    G P  L   T VRGGVDWMRKLAFRYR+IK++YNSYR NVG LLG  KRE WLQ+R +IE  TDNW TLALK L++ISQR NCVNVLVT+TQL PALAKVLL+GLGG+F IENIYSA+KIG E+C+ERI +RFGRKSTYVV+GDG +EETAA+ +++PFWRIS+HSDI AL+ AL +G+L
Sbjct:  358 SGGVATSKTTPTGKTGRARG-RRHQQPSPTRSTASDTGNSEAVKPP--------------ERVFVWDLDETLIIFHTLLSGSYANRYTKDHSSLMTIAFRMEEMVFNMADTHFFFNEIEECDQVHIDDVSSDDNGQDLSAYNFATDGFH---------TNTPPGAPPNLCLPTGVRGGVDWMRKLAFRYRKIKDIYNSYRGNVGTLLGPGKREAWLQIRSEIEVATDNWATLALKCLSMISQRENCVNVLVTSTQLAPALAKVLLFGLGGIFNIENIYSAHKIGHETCYERIVTRFGRKSTYVVIGDGNEEETAAKAMNFPFWRISAHSDIRALYTALDMGFL 676          
BLAST of Eyes absent homolog vs. Ensembl Fly
Match: eya (gene:FBgn0000320 transcript:FBtr0079335)

HSP 1 Score: 422.55 bits (1085), Expect = 4.410e-139
Identity = 202/343 (58.89%), Postives = 250/343 (72.89%), Query Frame = 3
Query:  657 AGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +G  + ++T  + K   + G  +    S ++S  S  GNSE    P              ER+FVWDLDET+IIFH+LL+G YA +Y KD S+ + +  RMEE++F++AD H FFN++EECDQVHIDDVSSDDNGQDLS YNF  DGF          +    G P  L   T VRGGVDWMRKLAFRYR+IK++YNSYR NVG LLG  KRE WLQ+R +IE  TDNW TLALK L++ISQR NCVNVLVT+TQL PALAKVLL+GLGG+F IENIYSA+KIG E+C+ERI +RFGRKSTYVV+GDG +EETAA+ +++PFWRIS+HSDI AL+ AL +G+L
Sbjct:  448 SGGVATSKTTPTGKTGRARG-RRHQQPSPTRSTASDTGNSEAVKPP--------------ERVFVWDLDETLIIFHTLLSGSYANRYTKDHSSLMTIAFRMEEMVFNMADTHFFFNEIEECDQVHIDDVSSDDNGQDLSAYNFATDGFH---------TNTPPGAPPNLCLPTGVRGGVDWMRKLAFRYRKIKDIYNSYRGNVGTLLGPGKREAWLQIRSEIEVATDNWATLALKCLSMISQRENCVNVLVTSTQLAPALAKVLLFGLGGIFNIENIYSAHKIGHETCYERIVTRFGRKSTYVVIGDGNEEETAAKAMNFPFWRISAHSDIRALYTALDMGFL 766          
BLAST of Eyes absent homolog vs. Ensembl Fly
Match: eya (gene:FBgn0000320 transcript:FBtr0079334)

HSP 1 Score: 422.165 bits (1084), Expect = 5.806e-139
Identity = 202/343 (58.89%), Postives = 250/343 (72.89%), Query Frame = 3
Query:  657 AGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +G  + ++T  + K   + G  +    S ++S  S  GNSE    P              ER+FVWDLDET+IIFH+LL+G YA +Y KD S+ + +  RMEE++F++AD H FFN++EECDQVHIDDVSSDDNGQDLS YNF  DGF          +    G P  L   T VRGGVDWMRKLAFRYR+IK++YNSYR NVG LLG  KRE WLQ+R +IE  TDNW TLALK L++ISQR NCVNVLVT+TQL PALAKVLL+GLGG+F IENIYSA+KIG E+C+ERI +RFGRKSTYVV+GDG +EETAA+ +++PFWRIS+HSDI AL+ AL +G+L
Sbjct:  442 SGGVATSKTTPTGKTGRARG-RRHQQPSPTRSTASDTGNSEAVKPP--------------ERVFVWDLDETLIIFHTLLSGSYANRYTKDHSSLMTIAFRMEEMVFNMADTHFFFNEIEECDQVHIDDVSSDDNGQDLSAYNFATDGFH---------TNTPPGAPPNLCLPTGVRGGVDWMRKLAFRYRKIKDIYNSYRGNVGTLLGPGKREAWLQIRSEIEVATDNWATLALKCLSMISQRENCVNVLVTSTQLAPALAKVLLFGLGGIFNIENIYSAHKIGHETCYERIVTRFGRKSTYVVIGDGNEEETAAKAMNFPFWRISAHSDIRALYTALDMGFL 760          
BLAST of Eyes absent homolog vs. Ensembl Zebrafish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 436.802 bits (1122), Expect = 2.501e-146
Identity = 210/303 (69.31%), Postives = 233/303 (76.90%), Query Frame = 3
Query:  786 NNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDD SSDDNGQDL  Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFERI SRFG   TYVV+GDG+DEE AA Q + PFWRISSHSD++ALH AL   YL
Sbjct:  332 NNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPLAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDASSDDNGQDLGTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTSALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGRDEEHAASQHNMPFWRISSHSDLLALHQALEFEYL 613          
BLAST of Eyes absent homolog vs. Ensembl Zebrafish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 436.417 bits (1121), Expect = 6.485e-146
Identity = 210/303 (69.31%), Postives = 233/303 (76.90%), Query Frame = 3
Query:  786 NNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDD SSDDNGQDL  Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFERI SRFG   TYVV+GDG+DEE AA Q + PFWRISSHSD++ALH AL   YL
Sbjct:  355 NNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPLAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDASSDDNGQDLGTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTSALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGRDEEHAASQHNMPFWRISSHSDLLALHQALEFEYL 636          
BLAST of Eyes absent homolog vs. Ensembl Zebrafish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 436.032 bits (1120), Expect = 8.553e-146
Identity = 210/303 (69.31%), Postives = 233/303 (76.90%), Query Frame = 3
Query:  786 NNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDD SSDDNGQDL  Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFERI SRFG   TYVV+GDG+DEE AA Q + PFWRISSHSD++ALH AL   YL
Sbjct:  357 NNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPLAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDASSDDNGQDLGTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTSALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGRDEEHAASQHNMPFWRISSHSDLLALHQALEFEYL 638          
BLAST of Eyes absent homolog vs. Ensembl Zebrafish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 433.721 bits (1114), Expect = 3.685e-145
Identity = 207/303 (68.32%), Postives = 232/303 (76.57%), Query Frame = 3
Query:  786 NNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDD SSDDNGQDL  Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFER+  RFGRK  YVV+GDG +EE AA + + PFWRISSHSD++ALH AL   YL
Sbjct:  332 NNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPLAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDASSDDNGQDLGTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTSALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERVMQRFGRKVVYVVIGDGVEEEQAAAKHNMPFWRISSHSDLLALHQALEFEYL 613          
BLAST of Eyes absent homolog vs. Ensembl Zebrafish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 432.95 bits (1112), Expect = 1.304e-144
Identity = 207/303 (68.32%), Postives = 232/303 (76.57%), Query Frame = 3
Query:  786 NNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDD SSDDNGQDL  Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFER+  RFGRK  YVV+GDG +EE AA + + PFWRISSHSD++ALH AL   YL
Sbjct:  355 NNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPLAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDASSDDNGQDLGTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTSALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERVMQRFGRKVVYVVIGDGVEEEQAAAKHNMPFWRISSHSDLLALHQALEFEYL 636          
BLAST of Eyes absent homolog vs. Ensembl Xenopus
Match: EYA4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:100487615])

