ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30015069
Length (bp)2307
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30015069) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30015069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30015069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30015069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015069SMESG000063648.1 Contig53723newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015069SMESG000063648.1 Contig53723uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30015069SMESG000063648.1 dd_Smed_v6_10764_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015069SMESG000063648.1 HQ141793.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30015069SMESG000063648.1 HQ141793.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30015069SMESG000063648.1 HQ141793.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30015069SMESG000063648.1 HQ141793.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30015069SMESG000063648.1 HQ141793.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Category 4 cellSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015069SMESG000063648.1 dd_Smed_v4_10764_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD6 (ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:17280])

HSP 1 Score: 169.088 bits (427), Expect = 2.595e-46
Identity = 92/254 (36.22%), Postives = 148/254 (58.27%), Query Frame = 3
Query:  351 DKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +II  L+  G  ++ QD   GNT LHE++W G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  + R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E + +L T +P      +S +
Sbjct:   24 ENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKD-GNTALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPE-VALLLTKAPQVGFTALSMV 273          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD6 (ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:17280])

HSP 1 Score: 174.096 bits (440), Expect = 6.192e-45
Identity = 98/284 (34.51%), Postives = 158/284 (55.63%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNE 1172
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +II  L+  G  ++ QD   GNT LHE++W G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  + R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L T +P   + +        RE    + R  S+P +
Sbjct:   14 LLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKD-GNTALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVA-LLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRD 293          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD6 (ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:17280])

HSP 1 Score: 174.096 bits (440), Expect = 6.192e-45
Identity = 98/284 (34.51%), Postives = 158/284 (55.63%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNE 1172
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +II  L+  G  ++ QD   GNT LHE++W G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  + R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L T +P   + +        RE    + R  S+P +
Sbjct:   14 LLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKD-GNTALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVA-LLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRD 293          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD6 (ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:17280])

HSP 1 Score: 174.096 bits (440), Expect = 6.690e-45
Identity = 98/284 (34.51%), Postives = 158/284 (55.63%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNE 1172
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +II  L+  G  ++ QD   GNT LHE++W G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  + R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L T +P   + +        RE    + R  S+P +
Sbjct:   14 LLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKD-GNTALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVA-LLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRD 293          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD6 (ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:17280])

HSP 1 Score: 171.014 bits (432), Expect = 4.906e-44
Identity = 91/249 (36.55%), Postives = 145/249 (58.23%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +II  L+  G  ++ QD   GNT LHE++W G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  + R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L
Sbjct:   14 LLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKD-GNTALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVALLL 259          

HSP 2 Score: 88.9669 bits (219), Expect = 1.476e-17
Identity = 59/185 (31.89%), Postives = 101/185 (54.59%), Query Frame = 3
Query:  531 AASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKT--CS 1079
            AA  GQ + +  L+ +GA+V +  + HG TPLH +A KG+   V+ L   G   ++ +    T LH A   G+ +    LI  G  +  Q++ G+T LH    +G +  +++LI    ++  +N+ G+TALH+A      + T++L+ +G+  D++N   +T L VA + +H  II +L T  CS
Sbjct:   17 AAYKGQTENVVQLINKGARVAV--TKHGRTPLHLAANKGHLPVVQILLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCS 199          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.783 bits (299), Expect = 2.910e-27
Identity = 88/309 (28.48%), Postives = 144/309 (46.60%), Query Frame = 3
Query:  279 SKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD--------------------------------STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            ++ ++T +H        A  + N D V   ++AG N     +D  SP+HIAA+ GQ E+   LL       + T   F  TPLH A+  G ++++++LLERG  V+I+                                 + +G TPLH +A K   +    L      PN  + + FTPLHL+ Q GH + +  LI  G+D+ A+   G T +H   +  H  V++IL +   +IN +   G T LH+A    +  + K LVE+GA +  +   + TPL  A ++ H+  +  L     + N++T +
Sbjct:  488 ARELQTPLHI-------ASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT 787          

HSP 2 Score: 117.472 bits (293), Expect = 1.339e-26
Identity = 85/256 (33.20%), Postives = 127/256 (49.61%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSI 1163
            + G +P+H+AA  G + I+ YLLQ     +V T      TPLH AA   Q D++++L+  GA+V+ Q +    TPLH ++  G +  V  L   G   N      ++PLH+A + G  +    L+   AD +   + G TPLH   +YG+  V R+L+   T ++   +N  T LH+AA     K+  LL+E+GAS         TPL +A KK+  EI   L     + N K+   F P +L    S Q  H  I
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG--ETPLHLAARANQTDVVRVLIRNGAKVDAQ-ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL----SAQEGHKEI 671          

HSP 3 Score: 110.153 bits (274), Expect = 2.486e-24
Identity = 78/251 (31.08%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGKS---PIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+         LLQ     +V +   F  TPLH AA  G  ++ Q+LLE+GA VN Q + H  +PLH +   G +     L   G + +     L TPLH A + GH+Q    L+  GA ISA+ + G  PLH   +  H   +R L+     ++    +  T LH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  164 DGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQ-ARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 4 Score: 102.449 bits (254), Expect = 7.037e-22
Identity = 80/274 (29.20%), Postives = 130/274 (47.45%), Query Frame = 3
Query:  306 TNVSNL-------IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            TN++NL       ID+ + +    +    R+GH+ ++D             K+G +P+H+AA+   ++  + LL      +  T D    TPLH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L            S  TPLH+A   G       L++ GA+   +   G+TPLH   R     V R+LI     ++ + +   T LHIA+ L    I  LL+++GA+ +     N +PL +A K+   E+  IL
Sbjct:  273 TNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 5 Score: 95.1301 bits (235), Expect = 1.060e-19
Identity = 67/237 (28.27%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +P+++AA+    E++KYLL+      ++T D F  TPL  A   G   ++ +LLE  ++  ++        LH +A K  +     L      P++ + S FTPLH+A   GH    + L+  GA+++ Q R   +PLH   ++G   ++ +L+S    I+ R ++  T LH AA     ++  LLV  GA I  +      PL +A +  H +    L       +  TV +L
Sbjct:  131 NGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSKGKVRLPA-----LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL 360          