HSP 1 Score: 443.351 bits (1139), Expect = 1.835e-149
Identity = 222/361 (61.50%), Postives = 264/361 (73.13%), Query Frame = 3
Query:  603 STTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            S++  YQL +    L +  G    T    ++++  +P    DD   ++   +S     +  NNP P   SD      LER+F+WDLDETIIIFHSLLTG +AQKY KD+ TAV LGLRMEE+IF+LAD H+FFNDLEECDQVH+DDVSSDDNGQDLS+Y+F  DGF   AS             L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGL G  KRE WLQLR D+E LTD+WL+ ALK+L+LIS R+N VNVLVTTTQL+PAL+KVLLY LGGVF IENIYSA K+GKESCFERI  RFGRK  YVV+GDG +EE AA++ + PFWRISSHSD++ALH AL L YL
Sbjct:  222 SSSSTYQLQDSLSGLTTQPGTDLQTGEFDAVQSPSTPIKDLDDRTCRTAGSKSRGRGRK--NNPSPPPDSD------LERVFIWDLDETIIIFHSLLTGTFAQKYGKDSPTAVTLGLRMEEMIFNLADAHLFFNDLEECDQVHVDDVSSDDNGQDLSSYSFATDGFRAAASSTT----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLFGPAKREAWLQLRADLEVLTDSWLSNALKSLSLISTRSNSVNVLVTTTQLIPALSKVLLYSLGGVFPIENIYSATKVGKESCFERIIQRFGRKVVYVVIGDGVEEEQAAKKNNMPFWRISSHSDLLALHQALELEYL 562          
BLAST of Eyes absent homolog vs. Ensembl Xenopus
Match: EYA4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:100487615])

HSP 1 Score: 442.58 bits (1137), Expect = 3.906e-149
Identity = 222/361 (61.50%), Postives = 264/361 (73.13%), Query Frame = 3
Query:  603 STTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            S++  YQL +    L +  G    T    ++++  +P    DD   ++   +S     +  NNP P   SD      LER+F+WDLDETIIIFHSLLTG +AQKY KD+ TAV LGLRMEE+IF+LAD H+FFNDLEECDQVH+DDVSSDDNGQDLS+Y+F  DGF   AS             L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGL G  KRE WLQLR D+E LTD+WL+ ALK+L+LIS R+N VNVLVTTTQL+PAL+KVLLY LGGVF IENIYSA K+GKESCFERI  RFGRK  YVV+GDG +EE AA++ + PFWRISSHSD++ALH AL L YL
Sbjct:  226 SSSSTYQLQDSLSGLTTQPGTDLQTGEFDAVQSPSTPIKDLDDRTCRTAGSKSRGRGRK--NNPSPPPDSD------LERVFIWDLDETIIIFHSLLTGTFAQKYGKDSPTAVTLGLRMEEMIFNLADAHLFFNDLEECDQVHVDDVSSDDNGQDLSSYSFATDGFRAAASSTT----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLFGPAKREAWLQLRADLEVLTDSWLSNALKSLSLISTRSNSVNVLVTTTQLIPALSKVLLYSLGGVFPIENIYSATKVGKESCFERIIQRFGRKVVYVVIGDGVEEEQAAKKNNMPFWRISSHSDLLALHQALELEYL 566          
BLAST of Eyes absent homolog vs. Ensembl Xenopus
Match: EYA4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:100487615])

HSP 1 Score: 442.965 bits (1138), Expect = 6.224e-149
Identity = 211/301 (70.10%), Postives = 240/301 (79.73%), Query Frame = 3
Query:  783 NNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
             NNP P   SD      LER+F+WDLDETIIIFHSLLTG +AQKY KD+ TAV LGLRMEE+IF+LAD H+FFNDLEECDQVH+DDVSSDDNGQDLS+Y+F  DGF   AS             L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGL G  KRE WLQLR D+E LTD+WL+ ALK+L+LIS R+N VNVLVTTTQL+PAL+KVLLY LGGVF IENIYSA K+GKESCFERI  RFGRK  YVV+GDG +EE AA++ + PFWRISSHSD++ALH AL L YL
Sbjct:  309 KNNPSPPPDSD------LERVFIWDLDETIIIFHSLLTGTFAQKYGKDSPTAVTLGLRMEEMIFNLADAHLFFNDLEECDQVHVDDVSSDDNGQDLSSYSFATDGFRAAASSTT----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLFGPAKREAWLQLRADLEVLTDSWLSNALKSLSLISTRSNSVNVLVTTTQLIPALSKVLLYSLGGVFPIENIYSATKVGKESCFERIIQRFGRKVVYVVIGDGVEEEQAAKKNNMPFWRISSHSDLLALHQALELEYL 591          
BLAST of Eyes absent homolog vs. Ensembl Xenopus
Match: EYA4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:100487615])

HSP 1 Score: 443.736 bits (1140), Expect = 7.991e-149
Identity = 222/361 (61.50%), Postives = 264/361 (73.13%), Query Frame = 3
Query:  603 STTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            S++  YQL +    L +  G    T    ++++  +P    DD   ++   +S     +  NNP P   SD      LER+F+WDLDETIIIFHSLLTG +AQKY KD+ TAV LGLRMEE+IF+LAD H+FFNDLEECDQVH+DDVSSDDNGQDLS+Y+F  DGF   AS             L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGL G  KRE WLQLR D+E LTD+WL+ ALK+L+LIS R+N VNVLVTTTQL+PAL+KVLLY LGGVF IENIYSA K+GKESCFERI  RFGRK  YVV+GDG +EE AA++ + PFWRISSHSD++ALH AL L YL
Sbjct:  276 SSSSTYQLQDSLSGLTTQPGTDLQTGEFDAVQSPSTPIKDLDDRTCRTAGSKSRGRGRK--NNPSPPPDSD------LERVFIWDLDETIIIFHSLLTGTFAQKYGKDSPTAVTLGLRMEEMIFNLADAHLFFNDLEECDQVHVDDVSSDDNGQDLSSYSFATDGFRAAASSTT----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLFGPAKREAWLQLRADLEVLTDSWLSNALKSLSLISTRSNSVNVLVTTTQLIPALSKVLLYSLGGVFPIENIYSATKVGKESCFERIIQRFGRKVVYVVIGDGVEEEQAAKKNNMPFWRISSHSDLLALHQALELEYL 616          
BLAST of Eyes absent homolog vs. Ensembl Xenopus
Match: EYA4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:100487615])

HSP 1 Score: 443.736 bits (1140), Expect = 8.360e-149
Identity = 211/301 (70.10%), Postives = 240/301 (79.73%), Query Frame = 3
Query:  783 NNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
             NNP P   SD      LER+F+WDLDETIIIFHSLLTG +AQKY KD+ TAV LGLRMEE+IF+LAD H+FFNDLEECDQVH+DDVSSDDNGQDLS+Y+F  DGF   AS             L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGL G  KRE WLQLR D+E LTD+WL+ ALK+L+LIS R+N VNVLVTTTQL+PAL+KVLLY LGGVF IENIYSA K+GKESCFERI  RFGRK  YVV+GDG +EE AA++ + PFWRISSHSD++ALH AL L YL
Sbjct:  340 KNNPSPPPDSD------LERVFIWDLDETIIIFHSLLTGTFAQKYGKDSPTAVTLGLRMEEMIFNLADAHLFFNDLEECDQVHVDDVSSDDNGQDLSSYSFATDGFRAAASSTT----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLFGPAKREAWLQLRADLEVLTDSWLSNALKSLSLISTRSNSVNVLVTTTQLIPALSKVLLYSLGGVFPIENIYSATKVGKESCFERIIQRFGRKVVYVVIGDGVEEEQAAKKNNMPFWRISSHSDLLALHQALELEYL 622          
BLAST of Eyes absent homolog vs. Ensembl Mouse
Match: Eya1 (EYA transcriptional coactivator and phosphatase 1 [Source:MGI Symbol;Acc:MGI:109344])

HSP 1 Score: 463.766 bits (1192), Expect = 1.408e-157
Identity = 227/367 (61.85%), Postives = 264/367 (71.93%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A      E + ++ +  +P    D    +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWR+SSHSD++ALHHAL L YL
Sbjct:  211 TSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYS-TIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL 558          
BLAST of Eyes absent homolog vs. Ensembl Mouse
Match: Eya1 (EYA transcriptional coactivator and phosphatase 1 [Source:MGI Symbol;Acc:MGI:109344])

HSP 1 Score: 464.151 bits (1193), Expect = 2.179e-157
Identity = 227/367 (61.85%), Postives = 264/367 (71.93%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A      E + ++ +  +P    D    +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWR+SSHSD++ALHHAL L YL
Sbjct:  240 TSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYS-TIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL 587          
BLAST of Eyes absent homolog vs. Ensembl Mouse
Match: Eya1 (EYA transcriptional coactivator and phosphatase 1 [Source:MGI Symbol;Acc:MGI:109344])

HSP 1 Score: 463.766 bits (1192), Expect = 3.861e-157
Identity = 227/367 (61.85%), Postives = 264/367 (71.93%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A      E + ++ +  +P    D    +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWR+SSHSD++ALHHAL L YL
Sbjct:  244 TSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYS-TIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL 591          
BLAST of Eyes absent homolog vs. Ensembl Mouse
Match: Eya1 (EYA transcriptional coactivator and phosphatase 1 [Source:MGI Symbol;Acc:MGI:109344])

HSP 1 Score: 463.766 bits (1192), Expect = 3.861e-157
Identity = 227/367 (61.85%), Postives = 264/367 (71.93%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A      E + ++ +  +P    D    +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWR+SSHSD++ALHHAL L YL
Sbjct:  244 TSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYS-TIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL 591          
BLAST of Eyes absent homolog vs. Ensembl Mouse
Match: Eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:MGI Symbol;Acc:MGI:1337104])

HSP 1 Score: 451.055 bits (1159), Expect = 8.355e-152
Identity = 221/321 (68.85%), Postives = 246/321 (76.64%), Query Frame = 3
Query:  723 KDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            KD  +   +S  S +      NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   AS  N          L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGLLG  KR+ WLQLR +IE LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LGG F IENIYSA KIGKESCFERI SRFG   TYVV+GDG+DEE AA Q + PFWRISSHSD++ALH AL L YL
Sbjct:  314 KDLDDRTCRSSGSKSRGRGRKNNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAASSAN----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLLGPAKRDAWLQLRAEIEGLTDSWLTNALKSLSIISTRSNCVNVLVTTTQLIPALAKVLLYSLGGAFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGRDEEHAANQHNMPFWRISSHSDLLALHQALELEYL 616          
BLAST of Eyes absent homolog vs. UniProt/SwissProt
Match: sp|Q99502|EYA1_HUMAN (Eyes absent homolog 1 OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=2)

HSP 1 Score: 466.077 bits (1198), Expect = 3.598e-157
Identity = 232/370 (62.70%), Postives = 265/370 (71.62%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSES---QSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A    VT+         SP     DS+S   +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  245 TSPTTPSTNATYQLQEPPSGITSQA----VTDPTAEYSTIHSPSTPIKDSDSDRLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL 592          
BLAST of Eyes absent homolog vs. UniProt/SwissProt
Match: sp|P97767|EYA1_MOUSE (Eyes absent homolog 1 OS=Mus musculus OX=10090 GN=Eya1 PE=1 SV=3)

HSP 1 Score: 463.766 bits (1192), Expect = 2.701e-156
Identity = 227/367 (61.85%), Postives = 264/367 (71.93%), Query Frame = 3
Query:  585 TNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            T+P+ PST   YQL   P  + S A      E + ++ +  +P    D    +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YN+Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKAL+LI  R NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE  A++ + PFWR+SSHSD++ALHHAL L YL
Sbjct:  244 TSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYS-TIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL 591          
BLAST of Eyes absent homolog vs. UniProt/SwissProt
Match: sp|O95677|EYA4_HUMAN (Eyes absent homolog 4 OS=Homo sapiens OX=9606 GN=EYA4 PE=1 SV=2)

HSP 1 Score: 454.521 bits (1168), Expect = 4.504e-152
Identity = 229/362 (63.26%), Postives = 263/362 (72.65%), Query Frame = 3
Query:  600 PSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            PS+T  YQL    P L +  G         ++++  +P   KD  E   +S  S +      NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   AS  N          L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGLLG  KR+ WLQLR +IE LTD+WLT ALK+L++IS R+NC+NVLVTTTQL+PALAKVLLY LGG F IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE AA++ + PFWRISSHSD++ALH AL L YL
Sbjct:  304 PSSTSTYQLQESLPGLTNQPGEFD------TMQSPSTP--IKDLDERTCRSSGSKSRGRGRKNNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAASSAN----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLLGPAKRDAWLQLRAEIEGLTDSWLTNALKSLSIISTRSNCINVLVTTTQLIPALAKVLLYSLGGAFPIENIYSATKIGKESCFERIMQRFGRKVVYVVIGDGVEEEQAAKKHNMPFWRISSHSDLLALHQALELEYL 639          
BLAST of Eyes absent homolog vs. UniProt/SwissProt
Match: sp|Q9Z191|EYA4_MOUSE (Eyes absent homolog 4 OS=Mus musculus OX=10090 GN=Eya4 PE=2 SV=2)

HSP 1 Score: 451.055 bits (1159), Expect = 5.844e-151
Identity = 221/321 (68.85%), Postives = 246/321 (76.64%), Query Frame = 3
Query:  723 KDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            KD  +   +S  S +      NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   AS  N          L LP  T VRGGVDWMRKLAFRYRR+KELYN+Y+NNVGGLLG  KR+ WLQLR +IE LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LGG F IENIYSA KIGKESCFERI SRFG   TYVV+GDG+DEE AA Q + PFWRISSHSD++ALH AL L YL
Sbjct:  314 KDLDDRTCRSSGSKSRGRGRKNNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAASSAN----------LCLP--TGVRGGVDWMRKLAFRYRRVKELYNTYKNNVGGLLGPAKRDAWLQLRAEIEGLTDSWLTNALKSLSIISTRSNCVNVLVTTTQLIPALAKVLLYSLGGAFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGRDEEHAANQHNMPFWRISSHSDLLALHQALELEYL 616          
BLAST of Eyes absent homolog vs. UniProt/SwissProt
Match: sp|O08575|EYA2_MOUSE (Eyes absent homolog 2 OS=Mus musculus OX=10090 GN=Eya2 PE=1 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 5.643e-147
Identity = 220/380 (57.89%), Postives = 263/380 (69.21%), Query Frame = 3
Query:  570 SYCPPTNP-----SIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            SY PP  P     S P +T  Y L   P  +PS + + S+     +     +P    D       S     G S+ N++P P      A +NE+ER+FVWDLDETIIIFHSLLTG +A +Y KD +T+V +GL MEE+IF+LAD H+FFNDLE+CDQ+H+DDVSSDDNGQDLS YNF  DGF   A  AS+C G               T V GGVDWMRKLAFRYRR+KE+YN+YRNNVGGL+G  KRE WLQLR ++E LTD WLT +LKAL LI+ R NCVNVLVTTTQL+PALAKVLLYGLG VF IENIYSA K GKESCFERI  RFGRK+ Y+V+GDG +EE  A++ + PFWRIS H+D+ AL HAL L YL
Sbjct:  175 SYNPPYVPASSLCSSPLSTSTYVLQEAPHNVPSQS-SESLAGDYNTHNGPSTPAKEGDTERPHRASDGKLRGRSKRNSDPSP------AGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSTDGFHSTAPGASLCLG---------------TGVHGGVDWMRKLAFRYRRVKEMYNTYRNNVGGLIGAPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYIVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL 532          
BLAST of Eyes absent homolog vs. TrEMBL
Match: Q86FY6 (Eyes absent homolog OS=Dugesia japonica OX=6161 GN=eya PE=3 SV=1)