HSP 6 Score: 94.7449 bits (234), Expect = 1.291e-19
Identity = 79/293 (26.96%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  201 RLLLGFTRPYAVPNTPSR--KIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDK-DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R L GFT P  +    +R   ++ L K    ++ +  + ++ L  A  +   + V   ++ G N  ++   G++P+H+AA   Q ++++ L++     +    +    TPLH A+ +G  DI+ +LL+ GA  N   +T  N +PLH +A +G  +    L        L+    FTPLHLA + G+ +  R L+  G  +  + +   TPLH    Y +  V+ +L+          +NG T LHIAA   + +I   L++  A  + ++    TPL ++ ++ H EI  +L
Sbjct:  388 RALNGFT-PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVILLLQAGANSNA--TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 7 Score: 89.3521 bits (220), Expect = 7.340e-18
Identity = 72/254 (28.35%), Postives = 120/254 (47.24%), Query Frame = 3
Query:  390 IID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFS 1139
            IID   KD  +P+H AA +G  +++  L+      +  T +     PLH AA    +D  + LL   A V+  D T    TPLH +A  G+ +  + L      PN    + FTPLH+A +    +    L++  A I A    G TPLH     G   +   L+    + +     G+T LH+AA   +  + ++L+ +GA +D +  + +TPL +A +  +++I+ +L     N+N  T        R+N+S
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL--APLHMAAQGDHVDAARTLLYHRAPVD--DVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT--------RDNYS 526          

HSP 8 Score: 85.5001 bits (210), Expect = 9.992e-17
Identity = 73/266 (27.44%), Postives = 123/266 (46.24%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI----------------------SVSTDINQRNQNGD-------TALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +    AA  G LE +  LL+A    N +  +  +S  LH A+  G  ++++ L++R AQV+   +  GNT LH ++  G S  V  L   G   N+ + + FTPL++A Q  H +  + L++ GA+ +     G TPL   ++ GH  V  +L+                      + +T + Q   N D       T LHIAA      + +LL+E GA+++ +   N +PL VA K   + +  +L +     + +T   L
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNS--LHLASKEGHSEVVRELIKRQAQVDAA-TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLL 294          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.783 bits (299), Expect = 2.910e-27
Identity = 88/309 (28.48%), Postives = 144/309 (46.60%), Query Frame = 3
Query:  279 SKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD--------------------------------STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            ++ ++T +H        A  + N D V   ++AG N     +D  SP+HIAA+ GQ E+   LL       + T   F  TPLH A+  G ++++++LLERG  V+I+                                 + +G TPLH +A K   +    L      PN  + + FTPLHL+ Q GH + +  LI  G+D+ A+   G T +H   +  H  V++IL +   +IN +   G T LH+A    +  + K LVE+GA +  +   + TPL  A ++ H+  +  L     + N++T +
Sbjct:  488 ARELQTPLHI-------ASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT 787          

HSP 2 Score: 117.472 bits (293), Expect = 1.339e-26
Identity = 85/256 (33.20%), Postives = 127/256 (49.61%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSI 1163
            + G +P+H+AA  G + I+ YLLQ     +V T      TPLH AA   Q D++++L+  GA+V+ Q +    TPLH ++  G +  V  L   G   N      ++PLH+A + G  +    L+   AD +   + G TPLH   +YG+  V R+L+   T ++   +N  T LH+AA     K+  LL+E+GAS         TPL +A KK+  EI   L     + N K+   F P +L    S Q  H  I
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG--ETPLHLAARANQTDVVRVLIRNGAKVDAQ-ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL----SAQEGHKEI 671          

HSP 3 Score: 110.153 bits (274), Expect = 2.486e-24
Identity = 78/251 (31.08%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGKS---PIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+         LLQ     +V +   F  TPLH AA  G  ++ Q+LLE+GA VN Q + H  +PLH +   G +     L   G + +     L TPLH A + GH+Q    L+  GA ISA+ + G  PLH   +  H   +R L+     ++    +  T LH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  164 DGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQ-ARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 4 Score: 102.449 bits (254), Expect = 7.037e-22
Identity = 80/274 (29.20%), Postives = 130/274 (47.45%), Query Frame = 3
Query:  306 TNVSNL-------IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            TN++NL       ID+ + +    +    R+GH+ ++D             K+G +P+H+AA+   ++  + LL      +  T D    TPLH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L            S  TPLH+A   G       L++ GA+   +   G+TPLH   R     V R+LI     ++ + +   T LHIA+ L    I  LL+++GA+ +     N +PL +A K+   E+  IL
Sbjct:  273 TNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 5 Score: 95.1301 bits (235), Expect = 1.060e-19
Identity = 67/237 (28.27%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +P+++AA+    E++KYLL+      ++T D F  TPL  A   G   ++ +LLE  ++  ++        LH +A K  +     L      P++ + S FTPLH+A   GH    + L+  GA+++ Q R   +PLH   ++G   ++ +L+S    I+ R ++  T LH AA     ++  LLV  GA I  +      PL +A +  H +    L       +  TV +L
Sbjct:  131 NGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSKGKVRLPA-----LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL 360          

HSP 6 Score: 94.7449 bits (234), Expect = 1.291e-19
Identity = 79/293 (26.96%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  201 RLLLGFTRPYAVPNTPSR--KIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDK-DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R L GFT P  +    +R   ++ L K    ++ +  + ++ L  A  +   + V   ++ G N  ++   G++P+H+AA   Q ++++ L++     +    +    TPLH A+ +G  DI+ +LL+ GA  N   +T  N +PLH +A +G  +    L        L+    FTPLHLA + G+ +  R L+  G  +  + +   TPLH    Y +  V+ +L+          +NG T LHIAA   + +I   L++  A  + ++    TPL ++ ++ H EI  +L
Sbjct:  388 RALNGFT-PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVILLLQAGANSNA--TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 7 Score: 89.3521 bits (220), Expect = 7.340e-18
Identity = 72/254 (28.35%), Postives = 120/254 (47.24%), Query Frame = 3
Query:  390 IID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFS 1139
            IID   KD  +P+H AA +G  +++  L+      +  T +     PLH AA    +D  + LL   A V+  D T    TPLH +A  G+ +  + L      PN    + FTPLH+A +    +    L++  A I A    G TPLH     G   +   L+    + +     G+T LH+AA   +  + ++L+ +GA +D +  + +TPL +A +  +++I+ +L     N+N  T        R+N+S
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL--APLHMAAQGDHVDAARTLLYHRAPVD--DVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT--------RDNYS 526          