HSP 1 Score: 1050.43 bits (2715), Expect = 0.000e+0
Identity = 526/551 (95.46%), Postives = 540/551 (98.00%), Query Frame = 3
Query:   36 MFASSAATASLFGTNQPNXXXXXXXXXXYGLNNSEVAQQLVASVTASTSSYLSGYTDFEGVNSTACLDSTTDPNDVLTSSQAESLFNCALHQSGLYGQPYSMSSYLSDMPPTSEDNSLFASNFYNGLTGNYT-DQSQQQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVNTRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            MFAS AATASLFGT+Q NP +FPSFMSSYGLNNSEVAQQLVASVTASTSSYL+GY+DFEG+NS ACLD+TTDPNDVLTSSQAESLFNCALHQSGLYGQPYSMSSYLSDMPPTSEDNSLFA+NFYNGLTGNY+ DQ+ QQRN AYVYAYGYSPYISAMYAGIHSPC QIMNSMGSVVN+RSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETA+SLKASESPGLSKDDSESQSKSPQSCNGNSETNNN GPKI S+I NENELERIFVWDLDETIIIFHSLLTGIYAQ+YQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQV+WPFWRISSHSDIVALHHALSLGYL
Sbjct:    1 MFASGAATASLFGTSQTNPPTFPSFMSSYGLNNSEVAQQLVASVTASTSSYLTGYSDFEGINSIACLDATTDPNDVLTSSQAESLFNCALHQSGLYGQPYSMSSYLSDMPPTSEDNSLFATNFYNGLTGNYSSDQAHQQRNPAYVYAYGYSPYISAMYAGIHSPCHQIMNSMGSVVNSRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAVSLKASESPGLSKDDSESQSKSPQSCNGNSETNNNSGPKIPSEIVNENELERIFVWDLDETIIIFHSLLTGIYAQRYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVNWPFWRISSHSDIVALHHALSLGYL 551          
BLAST of Eyes absent homolog vs. TrEMBL
Match: T1E114 (Eyes absent homolog OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 322/432 (74.54%), Postives = 359/432 (83.10%), Query Frame = 3
Query:   36 MFASSAATASLFGTNQPNXXXXXXXXXXYGLNNSEVAQQLVASVTASTSSYLSGYTDFEGVNSTACLDSTTDPNDVL-----TSSQAESLFNCALHQSGLYGQPYSMSSYLSDMPPTSEDNSLFASNFYNGLTGNY-TDQSQQQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVNTRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLR 1313
            MF S + TASLFGTNQ N S+FPSFMSSY ++NSE   Q + S   ST+SYL  YTDF+  +ST    STTD NDVL     T+SQAESLFNCALHQS LY QPYSMS YL+DMP ++E +SLF SNFY+GL+G+Y TDQS  QR   YVY YGYSPYISAMYAGI+SPCQQIMNSM S+ NTR YC P+NPSIPSTTQKYQLINLPPA+PS AG+ +VTETAISLK S+SPG SKDD +S SKSP S  G S+ NNN   KI S+ +NE ELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADN+MFFNDLEECDQVHIDDVSSDDNGQDL+NYNFLVDGF+GP S+CNG   VIQGG LG+PG+T+VRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLG QK+   +  +
Sbjct:    1 MFGSGSTTASLFGTNQANSSTFPSFMSSYNMDNSE--GQHLPSTATSTTSYLGNYTDFDTTSSTTSAGSTTDTNDVLAASQLTTSQAESLFNCALHQSTLYNQPYSMSGYLADMPQSTEHSSLFGSNFYSGLSGSYNTDQSNSQRTHPYVYTYGYSPYISAMYAGINSPCQQIMNSMNSMANTRPYCGPSNPSIPSTTQKYQLINLPPAVPSMAGSTTVTETAISLKTSDSPGHSKDDCDSPSKSPLSGIGISDNNNNAMSKIPSEPSNETELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNNMFFNDLEECDQVHIDDVSSDDNGQDLTNYNFLVDGFSGPTSMCNG---VIQGG-LGIPGSTTVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGNQKKRSLVTTK 426          
BLAST of Eyes absent homolog vs. TrEMBL
Match: H6V054 (Eyes absent homolog (Fragment) OS=Schmidtea polychroa OX=50054 GN=eya PE=2 SV=1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 277/281 (98.58%), Postives = 279/281 (99.29%), Query Frame = 3
Query:  393 ASNFYNGLTGNYTDQSQQQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVNTRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIK 1235
            ASNFYNGLTGNY+DQS QQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVN+RSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNN GPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIK
Sbjct:    1 ASNFYNGLTGNYSDQSHQQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVNSRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNSGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIK 281          
BLAST of Eyes absent homolog vs. TrEMBL
Match: A0A433TNR0 (Eyes absent homolog OS=Elysia chlorotica OX=188477 GN=EGW08_009038 PE=3 SV=1)

HSP 1 Score: 485.723 bits (1249), Expect = 2.710e-164
Identity = 241/365 (66.03%), Postives = 284/365 (77.81%), Query Frame = 3
Query:  594 SIPSTTQKYQLINLPPALPSTAGNASVTE-TAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            ++PST Q YQL++ P +  ST G  + T+    +  AS SP L ++     S+S     G S T  +PGP        E++LER+FVWDLDETIIIFHSLLTG YAQ+Y KD   ++++GLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLSNYNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YNSYR+NVGGLLG+ KRE W+QLR +IETLTD+WLTLALK+L +IS R+NCVNVLVTTTQLVPALAKVLLYGLGGVF I+NIYSA KIGKESCFERI SRFGRK TYVVVGDG+DEE+A++Q++WPFWRIS+HSD+ ALHHAL LGYL
Sbjct:  129 TVPST-QTYQLLDTP-STTSTVGQPTATDGNNYNQLASPSPPLKENGQRGASRS----RGRSRTQPSPGP--------ESDLERVFVWDLDETIIIFHSLLTGSYAQRYTKDPQGSMSMGLRMEEVIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSNYNFATDGFHAAANNAN------------LCLATGVRGGVDWMRKLAFRYRRMKEIYNSYRSNVGGLLGSPKREQWMQLRHEIETLTDSWLTLALKSLQIISSRSNCVNVLVTTTQLVPALAKVLLYGLGGVFNIDNIYSATKIGKESCFERIVSRFGRKCTYVVVGDGRDEESASKQMNWPFWRISNHSDLAALHHALDLGYL 467          
BLAST of Eyes absent homolog vs. TrEMBL
Match: A0A1S3K8L1 (Eyes absent homolog OS=Lingula unguis OX=7574 GN=LOC106179425 PE=3 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 2.485e-162
Identity = 252/424 (59.43%), Postives = 296/424 (69.81%), Query Frame = 3
Query:  420 GNYTDQSQQQRNSAYVYAY-GYSPYIS-AMYAGIHSPCQQIMNSMGSVVNTRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            G YT Q        Y YAY GYS Y+S A  AG+ S                        + P +TQ Y+L++LPPA          T++  ++ +   P  ++ +  S+ +         + N +PGP        EN+LER+FVWDLDETIIIFHSLLTG YAQ+Y KD   +V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRRIKE+YNSYRNNVGGLLG QKR+ WLQLRQ+IE LTD+WL LALK+L +I+ R+NCVNVLVTTTQLVPALAKVLLYGLGGVF IENIYSA KIGKESCFERI SRFGRK TYVVVGDG+DEE AA+Q++WP+WR+S+HSD+ ALHHAL LGYL
Sbjct:  323 GGYTSQG------GYPYAYPGYSSYMSTADAAGLAS------------------------TSPPSTQTYKLVDLPPA---------TTDSQYNIPSPSPPLKAEANGRSRRRR--------QNNPSPGP--------ENDLERVFVWDLDETIIIFHSLLTGSYAQRYGKDPPQSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFQTDGFHAAATNAN------------LCLATGVRGGVDWMRKLAFRYRRIKEIYNSYRNNVGGLLGPQKRDQWLQLRQEIEALTDSWLNLALKSLQIINSRSNCVNVLVTTTQLVPALAKVLLYGLGGVFSIENIYSATKIGKESCFERIVSRFGRKCTYVVVGDGRDEEAAAKQMNWPYWRVSNHSDLAALHHALDLGYL 679          
BLAST of Eyes absent homolog vs. Ensembl Cavefish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 431.024 bits (1107), Expect = 5.046e-146
Identity = 210/305 (68.85%), Postives = 235/305 (77.05%), Query Frame = 3
Query:  783 NNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQR-NNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
             NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KDA  AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R +NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFER+  RFGRK  YVV+GDG +EE AA + + PFWRISSHSD++ALH AL   YL
Sbjct:  193 KNNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDAPMAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTTALKSLSIISSRFDNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERVMQRFGRKVVYVVIGDGVEEEQAAAKHNMPFWRISSHSDLLALHQALEFEYL 476          
BLAST of Eyes absent homolog vs. Ensembl Cavefish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 431.409 bits (1108), Expect = 2.079e-145
Identity = 210/305 (68.85%), Postives = 235/305 (77.05%), Query Frame = 3
Query:  783 NNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQR-NNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
             NNP P   SD      LER+FVWDLDETII+FHSLLTG YAQKY KDA  AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R +NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFER+  RFGRK  YVV+GDG +EE AA + + PFWRISSHSD++ALH AL   YL
Sbjct:  249 KNNPSPPPDSD------LERVFVWDLDETIIVFHSLLTGSYAQKYGKDAPMAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTTALKSLSIISSRFDNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERVMQRFGRKVVYVVIGDGVEEEQAAAKHNMPFWRISSHSDLLALHQALEFEYL 532          
BLAST of Eyes absent homolog vs. Ensembl Cavefish
Match: eya2 (EYA transcriptional coactivator and phosphatase 2 [Source:ZFIN;Acc:ZDB-GENE-040912-24])