HSP 8 Score: 85.5001 bits (210), Expect = 9.992e-17
Identity = 73/266 (27.44%), Postives = 123/266 (46.24%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI----------------------SVSTDINQRNQNGD-------TALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +    AA  G LE +  LL+A    N +  +  +S  LH A+  G  ++++ L++R AQV+   +  GNT LH ++  G S  V  L   G   N+ + + FTPL++A Q  H +  + L++ GA+ +     G TPL   ++ GH  V  +L+                      + +T + Q   N D       T LHIAA      + +LL+E GA+++ +   N +PL VA K   + +  +L +     + +T   L
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNS--LHLASKEGHSEVVRELIKRQAQVDAA-TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLL 294          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 3.107e-27
Identity = 88/309 (28.48%), Postives = 144/309 (46.60%), Query Frame = 3
Query:  279 SKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD--------------------------------STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            ++ ++T +H        A  + N D V   ++AG N     +D  SP+HIAA+ GQ E+   LL       + T   F  TPLH A+  G ++++++LLERG  V+I+                                 + +G TPLH +A K   +    L      PN  + + FTPLHL+ Q GH + +  LI  G+D+ A+   G T +H   +  H  V++IL +   +IN +   G T LH+A    +  + K LVE+GA +  +   + TPL  A ++ H+  +  L     + N++T +
Sbjct:  488 ARELQTPLHI-------ASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT 787          

HSP 2 Score: 117.472 bits (293), Expect = 1.381e-26
Identity = 85/256 (33.20%), Postives = 127/256 (49.61%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSI 1163
            + G +P+H+AA  G + I+ YLLQ     +V T      TPLH AA   Q D++++L+  GA+V+ Q +    TPLH ++  G +  V  L   G   N      ++PLH+A + G  +    L+   AD +   + G TPLH   +YG+  V R+L+   T ++   +N  T LH+AA     K+  LL+E+GAS         TPL +A KK+  EI   L     + N K+   F P +L    S Q  H  I
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG--ETPLHLAARANQTDVVRVLIRNGAKVDAQ-ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL----SAQEGHKEI 671          

HSP 3 Score: 110.153 bits (274), Expect = 2.272e-24
Identity = 78/251 (31.08%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+         LLQ     +V +   F  TPLH AA  G  ++ Q+LLE+GA VN Q + H  +PLH +   G +     L   G + +     L TPLH A + GH+Q    L+  GA ISA+ + G  PLH   +  H   +R L+     ++    +  T LH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  164 DGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQ-ARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 4 Score: 102.449 bits (254), Expect = 7.005e-22
Identity = 80/274 (29.20%), Postives = 130/274 (47.45%), Query Frame = 3
Query:  306 TNVSNL-------IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            TN++NL       ID+ + +    +    R+GH+ ++D             K+G +P+H+AA+   ++  + LL      +  T D    TPLH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L            S  TPLH+A   G       L++ GA+   +   G+TPLH   R     V R+LI     ++ + +   T LHIA+ L    I  LL+++GA+ +     N +PL +A K+   E+  IL
Sbjct:  273 TNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 5 Score: 95.5153 bits (236), Expect = 9.606e-20
Identity = 67/237 (28.27%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +P+++AA+    E++KYLL+      ++T D F  TPL  A   G   ++ +LLE  ++  ++        LH +A K  +     L      P++ + S FTPLH+A   GH    + L+  GA+++ Q R   +PLH   ++G   ++ +L+S    I+ R ++  T LH AA     ++  LLV  GA I  +      PL +A +  H +    L       +  TV +L
Sbjct:  131 NGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSKGKVRLPA-----LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL 360          

HSP 6 Score: 95.1301 bits (235), Expect = 1.263e-19
Identity = 79/293 (26.96%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  201 RLLLGFTRPYAVPNTPSR--KIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDK-DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R L GFT P  +    +R   ++ L K    ++ +  + ++ L  A  +   + V   ++ G N  ++   G++P+H+AA   Q ++++ L++     +    +    TPLH A+ +G  DI+ +LL+ GA  N   +T  N +PLH +A +G  +    L        L+    FTPLHLA + G+ +  R L+  G  +  + +   TPLH    Y +  V+ +L+          +NG T LHIAA   + +I   L++  A  + ++    TPL ++ ++ H EI  +L
Sbjct:  388 RALNGFT-PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVILLLQAGANSNA--TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 7 Score: 89.3521 bits (220), Expect = 7.241e-18
Identity = 72/254 (28.35%), Postives = 120/254 (47.24%), Query Frame = 3
Query:  390 IID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFS 1139
            IID   KD  +P+H AA +G  +++  L+      +  T +     PLH AA    +D  + LL   A V+  D T    TPLH +A  G+ +  + L      PN    + FTPLH+A +    +    L++  A I A    G TPLH     G   +   L+    + +     G+T LH+AA   +  + ++L+ +GA +D +  + +TPL +A +  +++I+ +L     N+N  T        R+N+S
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL--APLHMAAQGDHVDAARTLLYHRAPVD--DVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT--------RDNYS 526          

HSP 8 Score: 85.5001 bits (210), Expect = 9.772e-17
Identity = 73/266 (27.44%), Postives = 123/266 (46.24%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI----------------------SVSTDINQRNQNGD-------TALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +    AA  G LE +  LL+A    N +  +  +S  LH A+  G  ++++ L++R AQV+   +  GNT LH ++  G S  V  L   G   N+ + + FTPL++A Q  H +  + L++ GA+ +     G TPL   ++ GH  V  +L+                      + +T + Q   N D       T LHIAA      + +LL+E GA+++ +   N +PL VA K   + +  +L +     + +T   L
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNS--LHLASKEGHSEVVRELIKRQAQVDAA-TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLL 294          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 3.107e-27
Identity = 88/309 (28.48%), Postives = 144/309 (46.60%), Query Frame = 3
Query:  279 SKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD--------------------------------STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            ++ ++T +H        A  + N D V   ++AG N     +D  SP+HIAA+ GQ E+   LL       + T   F  TPLH A+  G ++++++LLERG  V+I+                                 + +G TPLH +A K   +    L      PN  + + FTPLHL+ Q GH + +  LI  G+D+ A+   G T +H   +  H  V++IL +   +IN +   G T LH+A    +  + K LVE+GA +  +   + TPL  A ++ H+  +  L     + N++T +
Sbjct:  488 ARELQTPLHI-------ASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT 787          

HSP 2 Score: 117.472 bits (293), Expect = 1.381e-26
Identity = 85/256 (33.20%), Postives = 127/256 (49.61%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSI 1163
            + G +P+H+AA  G + I+ YLLQ     +V T      TPLH AA   Q D++++L+  GA+V+ Q +    TPLH ++  G +  V  L   G   N      ++PLH+A + G  +    L+   AD +   + G TPLH   +YG+  V R+L+   T ++   +N  T LH+AA     K+  LL+E+GAS         TPL +A KK+  EI   L     + N K+   F P +L    S Q  H  I
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG--ETPLHLAARANQTDVVRVLIRNGAKVDAQ-ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL----SAQEGHKEI 671          

HSP 3 Score: 110.153 bits (274), Expect = 2.272e-24
Identity = 78/251 (31.08%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+         LLQ     +V +   F  TPLH AA  G  ++ Q+LLE+GA VN Q + H  +PLH +   G +     L   G + +     L TPLH A + GH+Q    L+  GA ISA+ + G  PLH   +  H   +R L+     ++    +  T LH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  164 DGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQ-ARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 4 Score: 102.449 bits (254), Expect = 7.005e-22
Identity = 80/274 (29.20%), Postives = 130/274 (47.45%), Query Frame = 3
Query:  306 TNVSNL-------IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            TN++NL       ID+ + +    +    R+GH+ ++D             K+G +P+H+AA+   ++  + LL      +  T D    TPLH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L            S  TPLH+A   G       L++ GA+   +   G+TPLH   R     V R+LI     ++ + +   T LHIA+ L    I  LL+++GA+ +     N +PL +A K+   E+  IL
Sbjct:  273 TNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 5 Score: 95.5153 bits (236), Expect = 9.606e-20
Identity = 67/237 (28.27%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +P+++AA+    E++KYLL+      ++T D F  TPL  A   G   ++ +LLE  ++  ++        LH +A K  +     L      P++ + S FTPLH+A   GH    + L+  GA+++ Q R   +PLH   ++G   ++ +L+S    I+ R ++  T LH AA     ++  LLV  GA I  +      PL +A +  H +    L       +  TV +L
Sbjct:  131 NGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSKGKVRLPA-----LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL 360          

HSP 6 Score: 95.1301 bits (235), Expect = 1.263e-19
Identity = 79/293 (26.96%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  201 RLLLGFTRPYAVPNTPSR--KIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDK-DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R L GFT P  +    +R   ++ L K    ++ +  + ++ L  A  +   + V   ++ G N  ++   G++P+H+AA   Q ++++ L++     +    +    TPLH A+ +G  DI+ +LL+ GA  N   +T  N +PLH +A +G  +    L        L+    FTPLHLA + G+ +  R L+  G  +  + +   TPLH    Y +  V+ +L+          +NG T LHIAA   + +I   L++  A  + ++    TPL ++ ++ H EI  +L
Sbjct:  388 RALNGFT-PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVILLLQAGANSNA--TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 7 Score: 89.3521 bits (220), Expect = 7.241e-18
Identity = 72/254 (28.35%), Postives = 120/254 (47.24%), Query Frame = 3
Query:  390 IID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFS 1139
            IID   KD  +P+H AA +G  +++  L+      +  T +     PLH AA    +D  + LL   A V+  D T    TPLH +A  G+ +  + L      PN    + FTPLH+A +    +    L++  A I A    G TPLH     G   +   L+    + +     G+T LH+AA   +  + ++L+ +GA +D +  + +TPL +A +  +++I+ +L     N+N  T        R+N+S
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL--APLHMAAQGDHVDAARTLLYHRAPVD--DVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT--------RDNYS 526          

HSP 8 Score: 85.5001 bits (210), Expect = 9.772e-17
Identity = 73/266 (27.44%), Postives = 123/266 (46.24%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI----------------------SVSTDINQRNQNGD-------TALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +    AA  G LE +  LL+A    N +  +  +S  LH A+  G  ++++ L++R AQV+   +  GNT LH ++  G S  V  L   G   N+ + + FTPL++A Q  H +  + L++ GA+ +     G TPL   ++ GH  V  +L+                      + +T + Q   N D       T LHIAA      + +LL+E GA+++ +   N +PL VA K   + +  +L +     + +T   L
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNS--LHLASKEGHSEVVRELIKRQAQVDAA-TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLL 294          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 3.470e-27
Identity = 88/309 (28.48%), Postives = 144/309 (46.60%), Query Frame = 3
Query:  279 SKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD--------------------------------STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            ++ ++T +H        A  + N D V   ++AG N     +D  SP+HIAA+ GQ E+   LL       + T   F  TPLH A+  G ++++++LLERG  V+I+                                 + +G TPLH +A K   +    L      PN  + + FTPLHL+ Q GH + +  LI  G+D+ A+   G T +H   +  H  V++IL +   +IN +   G T LH+A    +  + K LVE+GA +  +   + TPL  A ++ H+  +  L     + N++T +
Sbjct:  488 ARELQTPLHI-------ASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT 787          

HSP 2 Score: 117.472 bits (293), Expect = 1.453e-26
Identity = 85/256 (33.20%), Postives = 127/256 (49.61%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSI 1163
            + G +P+H+AA  G + I+ YLLQ     +V T      TPLH AA   Q D++++L+  GA+V+ Q +    TPLH ++  G +  V  L   G   N      ++PLH+A + G  +    L+   AD +   + G TPLH   +YG+  V R+L+   T ++   +N  T LH+AA     K+  LL+E+GAS         TPL +A KK+  EI   L     + N K+   F P +L    S Q  H  I
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG--ETPLHLAARANQTDVVRVLIRNGAKVDAQ-ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHL----SAQEGHKEI 671          