HSP 1 Score: 426.017 bits (1094), Expect = 3.298e-144
Identity = 223/432 (51.62%), Postives = 288/432 (66.67%), Query Frame = 3
Query:  408 NGLTGNYTDQSQQQRNSAYVYAYG---YSPYISAMYAGIHSPCQQIMNSMGSVVNTRSYCPPTNPSIPST--TQKYQL-INLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            N +TG       QQ  SAY  +YG   YSPY +  Y   +     I  S  ++     Y  P +P++ ++   + +Q+  + PP+ P+                   PG  ++ + ++  S     G    N+ P P + SDI      ER+F+WDLDETIIIFHSLLTG ++ ++ KD++ AV+LGL MEE+IF+LAD+ +FFNDLEECDQVHIDDV+SDDNGQDLS YNF  DGF  PA           GG L L   + V GGVDWMRKLAFRYRR+KE+YN+++NNVGGLLG+ KRE WLQLR+++E LTD WLT ALKAL LI+ R NCVNV+VTTTQL+PAL+KVLLYGLGG F IENIYSA K GKESCFER++ RFGR++ YVV+GDG +EET A++ + PFWR++  +D+ AL HAL L YL
Sbjct:   78 NSITGTTPFSPTQQDFSAYS-SYGQSQYSPYYNTHYNNPYLTTSNI--SPSTITTAIPYQHPEHPAVTTSHSPESHQVEYHTPPSPPT-------------------PGKEQEGAPARRGSDGKLRGRKRAND-PVPPLDSDI------ERVFIWDLDETIIIFHSLLTGSFSTRFSKDSAKAVSLGLWMEEMIFNLADSRLFFNDLEECDQVHIDDVASDDNGQDLSTYNFGTDGFQSPAG----------GGALCL--GSGVHGGVDWMRKLAFRYRRVKEIYNTFKNNVGGLLGSPKREEWLQLRREMEALTDLWLTHALKALALINSRPNCVNVMVTTTQLIPALSKVLLYGLGGAFPIENIYSATKTGKESCFERVAQRFGRRAVYVVIGDGVEEETVAKKKNMPFWRVTCRADLEALSHALELDYL 468          
BLAST of Eyes absent homolog vs. Ensembl Cavefish
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-050327-93])

HSP 1 Score: 425.631 bits (1093), Expect = 6.160e-142
Identity = 201/289 (69.55%), Postives = 228/289 (78.89%), Query Frame = 3
Query:  828 NELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGF---AGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            ++   +FVWDLDETII+FHSLLTG YAQKY KDA  AV LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   A  AS+C                 T VRGGVDWMRKLAFRYRR+KELY +Y+NNVGGLLG  KRE WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG  F IENIYSA KIGKESCFER+  RFGRK  YVV+GDG +EE AA + + PFWRISSHSD++ALH AL   YL
Sbjct:  348 DQFYLVFVWDLDETIIVFHSLLTGSYAQKYGKDAPMAVTLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAATSASLCLA---------------TGVRGGVDWMRKLAFRYRRVKELYCTYKNNVGGLLGPAKREAWLQLRAEVEALTDSWLTTALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSAFPIENIYSATKIGKESCFERVMQRFGRKVVYVVIGDGVEEEQAAAKHNMPFWRISSHSDLLALHQALEFEYL 621          
BLAST of Eyes absent homolog vs. Ensembl Cavefish
Match: eya3 (eyes absent homolog 3 [Source:NCBI gene;Acc:103037529])

HSP 1 Score: 419.083 bits (1076), Expect = 2.567e-140
Identity = 217/400 (54.25%), Postives = 272/400 (68.00%), Query Frame = 3
Query:  540 NSMGSVVNTRSYCPPTN--PSIPSTT---------QKYQLINLPPALPSTAGNASVTETAISLKASESPGLS-------KDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            NS+G     + Y PP N  P+ P ++         Q Y  I    ++ +   + +VT  +++L A  +  +        +D  ES  ++P S           G K  S  + EN+LERIF+WDLDETIIIFHSLLTG +AQK+ KD +T + LGL+MEELIF LAD H+FFNDLEECDQVH++DV+SDDNGQDLSNYNF  DGF G A      ST            T V+GGV+WMRKLAFRYRR+KE+YN Y+ NVG LL   KRE  L++R +IET TD+WL+ A+K+L LI  R  C+NVLVTTTQLVPALAKVLLYGLG VF ++NIYSA KIGKESCFERI SRFG+K TYVV+GDG++EE AA+Q + PFWRIS+H D+V+LH AL L +L
Sbjct:  173 NSLGQNQFPQYYAPPANYLPAAPPSSEGDGAGVVVQNYTPIKTEDSVTAGLPSTTVTSPSVTLPAGAALPVGAPFSTAPRDQDESARRNPPS------KAKGKGKKPDSSQSTENDLERIFLWDLDETIIIFHSLLTGSFAQKFGKDPATVLNLGLQMEELIFELADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYNFASDGFNGAAGAGGPGST------------TGVQGGVEWMRKLAFRYRRLKEIYNGYKGNVGALLSPLKRELLLRVRSEIETATDSWLSTAIKSLLLIQSRGRCMNVLVTTTQLVPALAKVLLYGLGDVFPVDNIYSATKIGKESCFERIVSRFGKKVTYVVIGDGREEEFAAKQHNMPFWRISAHGDLVSLHQALELDFL 554          
BLAST of Eyes absent homolog vs. Ensembl Sea Lamprey
Match: eya1 (EYA transcriptional coactivator and phosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-990712-18])