HSP 3 Score: 110.153 bits (274), Expect = 2.674e-24
Identity = 78/251 (31.08%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+         LLQ     +V +   F  TPLH AA  G  ++ Q+LLE+GA VN Q + H  +PLH +   G +     L   G + +     L TPLH A + GH+Q    L+  GA ISA+ + G  PLH   +  H   +R L+     ++    +  T LH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  164 DGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQ-ARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 4 Score: 102.064 bits (253), Expect = 7.251e-22
Identity = 80/274 (29.20%), Postives = 130/274 (47.45%), Query Frame = 3
Query:  306 TNVSNL-------IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            TN++NL       ID+ + +    +    R+GH+ ++D             K+G +P+H+AA+   ++  + LL      +  T D    TPLH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L            S  TPLH+A   G       L++ GA+   +   G+TPLH   R     V R+LI     ++ + +   T LHIA+ L    I  LL+++GA+ +     N +PL +A K+   E+  IL
Sbjct:  273 TNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 5 Score: 95.1301 bits (235), Expect = 1.047e-19
Identity = 67/237 (28.27%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +P+++AA+    E++KYLL+      ++T D F  TPL  A   G   ++ +LLE  ++  ++        LH +A K  +     L      P++ + S FTPLH+A   GH    + L+  GA+++ Q R   +PLH   ++G   ++ +L+S    I+ R ++  T LH AA     ++  LLV  GA I  +      PL +A +  H +    L       +  TV +L
Sbjct:  131 NGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF--TPLAVALQQGHDRVVAVLLENDSKGKVRLPA-----LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL 360          

HSP 6 Score: 94.7449 bits (234), Expect = 1.353e-19
Identity = 79/293 (26.96%), Postives = 142/293 (48.46%), Query Frame = 3
Query:  201 RLLLGFTRPYAVPNTPSR--KIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDK-DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R L GFT P  +    +R   ++ L K    ++ +  + ++ L  A  +   + V   ++ G N  ++   G++P+H+AA   Q ++++ L++     +    +    TPLH A+ +G  DI+ +LL+ GA  N   +T  N +PLH +A +G  +    L        L+    FTPLHLA + G+ +  R L+  G  +  + +   TPLH    Y +  V+ +L+          +NG T LHIAA   + +I   L++  A  + ++    TPL ++ ++ H EI  +L
Sbjct:  388 RALNGFT-PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVILLLQAGANSNA--TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 7 Score: 89.3521 bits (220), Expect = 7.068e-18
Identity = 72/254 (28.35%), Postives = 120/254 (47.24%), Query Frame = 3
Query:  390 IID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFS 1139
            IID   KD  +P+H AA +G  +++  L+      +  T +     PLH AA    +D  + LL   A V+  D T    TPLH +A  G+ +  + L      PN    + FTPLH+A +    +    L++  A I A    G TPLH     G   +   L+    + +     G+T LH+AA   +  + ++L+ +GA +D +  + +TPL +A +  +++I+ +L     N+N  T        R+N+S
Sbjct:  285 IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGL--APLHMAAQGDHVDAARTLLYHRAPVD--DVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT--------RDNYS 526          

HSP 8 Score: 85.5001 bits (210), Expect = 1.048e-16
Identity = 73/266 (27.44%), Postives = 123/266 (46.24%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI----------------------SVSTDINQRNQNGD-------TALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +G +    AA  G LE +  LL+A    N +  +  +S  LH A+  G  ++++ L++R AQV+   +  GNT LH ++  G S  V  L   G   N+ + + FTPL++A Q  H +  + L++ GA+ +     G TPL   ++ GH  V  +L+                      + +T + Q   N D       T LHIAA      + +LL+E GA+++ +   N +PL VA K   + +  +L +     + +T   L
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNS--LHLASKEGHSEVVRELIKRQAQVDAA-TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLL 294          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: dgo (gene:FBgn0086898 transcript:FBtr0088249)

HSP 1 Score: 171.014 bits (432), Expect = 1.023e-43
Identity = 94/242 (38.84%), Postives = 136/242 (56.20%), Query Frame = 3
Query:  489 VNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCL-------------------------IGRLP--------------NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            ++ PD+ + T LH+A + G    ++ LL   A    ++S  GNTPLHE+A +G+S+ V+ +C                           GR+                + N    + LHLA Q GHNQ++R L+  GAD   +N +GDTPLHT  RYGHAGVSRIL+S   D N+ N NGDTALHI  A+ RRK+T++L+E+ A + I+N Q + P+ +A++K++ EIIEIL T     N+K
Sbjct:   18 ISGPDSSNWTSLHEAVAAGDDRRVEGLLFSNADRLARESVQGNTPLHEAASRGFSRCVKLICTPPTPPASSGVGKAAKGQKDKDKDKNKGRVKVAHQTIEALHNSALGIANNEGLSALHLAAQNGHNQSSRELLLAGADPDVRNNYGDTPLHTACRYGHAGVSRILLSALCDPNKTNLNGDTALHITCAMGRRKLTRILLEADARLGIKNAQGDCPMHIAIRKNYREIIEILNTPKKIRNRK 259          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: dgo (gene:FBgn0086898 transcript:FBtr0088250)

HSP 1 Score: 171.014 bits (432), Expect = 1.023e-43
Identity = 94/242 (38.84%), Postives = 136/242 (56.20%), Query Frame = 3
Query:  489 VNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCL-------------------------IGRLP--------------NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            ++ PD+ + T LH+A + G    ++ LL   A    ++S  GNTPLHE+A +G+S+ V+ +C                           GR+                + N    + LHLA Q GHNQ++R L+  GAD   +N +GDTPLHT  RYGHAGVSRIL+S   D N+ N NGDTALHI  A+ RRK+T++L+E+ A + I+N Q + P+ +A++K++ EIIEIL T     N+K
Sbjct:   18 ISGPDSSNWTSLHEAVAAGDDRRVEGLLFSNADRLARESVQGNTPLHEAASRGFSRCVKLICTPPTPPASSGVGKAAKGQKDKDKDKNKGRVKVAHQTIEALHNSALGIANNEGLSALHLAAQNGHNQSSRELLLAGADPDVRNNYGDTPLHTACRYGHAGVSRILLSALCDPNKTNLNGDTALHITCAMGRRKLTRILLEADARLGIKNAQGDCPMHIAIRKNYREIIEILNTPKKIRNRK 259          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 129.413 bits (324), Expect = 3.123e-30
Identity = 94/292 (32.19%), Postives = 145/292 (49.66%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSIPN---EMCSVINNP 1196
            N    V+  +R G ++    + G +P+H+AA  G + I+ YLLQ  A P    + P     TPLH AA   Q DII++LL  GAQV+ + +    TPLH ++  G    V  L   G   +     ++T LH+A + G ++    LI  GA + A  + G TPLH   +YGH  V+++L+    D++ + +NG T LH+A     +++  LL+E GAS         TPL +A +K+  +I   L       N ++   F P +L    S Q  H  I N   E  + +N+P
Sbjct:  381 NRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP----DVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR-AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL----SSQEGHAEISNLLIEHKAAVNHP 663          

HSP 2 Score: 106.686 bits (265), Expect = 4.122e-23
Identity = 76/251 (30.28%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGKS---PIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+   ++    LL      +V +   F  TPLH A+  G  +I  +L+++GA VN   + H  +PLH +A  G +  V  L   G           TPLH A + GH Q    L+  GA ISA+ + G  PLH   +  H   +RIL+     +++   +  TALH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  142 DGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGF--TPLHIASHYGNQNIANLLIQKGADVNYS-AKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELL 389          

HSP 3 Score: 105.531 bits (262), Expect = 9.627e-23
Identity = 80/291 (27.49%), Postives = 130/291 (44.67%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQ--------------------------------DSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            A  + N D V   ++ G  +    KD  + +HIAA+ GQ E+   L++     +  T   F  TPLH  A  G I + Q+LL++ A V+ Q                                 + +G+TPLH +A K        L   G L N  + + FTPLHL+ Q GH + +  LI   A ++   + G TP+H   +  +  V+ IL     +I+   + G T LH+A+   +  + + L+++GA++D       TPL    ++ H  I+ +L     N N +TV
Sbjct:  476 ASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF--TPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTV 764          

HSP 4 Score: 99.7525 bits (247), Expect = 6.272e-21
Identity = 82/307 (26.71%), Postives = 144/307 (46.91%), Query Frame = 3
Query:  300 IHTNVSNLIDAVSINNFDK----VKEFIRAGHNLIID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLC---LIGRL--------------------------PNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            I+T+ +N ++A+ + + D     V E +R G   I+D   K G + +HIA+  GQ E++K LL+     NV + + F  TPL+ AA      ++++LL  GA  ++  +  G TPL  +  +G+ + V  L      G++                          P++ + S FTPLH+A   G+      LI+ GAD++   +   +PLH   ++G   +  +L+    +I  + ++G T LH AA     ++  +L+E GA I  +      PL +A +  H +   IL       ++ TV +L
Sbjct:   37 INTSNANGLNALHLASKDGHIHVVSELLRRG--AIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGF--TPLYMAAQENHDAVVRLLLSNGANQSLA-TEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL 338          

HSP 5 Score: 98.5969 bits (244), Expect = 1.264e-20
Identity = 72/245 (29.39%), Postives = 112/245 (45.71%), Query Frame = 3
Query:  372 RAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R+GH  ++D             K+G +P+H+AA+   ++  + LL      +  T D    T LH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L   G   +    S  TPLH+A   G       L++  A        G+TPLH   R     + RIL+     ++ R +   T LHIA+ L    I  LL++ GA +D       T L +A K+   E+  +L
Sbjct:  280 RSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL--TALHVAAHCGHVRVAKLLLDRNADANAR-ALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 521          

HSP 6 Score: 71.2478 bits (173), Expect = 3.664e-12
Identity = 50/169 (29.59%), Postives = 86/169 (50.89%), Query Frame = 3
Query:  564 MLLERGAQVNIQDSTHGNTPLHESAWKG-YSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            M+ E GAQ +      GNT    +A  G   + +E+L     + N  N +    LHLA + GH      L+R GA + +  + G+T LH     G   V ++L+  +  +N ++QNG T L++AA      + +LL+ +GA+  +      TPL VA+++ H +++ +L
Sbjct:    1 MVTENGAQGD------GNTSFLRAARAGNLERVLEHLKNNIDI-NTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL 162          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 129.028 bits (323), Expect = 3.391e-30
Identity = 94/294 (31.97%), Postives = 146/294 (49.66%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSIPN---EMCSVINNPEQ 1202
            N    V+  +R G ++    + G +P+H+AA  G + I+ YLLQ  A P    + P     TPLH AA   Q DII++LL  GAQV+ + +    TPLH ++  G    V  L   G   +     ++T LH+A + G ++    LI  GA + A  + G TPLH   +YGH  V+++L+    D++ + +NG T LH+A     +++  LL+E GAS         TPL +A +K+  +I   L       N ++   F P +L    S Q  H  I N   E  + +N+P +
Sbjct:  381 NRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP----DVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR-AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL----SSQEGHAEISNLLIEHKAAVNHPAK 665          

HSP 2 Score: 105.145 bits (261), Expect = 8.642e-23
Identity = 84/315 (26.67%), Postives = 138/315 (43.81%), Query Frame = 3
Query:  258 IQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD--------------------------------STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            I+ L +N   +        + L  A  + N D V   ++ G  +    KD  + +HIAA+ GQ E+   L++     +  T   F  TPLH  A  G I + Q+LL++ A V+ Q                                 + +G+TPLH +A K        L   G L N  + + FTPLHL+ Q GH + +  LI   A ++   + G TP+H   +  +  V+ IL     +I+   + G T LH+A+   +  + + L+++GA++D       TPL    ++ H  I+ +L     N N +TV
Sbjct:  452 IRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF--TPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTV 764          

HSP 3 Score: 105.145 bits (261), Expect = 9.338e-23
Identity = 76/251 (30.28%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGKS---PIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+   ++    LL      +V +   F  TPLH A+  G  +I  +L+++GA VN   + H  +PLH +A  G +  V  L   G           TPLH A + GH Q    L+  GA ISA+ + G  PLH   +  H   +RIL+     +++   +  TALH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  142 DGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGF--TPLHIASHYGNQNIANLLIQKGADVNY-SAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELL 389          

HSP 4 Score: 98.9821 bits (245), Expect = 7.628e-21
Identity = 85/323 (26.32%), Postives = 150/323 (46.44%), Query Frame = 3
Query:  252 RKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDK----VKEFIRAGHNLIID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLC---LIGRL--------------------------PNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            R ++ L+ N       I+T+ +N ++A+ + + D     V E +R G   I+D   K G + +HIA+  GQ E++K LL+     NV + + F  TPL+ AA      ++++LL  GA  ++  +  G TPL  +  +G+ + V  L      G++                          P++ + S FTPLH+A   G+      LI+ GAD++   +   +PLH   ++G   +  +L+    +I  + ++G T LH AA     ++  +L+E GA I  +      PL +A +  H +   IL       ++ TV +L
Sbjct:   26 RVLEHLKNN-----IDINTSNANGLNALHLASKDGHIHVVSELLRRG--AIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGF--TPLYMAAQENHDAVVRLLLSNGANQSLA-TEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL 338          