HSP 1 Score: 425.631 bits (1093), Expect = 1.396e-142
Identity = 216/336 (64.29%), Postives = 252/336 (75.00%), Query Frame = 3
Query:  690 SLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVG----GLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +L++  +PG  K+  E   ++    +      NNP P    D      LER+F+WDLDETIIIFHSLLTG YA +Y KD  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQ LS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+YNSY+NNVG    GLLG  KR+ WLQLR +IE LTD+WLTLALK+L+L+  R+NC+NVLVTTTQLVPALAKVLLYGLG VF IENIYSA KIGKE+CFERI SRFGRK  YVVVGDG +EE A+++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  310 TLQSPTTPG--KESEERTRRASGGKSRGRGRRNNPSPPPDGD------LERVFIWDLDETIIIFHSLLTGSYATRYGKDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQHLSTYNFATDGFHASATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYNSYKNNVGVVGAGLLGPPKRDAWLQLRAEIEALTDSWLTLALKSLSLVHSRSNCINVLVTTTQLVPALAKVLLYGLGIVFPIENIYSATKIGKENCFERIMSRFGRKVVYVVVGDGVEEEQASKKHNMPFWRISSHSDLMALHHALELEYL 625          
BLAST of Eyes absent homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010369.1 (pep scaffold:Pmarinus_7.0:GL478893:143469:150485:-1 gene:ENSPMAG00000009390.1 transcript:ENSPMAT00000010369.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 252.677 bits (644), Expect = 2.360e-81
Identity = 126/205 (61.46%), Postives = 148/205 (72.20%), Query Frame = 3
Query:  996 FFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQV 1610
            F +  EECDQ HIDDVS+DDNGQDL  YNF  DGF   +           GG  GL   T VRGG +WMRKLAFRYR IKE+YN+Y+NN+ GLLG  K E WLQL  +IE LT++WL LA K L+LI  R+N  NVLVTTTQL+PAL+KVLLYG G VF I NI+SA K+GKESCFERI S +GRK  YVV+GDG +EE  A++V
Sbjct:    1 FLSVFEECDQSHIDDVSADDNGQDLGTYNFATDGFCTASG---------SGG--GLCAATGVRGGSEWMRKLAFRYRHIKEIYNTYKNNLPGLLGPVKGEAWLQLLPEIENLTESWLMLAHKCLSLIHSRSNSENVLVTTTQLIPALSKVLLYGFGEVFPINNIFSATKMGKESCFERIVSHYGRKVIYVVIGDGVEEEQVAKKV 194          
BLAST of Eyes absent homolog vs. Ensembl Nematostella
Match: EDO37382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG20])

HSP 1 Score: 434.491 bits (1116), Expect = 1.095e-150
Identity = 201/306 (65.69%), Postives = 249/306 (81.37%), Query Frame = 3
Query:  768 GNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            G   T++ P P++      ++ LERIF+WDLDETIIIFHSLLTG++A K+ KD+ ++VALGLRMEE+IF+LAD HMFFNDLE+CDQVHIDDV++DDNG DLS YNF  DGF   A+  N            L   T VRGGVDWMRKLA+RYR+IKE+Y+SYRNNVGGLLG  KRE WLQLR ++E+ TD+WLTLALKAL++I  R NC+N++VTTTQLVPALAK LLYGLG +F IENIYSA KIGKE+CFERI +RFG+K TY+VVGDG+DEETA+RQ+++PFWR+++HSD++ LHHAL LG+L
Sbjct:    3 GRRSTSSAPTPEL------DHSLERIFIWDLDETIIIFHSLLTGLFATKFGKDSPSSVALGLRMEEMIFNLADTHMFFNDLEDCDQVHIDDVAADDNGLDLSTYNFEADGFHAAATSAN------------LCMATGVRGGVDWMRKLAYRYRKIKEVYSSYRNNVGGLLGAAKRETWLQLRMELESTTDSWLTLALKALSIIHSRTNCLNIMVTTTQLVPALAKSLLYGLGALFPIENIYSATKIGKEACFERILNRFGKKCTYIVVGDGRDEETASRQMNFPFWRVNTHSDLINLHHALDLGHL 290          
BLAST of Eyes absent homolog vs. Ensembl Medaka
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:101171377])

HSP 1 Score: 448.358 bits (1152), Expect = 3.261e-151
Identity = 224/362 (61.88%), Postives = 263/362 (72.65%), Query Frame = 3
Query:  606 TTQKYQLINLPPALPSTAGNASVTETAI--SLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +T  YQL +  PA+    G A+    A   ++++  +P    DD   +S   +S     + N +P P        +++LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IFSLAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KELY++Y+NNVGGLLG  KR+ WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG VF IENIYSA KIGKESCFERI SRFG   TYVV+GDGKDEE AA Q + PFWRISSHSD++ALH AL   YL
Sbjct:  250 STAAYQLQDPAPAM---TGQAAELHPADFDTVQSPSTPIKELDDRACRSGGSKSRGRGRKNNPSPAP--------DSDLERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFSLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKELYSTYKNNVGGLLGPAKRDAWLQLRAEVEALTDSWLTHALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSVFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGKDEEHAASQHNMPFWRISSHSDLLALHQALEFEYL 588          
BLAST of Eyes absent homolog vs. Ensembl Medaka
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:101171377])

HSP 1 Score: 448.743 bits (1153), Expect = 4.293e-151
Identity = 224/362 (61.88%), Postives = 263/362 (72.65%), Query Frame = 3
Query:  606 TTQKYQLINLPPALPSTAGNASVTETAI--SLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +T  YQL +  PA+    G A+    A   ++++  +P    DD   +S   +S     + N +P P        +++LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IFSLAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KELY++Y+NNVGGLLG  KR+ WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG VF IENIYSA KIGKESCFERI SRFG   TYVV+GDGKDEE AA Q + PFWRISSHSD++ALH AL   YL
Sbjct:  276 STAAYQLQDPAPAM---TGQAAELHPADFDTVQSPSTPIKELDDRACRSGGSKSRGRGRKNNPSPAP--------DSDLERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFSLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKELYSTYKNNVGGLLGPAKRDAWLQLRAEVEALTDSWLTHALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSVFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGKDEEHAASQHNMPFWRISSHSDLLALHQALEFEYL 614          
BLAST of Eyes absent homolog vs. Ensembl Medaka
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:101171377])

HSP 1 Score: 447.588 bits (1150), Expect = 2.639e-150
Identity = 224/362 (61.88%), Postives = 263/362 (72.65%), Query Frame = 3
Query:  606 TTQKYQLINLPPALPSTAGNASVTETAI--SLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +T  YQL +  PA+    G A+    A   ++++  +P    DD   +S   +S     + N +P P        +++LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IFSLAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KELY++Y+NNVGGLLG  KR+ WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG VF IENIYSA KIGKESCFERI SRFG   TYVV+GDGKDEE AA Q + PFWRISSHSD++ALH AL   YL
Sbjct:  304 STAAYQLQDPAPAM---TGQAAELHPADFDTVQSPSTPIKELDDRACRSGGSKSRGRGRKNNPSPAP--------DSDLERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFSLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKELYSTYKNNVGGLLGPAKRDAWLQLRAEVEALTDSWLTHALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSVFPIENIYSATKIGKESCFERIVSRFGTNITYVVIGDGKDEEHAASQHNMPFWRISSHSDLLALHQALEFEYL 642          
BLAST of Eyes absent homolog vs. Ensembl Medaka
Match: eya4 (EYA transcriptional coactivator and phosphatase 4 [Source:NCBI gene;Acc:101171377])

HSP 1 Score: 445.662 bits (1145), Expect = 1.865e-149
Identity = 221/362 (61.05%), Postives = 263/362 (72.65%), Query Frame = 3
Query:  606 TTQKYQLINLPPALPSTAGNASVTETAI--SLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            +T  YQL +  PA+    G A+    A   ++++  +P    DD   +S   +S     + N +P P        +++LER+FVWDLDETII+FHSLLTG YAQKY KD   AV LGLRMEE+IFSLAD H+FFNDLEECDQVHIDDVSSDDNGQDLS Y+F  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KELY++Y+NNVGGLLG  KR+ WLQLR ++E LTD+WLT ALK+L++IS R+NCVNVLVTTTQL+PALAKVLLY LG VF IENIYSA KIGKESCFERI  RFGRK  YVV+GDG +EE AA++ + PFWRISSHSD++ALH AL   YL
Sbjct:  304 STAAYQLQDPAPAM---TGQAAELHPADFDTVQSPSTPIKELDDRACRSGGSKSRGRGRKNNPSPAP--------DSDLERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFSLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKELYSTYKNNVGGLLGPAKRDAWLQLRAEVEALTDSWLTHALKSLSIISSRSNCVNVLVTTTQLIPALAKVLLYSLGSVFPIENIYSATKIGKESCFERIMQRFGRKVVYVVIGDGVEEEQAAKKHNMPFWRISSHSDLLALHQALEFEYL 642          
BLAST of Eyes absent homolog vs. Ensembl Medaka
Match: eya1 (EYA transcriptional coactivator and phosphatase 1 [Source:NCBI gene;Acc:100049367])

HSP 1 Score: 426.787 bits (1096), Expect = 1.110e-143
Identity = 219/349 (62.75%), Postives = 255/349 (73.07%), Query Frame = 3
Query:  648 PSTAGNASVTETAISLKASESPGLSKDDSES---QSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            P+   + ++T+         SP     DS+S   +  S     G    NNNP P   SD      LER+F+WDLDETII+FHSLLTG YA +Y +D  T+V+LGLRMEE+IF+LAD H+FFNDLEECDQVHIDDVSSDDNGQDLS YNF  DGF   A+  N            L   T VRGGVDWMRKLAFRYRR+KE+Y +Y+NNVGGLLG  KRE WLQLR +IE LTD+WLTLALKALTLI  R+NCVN+LVTTTQL+PALAKVLLYGLG VF IENIYSA KIGKESCFER+  RFGRK  Y+VVGDG +EE  +++ + PFWRISSHSD++ALHHAL L YL
Sbjct:  202 PTGITSQALTDNPAEYSTIHSPSTPIKDSDSDRLRRASDGKSRGRGRRNNNPSPPPDSD------LERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFSADGFHAAATSAN------------LCLATGVRGGVDWMRKLAFRYRRVKEIYTTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALTLIHSRSNCVNILVTTTQLIPALAKVLLYGLGVVFPIENIYSATKIGKESCFERVIQRFGRKVVYIVVGDGVEEEQGSKKHNMPFWRISSHSDLMALHHALDLEYL 532          
BLAST of Eyes absent homolog vs. Planmine SMEST
Match: SMESG000001561.1 (SMESG000001561.1)

HSP 1 Score: 1113.6 bits (2879), Expect = 0.000e+0
Identity = 549/550 (99.82%), Postives = 550/550 (100.00%), Query Frame = 3
Query:   36 MFASSAATASLFGTNQPNXXXXXXXXXXYGLNNSEVAQQLVASVTASTSSYLSGYTDFEGVNSTACLDSTTDPNDVLTSSQAESLFNCALHQSGLYGQPYSMSSYLSDMPPTSEDNSLFASNFYNGLTGNYTDQSQQQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVNTRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 1685
            MFASSAATASLFGTNQPNPSSFPSFMSSYGLNNSEVAQQLVASVTASTSSYLSGYTDFEGVNSTACLDSTTDPNDVLTSSQAESLFNCALHQSGLYGQPYSMSSYLSDMPPTSEDNSLFASNFYNGLTGNYTDQSQQQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVN+RSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL
Sbjct:    1 MFASSAATASLFGTNQPNPSSFPSFMSSYGLNNSEVAQQLVASVTASTSSYLSGYTDFEGVNSTACLDSTTDPNDVLTSSQAESLFNCALHQSGLYGQPYSMSSYLSDMPPTSEDNSLFASNFYNGLTGNYTDQSQQQRNSAYVYAYGYSPYISAMYAGIHSPCQQIMNSMGSVVNSRSYCPPTNPSIPSTTQKYQLINLPPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETNNNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDASTAVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNFLVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIKELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQRNNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERISSRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL 550          
The following BLAST results are available for this feature:
BLAST of Eyes absent homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EYA14.305e-15862.70EYA transcriptional coactivator and phosphatase 1 ... [more]
EYA14.695e-15862.70EYA transcriptional coactivator and phosphatase 1 ... [more]
EYA15.921e-15862.70EYA transcriptional coactivator and phosphatase 1 ... [more]
EYA17.493e-15862.70EYA transcriptional coactivator and phosphatase 1 ... [more]
EYA17.493e-15862.70EYA transcriptional coactivator and phosphatase 1 ... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eya-11.253e-2125.00Eyes absent homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
eya-11.443e-2125.00Eyes absent homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eya4.042e-14058.89gene:FBgn0000320 transcript:FBtr0306113[more]
eya4.410e-13958.89gene:FBgn0000320 transcript:FBtr0079335[more]
eya5.806e-13958.89gene:FBgn0000320 transcript:FBtr0079334[more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eya42.501e-14669.31EYA transcriptional coactivator and phosphatase 4 ... [more]
eya46.485e-14669.31EYA transcriptional coactivator and phosphatase 4 ... [more]
eya48.553e-14669.31EYA transcriptional coactivator and phosphatase 4 ... [more]
eya43.685e-14568.32EYA transcriptional coactivator and phosphatase 4 ... [more]
eya41.304e-14468.32EYA transcriptional coactivator and phosphatase 4 ... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EYA41.835e-14961.50EYA transcriptional coactivator and phosphatase 4 ... [more]
EYA43.906e-14961.50EYA transcriptional coactivator and phosphatase 4 ... [more]
EYA46.224e-14970.10EYA transcriptional coactivator and phosphatase 4 ... [more]
EYA47.991e-14961.50EYA transcriptional coactivator and phosphatase 4 ... [more]
EYA48.360e-14970.10EYA transcriptional coactivator and phosphatase 4 ... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eya11.408e-15761.85EYA transcriptional coactivator and phosphatase 1 ... [more]
Eya12.179e-15761.85EYA transcriptional coactivator and phosphatase 1 ... [more]
Eya13.861e-15761.85EYA transcriptional coactivator and phosphatase 1 ... [more]
Eya13.861e-15761.85EYA transcriptional coactivator and phosphatase 1 ... [more]
Eya48.355e-15268.85EYA transcriptional coactivator and phosphatase 4 ... [more]
back to top
BLAST of Eyes absent homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99502|EYA1_HUMAN3.598e-15762.70Eyes absent homolog 1 OS=Homo sapiens OX=9606 GN=E... [more]
sp|P97767|EYA1_MOUSE2.701e-15661.85Eyes absent homolog 1 OS=Mus musculus OX=10090 GN=... [more]
sp|O95677|EYA4_HUMAN4.504e-15263.26Eyes absent homolog 4 OS=Homo sapiens OX=9606 GN=E... [more]
sp|Q9Z191|EYA4_MOUSE5.844e-15168.85Eyes absent homolog 4 OS=Mus musculus OX=10090 GN=... [more]
sp|O08575|EYA2_MOUSE5.643e-14757.89Eyes absent homolog 2 OS=Mus musculus OX=10090 GN=... [more]
back to top
BLAST of Eyes absent homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q86FY60.000e+095.46Eyes absent homolog OS=Dugesia japonica OX=6161 GN... [more]
T1E1140.000e+074.54Eyes absent homolog OS=Dendrocoelum lacteum OX=278... [more]
H6V0540.000e+098.58Eyes absent homolog (Fragment) OS=Schmidtea polych... [more]
A0A433TNR02.710e-16466.03Eyes absent homolog OS=Elysia chlorotica OX=188477... [more]
A0A1S3K8L12.485e-16259.43Eyes absent homolog OS=Lingula unguis OX=7574 GN=L... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eya45.046e-14668.85EYA transcriptional coactivator and phosphatase 4 ... [more]
eya42.079e-14568.85EYA transcriptional coactivator and phosphatase 4 ... [more]
eya23.298e-14451.62EYA transcriptional coactivator and phosphatase 2 ... [more]
eya46.160e-14269.55EYA transcriptional coactivator and phosphatase 4 ... [more]
eya32.567e-14054.25eyes absent homolog 3 [Source:NCBI gene;Acc:103037... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eya11.396e-14264.29EYA transcriptional coactivator and phosphatase 1 ... [more]
ENSPMAT00000010369.12.360e-8161.46pep scaffold:Pmarinus_7.0:GL478893:143469:150485:-... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Eyes absent homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO373821.095e-15065.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eyes absent homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eya43.261e-15161.88EYA transcriptional coactivator and phosphatase 4 ... [more]
eya44.293e-15161.88EYA transcriptional coactivator and phosphatase 4 ... [more]
eya42.639e-15061.88EYA transcriptional coactivator and phosphatase 4 ... [more]
eya41.865e-14961.05EYA transcriptional coactivator and phosphatase 4 ... [more]
eya11.110e-14362.75EYA transcriptional coactivator and phosphatase 1 ... [more]
back to top
BLAST of Eyes absent homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000001561.10.000e+099.82SMESG000001561.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015071 ID=SMED30015071|Name=Eyes absent homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1754bp
TTTCGTTTTTTTTAATATAACATAAAAAATCTCGAATGTTTGCTAGTTCA
GCCGCAACTGCATCATTGTTTGGTACAAATCAACCGAATCCCTCCTCATT
TCCGTCATTTATGTCATCATATGGATTGAATAATTCTGAAGTAGCACAAC
AGTTGGTCGCTAGTGTTACGGCATCAACCAGTTCCTATTTATCCGGTTAT
ACGGATTTTGAAGGAGTTAATAGTACAGCGTGCTTAGATTCGACGACTGA
TCCGAATGATGTATTAACAAGCAGCCAAGCTGAAAGCTTATTTAATTGTG
CTCTTCATCAATCTGGTTTATATGGTCAGCCGTATTCTATGAGTAGTTAT
TTGTCTGATATGCCACCTACAAGTGAAGATAACTCGTTGTTTGCCTCGAA
CTTTTACAACGGACTTACAGGAAATTATACCGACCAGTCTCAGCAACAAC
GCAACTCAGCATATGTATACGCATATGGATATTCGCCCTACATATCGGCA
ATGTATGCTGGTATTCATTCACCGTGTCAACAAATCATGAACAGTATGGG
TTCGGTAGTTAATACTCGTTCATATTGTCCACCAACAAATCCTTCGATTC
CATCAACTACACAGAAATATCAGTTAATAAATTTGCCTCCGGCTCTTCCG
TCGACTGCAGGCAACGCATCTGTGACAGAAACTGCCATCTCTCTAAAAGC
GTCGGAATCTCCTGGCCTTTCGAAAGACGACTCAGAAAGTCAATCTAAAT
CACCGCAGAGTTGCAATGGCAATTCGGAAACGAACAACAATCCGGGCCCG
AAAATCCAGTCAGACATTGCCAATGAAAACGAACTGGAAAGAATTTTTGT
TTGGGATTTGGACGAGACTATCATAATTTTTCATTCTCTCCTTACAGGAA
TTTACGCTCAGAAATACCAAAAAGATGCTTCAACTGCAGTCGCTCTCGGT
TTACGGATGGAGGAACTTATTTTCAGTTTAGCTGACAATCACATGTTTTT
CAATGATTTAGAAGAATGCGATCAAGTACACATTGATGATGTGTCATCAG
ATGATAATGGACAAGACTTAAGCAATTACAATTTTCTTGTCGACGGATTT
GCTGGGCCTGCTAGTATTTGCAATGGAGTATCTACAGTGATCCAAGGTGG
ACCACTGGGACTTCCTGGAAACACCAGTGTGCGCGGAGGAGTTGATTGGA
TGAGGAAATTAGCGTTCCGTTATCGACGAATAAAAGAACTGTACAATTCT
TACAGAAACAATGTAGGAGGTTTATTAGGCACACAAAAACGGGAACACTG
GCTACAATTAAGGCAAGACATTGAAACTCTTACAGACAATTGGCTTACGT
TGGCTTTGAAAGCCTTAACACTAATATCTCAAAGAAACAACTGTGTTAAT
GTATTGGTCACAACTACACAATTGGTACCCGCACTGGCAAAGGTTTTACT
GTATGGCTTGGGGGGAGTATTTCAAATTGAGAATATTTATTCTGCAAACA
AAATAGGGAAAGAGAGCTGTTTCGAAAGAATTTCATCTAGATTCGGACGA
AAGAGCACATACGTTGTTGTTGGAGATGGAAAAGATGAAGAAACAGCTGC
CAGACAGGTTAGTTGGCCATTTTGGAGAATAAGTTCACATTCCGATATCG
TGGCACTTCACCACGCATTGAGTCTTGGTTACTTATAATTACACTTTGCT
TTTTAGTTTTTTTATTCATTTGAAATTAATACAACTTGTTTTAATCAAAA
AAAA
back to top