HSP 5 Score: 96.6709 bits (239), Expect = 4.551e-20
Identity = 72/245 (29.39%), Postives = 112/245 (45.71%), Query Frame = 3
Query:  372 RAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R+GH  ++D             K+G +P+H+AA+   ++  + LL      +  T D    T LH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L   G   +    S  TPLH+A   G       L++  A        G+TPLH   R     + RIL+     ++ R +   T LHIA+ L    I  LL++ GA +D       T L +A K+   E+  +L
Sbjct:  280 RSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL--TALHVAAHCGHVRVAKLLLDRNADANAR-ALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 521          

HSP 6 Score: 69.3218 bits (168), Expect = 1.007e-11
Identity = 50/169 (29.59%), Postives = 86/169 (50.89%), Query Frame = 3
Query:  564 MLLERGAQVNIQDSTHGNTPLHESAWKG-YSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            M+ E GAQ +      GNT    +A  G   + +E+L     + N  N +    LHLA + GH      L+R GA + +  + G+T LH     G   V ++L+  +  +N ++QNG T L++AA      + +LL+ +GA+  +      TPL VA+++ H +++ +L
Sbjct:    1 MVTENGAQGD------GNTSFLRAARAGNLERVLEHLKNNIDI-NTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL 162          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334060)

HSP 1 Score: 129.413 bits (324), Expect = 3.797e-30
Identity = 94/292 (32.19%), Postives = 145/292 (49.66%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLPENLRENFSVQSRHVSIPN---EMCSVINNP 1196
            N    V+  +R G ++    + G +P+H+AA  G + I+ YLLQ  A P    + P     TPLH AA   Q DII++LL  GAQV+ + +    TPLH ++  G    V  L   G   +     ++T LH+A + G ++    LI  GA + A  + G TPLH   +YGH  V+++L+    D++ + +NG T LH+A     +++  LL+E GAS         TPL +A +K+  +I   L       N ++   F P +L    S Q  H  I N   E  + +N+P
Sbjct:  531 NRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP----DVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR-AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL----SSQEGHAEISNLLIEHKAAVNHP 813          

HSP 2 Score: 106.686 bits (265), Expect = 3.991e-23
Identity = 76/251 (30.28%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII------DKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + F  +   ++ GH+ ++      D  GK     +HIAA+   ++    LL      +V +   F  TPLH A+  G  +I  +L+++GA VN   + H  +PLH +A  G +  V  L   G           TPLH A + GH Q    L+  GA ISA+ + G  PLH   +  H   +RIL+     +++   +  TALH+AA     ++ KLL++  A  + R +   TPL +A KK+  +++E+L
Sbjct:  292 DGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGF--TPLHIASHYGNQNIANLLIQKGADVNYS-AKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELL 539          

HSP 3 Score: 105.916 bits (263), Expect = 8.051e-23
Identity = 80/291 (27.49%), Postives = 130/291 (44.67%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQ--------------------------------DSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            A  + N D V   ++ G  +    KD  + +HIAA+ GQ E+   L++     +  T   F  TPLH  A  G I + Q+LL++ A V+ Q                                 + +G+TPLH +A K        L   G L N  + + FTPLHL+ Q GH + +  LI   A ++   + G TP+H   +  +  V+ IL     +I+   + G T LH+A+   +  + + L+++GA++D       TPL    ++ H  I+ +L     N N +TV
Sbjct:  626 ASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF--TPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTV 914          

HSP 4 Score: 100.138 bits (248), Expect = 4.323e-21
Identity = 82/307 (26.71%), Postives = 144/307 (46.91%), Query Frame = 3
Query:  300 IHTNVSNLIDAVSINNFDK----VKEFIRAGHNLIID---KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLC---LIGRL--------------------------PNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            I+T+ +N ++A+ + + D     V E +R G   I+D   K G + +HIA+  GQ E++K LL+     NV + + F  TPL+ AA      ++++LL  GA  ++  +  G TPL  +  +G+ + V  L      G++                          P++ + S FTPLH+A   G+      LI+ GAD++   +   +PLH   ++G   +  +L+    +I  + ++G T LH AA     ++  +L+E GA I  +      PL +A +  H +   IL       ++ TV +L
Sbjct:  187 INTSNANGLNALHLASKDGHIHVVSELLRRG--AIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGF--TPLYMAAQENHDAVVRLLLSNGANQSLA-TEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL 488          

HSP 5 Score: 98.2117 bits (243), Expect = 1.624e-20
Identity = 72/245 (29.39%), Postives = 112/245 (45.71%), Query Frame = 3
Query:  372 RAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R+GH  ++D             K+G +P+H+AA+   ++  + LL      +  T D    T LH AA  G + + ++LL+R A  N + + +G TPLH +  K   + VE L   G   +    S  TPLH+A   G       L++  A        G+TPLH   R     + RIL+     ++ R +   T LHIA+ L    I  LL++ GA +D       T L +A K+   E+  +L
Sbjct:  430 RSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL--TALHVAAHCGHVRVAKLLLDRNADANAR-ALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 671          

HSP 6 Score: 54.299 bits (129), Expect = 4.663e-7
Identity = 31/112 (27.68%), Postives = 60/112 (53.57%), Query Frame = 3
Query:  732 AVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A + G+ +     ++   DI+  N  G   LH   + GH  V   L+     ++   + G+TALHIA+   + ++ KLL+E  AS+++++    TPL +A +++H  ++ +L
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLL 279          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd6b (ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE-030916-4])

HSP 1 Score: 186.037 bits (471), Expect = 3.338e-49
Identity = 112/311 (36.01%), Postives = 168/311 (54.02%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPS 1253
            L+ A      D V + I  G  + I K+G++P+H+AA  G + +++ LL A    +++  D+ D T LH+AA +G  D+I  L++ G  ++ QD   GNT LHE+AW G+SQTV+ L   G   +  N +  T LHLA Q GH Q+ R L+  G+   ++N  GDT LH   RY H  V R L+     +  RN  GDTALHIAA L  RK  ++L+E+GA   I+N   ET LD A ++++S  + +L T +P    ++ +   E  R+    + R  S+P +        E  P +  S SP + T  S
Sbjct:   16 LLIASHKGQADHVVQLINRGAKVAITKNGRTPLHLAAYKGHIAVVRILLAAG--CDLDIEDDGDQTALHRAAVVGNTDVISALVQEGCALDRQDKD-GNTALHEAAWHGFSQTVKLLVKAGANVHAKNKAGNTALHLACQNGHVQSCRVLLLGGSRPDSKNSVGDTCLHVSARYNHVSVIRALLGAICSVTDRNHTGDTALHIAATLNHRKTVRMLLEAGADSRIKNNTGETALDQA-RENNSPEVALLLTKAPQAELQSRTHREER-RDKMKTEGRAQSVPRD--------EMLPRKCDSASPAQDTHGS 313          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd6b (ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE-030916-4])