protein sequence of SMED30015071-orf-1

>SMED30015071-orf-1 ID=SMED30015071-orf-1|Name=SMED30015071-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=551bp
MFASSAATASLFGTNQPNPSSFPSFMSSYGLNNSEVAQQLVASVTASTSS
YLSGYTDFEGVNSTACLDSTTDPNDVLTSSQAESLFNCALHQSGLYGQPY
SMSSYLSDMPPTSEDNSLFASNFYNGLTGNYTDQSQQQRNSAYVYAYGYS
PYISAMYAGIHSPCQQIMNSMGSVVNTRSYCPPTNPSIPSTTQKYQLINL
PPALPSTAGNASVTETAISLKASESPGLSKDDSESQSKSPQSCNGNSETN
NNPGPKIQSDIANENELERIFVWDLDETIIIFHSLLTGIYAQKYQKDAST
AVALGLRMEELIFSLADNHMFFNDLEECDQVHIDDVSSDDNGQDLSNYNF
LVDGFAGPASICNGVSTVIQGGPLGLPGNTSVRGGVDWMRKLAFRYRRIK
ELYNSYRNNVGGLLGTQKREHWLQLRQDIETLTDNWLTLALKALTLISQR
NNCVNVLVTTTQLVPALAKVLLYGLGGVFQIENIYSANKIGKESCFERIS
SRFGRKSTYVVVGDGKDEETAARQVSWPFWRISSHSDIVALHHALSLGYL
*
back to top
Aliases
The feature 'Eyes absent homolog' has the following synonyms
Synonym
eya
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000036eye
PLANA:0000075optic cup
PLANA:0000095trail cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000205oviduct
PLANA:0000418head
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR038102EYA_dom_sf
IPR006545EYA_dom
IPR028472EYA_fam
IPR042577EYA_dom_metazoan
Vocabulary: molecular function
TermDefinition
GO:0004721phosphoprotein phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006470protein dephosphorylation
GO:0007275multicellular organism development
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038102EYA domain superfamilyGENE3DG3DSA:3.40.50.12350coord: 268..550
e-value: 2.7E-132
score: 442.0
IPR006545EYA domainTIGRFAMTIGR01658TIGR01658coord: 268..549
e-value: 4.5E-108
score: 359.1
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 269..544
e-value: 7.4E-32
score: 105.5
NoneNo IPR availableSFLDSFLDG01129C1.5:_HAD,_Beta-PGM,_Phosphatcoord: 269..544
e-value: 7.4E-32
score: 105.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..258
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..258
IPR028472Eyes absent familyPANTHERPTHR10190EYES ABSENTcoord: 71..550
IPR042577EYA domain, metazoanCDDcd02601HAD_Eyacoord: 267..550
e-value: 9.52079E-163
score: 461.576