HSP 1 Score: 183.726 bits (465), Expect = 2.625e-48
Identity = 111/311 (35.69%), Postives = 167/311 (53.70%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPS 1253
            L+ A      D V + I  G  + I K+G++P+H+AA  G + +++ LL A    +++  D+ D T LH+AA +G  D+I  L++ G  ++ QD   GNT LHE+AW G+SQTV+ L   G   +  N +  T LHLA Q GH Q+ R L+  G+   ++N  GDT LH   RY H  V R L+     +  RN  GDTALHIAA L  RK  ++L+E+GA   I+N   ET LD A ++++S  + +L T +P +  +  +      R+    + R  S+P +        E  P +  S SP + T  S
Sbjct:   16 LLIASHKGQADHVVQLINRGAKVAITKNGRTPLHLAAYKGHIAVVRILLAAG--CDLDIEDDGDQTALHRAAVVGNTDVISALVQEGCALDRQDKD-GNTALHEAAWHGFSQTVKLLVKAGANVHAKNKAGNTALHLACQNGHVQSCRVLLLGGSRPDSKNSVGDTCLHVSARYNHVSVIRALLGAICSVTDRNHTGDTALHIAATLNHRKTVRMLLEAGADSRIKNNTGETALDQA-RENNSPEVALLLTKAPQSFSRGRTV--RKRRDKMKTEGRAQSVPRD--------EMLPRKCDSASPAQDTHGS 312          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 125.561 bits (314), Expect = 8.679e-29
Identity = 88/255 (34.51%), Postives = 134/255 (52.55%), Query Frame = 3
Query:  354 KVKEFI-RAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEI----IEILKTCSPNTNQ 1094
            KV E + + G +L  + + G +PIH+AA  G   I+K L    A P    NT +    T LH AA  GQID+++ LL+ GA+V+I+ +    T LH ++  G  + V+ L   G LPN    S +TPLHL+ + GH +    L+  G+ +SA  + G TPLH   +YG   V+ +L+      +   ++G T LH+AA    +++  LL++ GAS         TPL +A KK+  EI    +E    C+  T Q
Sbjct:  401 KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASP----NTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIK-AKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQ 650          

HSP 2 Score: 120.553 bits (301), Expect = 2.711e-27
Identity = 74/229 (32.31%), Postives = 122/229 (53.28%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            G++ +H+AA  GQ+++++YLLQ     ++   D  D T LH A+ +G+++I+Q LL++GA  N   +T G TPLH SA +G+ +    L   G   +      FTPLH+A + G  +    L++  A   A  + G TPLH    Y +  V+ +L+      +   +NG T LHIAA   + +I   L+E GA  +    Q  +PL +A ++   +++ +L T   N N
Sbjct:  453 GETALHMAARAGQIDVVRYLLQNGAKVDIKAKD--DQTALHIASRLGKLEIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVN 678          

HSP 3 Score: 108.227 bits (269), Expect = 1.744e-23
Identity = 77/268 (28.73%), Postives = 127/268 (47.39%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL--KTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQ 1202
            G +P+H++A  G  EI   LL+     +  T   F  TPLH AA  GQ+++  +LL++ A  +    + G TPLH +A     +    L   G  P+    + +TPLH+A +    +    L+  GA+ +   R G +PLH   + G   +  +L++   ++N  N+NG T LH+AA   +  +T++L+  GA ID +     TPL VA    + ++   L      PN   K +     ++   FS Q  H  I N +     +P +
Sbjct:  519 GYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGF--TPLHVAAKYGQLEVANLLLQKKAAPDAAGKS-GLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNE 783          

HSP 4 Score: 103.219 bits (256), Expect = 6.293e-22
Identity = 71/245 (28.98%), Postives = 118/245 (48.16%), Query Frame = 3
Query:  372 RAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R+GH  +++             K+G SP+H+A +   L  ++ LLQ     +  T D    T LH AA  G   + ++++++ A  N + + +G TPLH +  K   + +E L   G     V  S  TP+H+A   GH    + L   GA  +  N  G+T LH   R G   V R L+     ++ + ++  TALHIA+ L + +I + L++ GA  +       TPL ++ ++ H EI  +L
Sbjct:  297 RSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYL--TALHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALL 538          

HSP 5 Score: 97.0561 bits (240), Expect = 4.863e-20
Identity = 65/224 (29.02%), Postives = 112/224 (50.00%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            KDG +P+H  A +G  ++++ LL         T +    +PLH A     ++ +Q+LL+  A V+  D T+   T LH +A  G+ +  + +      PN    + FTPLH+A +    +    L++ GA + A    G TP+H     GH  + + L       N  N  G+TALH+AA   +  + + L+++GA +DI+   ++T L +A +    EI++ L
Sbjct:  286 KDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGL--SPLHMATQGDHLNCVQLLLQHNAPVD--DVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQL 505          

HSP 6 Score: 88.5817 bits (218), Expect = 2.555e-17
Identity = 75/307 (24.43%), Postives = 132/307 (43.00%), Query Frame = 3
Query:  357 VKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLE---------------------RGAQVNIQD---------------STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNG---------------------------------DTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            V+E +  G N+    ++G +P+++AA+   L+++++LL+     ++ T D F  TPL  A   G   ++ +LLE                     + A + +Q+               +  G TPLH +A  G       L   G   + +  +  TPLH+A + G+    + L+  G+ I A+ + G TPLH G R GH  V  +L+     I  + +NG                                  TALH+AA     K+ K++V+  A+ + + +   TPL +A KK+  +++E+L
Sbjct:  102 VRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGF--TPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 406          

HSP 7 Score: 79.337 bits (194), Expect = 1.383e-14
Identity = 73/250 (29.20%), Postives = 97/250 (38.80%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQA------------FPMYNVNTPDN-------FDS------------TPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYG--------------------------------------HAGVSRILISVSTDINQRNQNGDTALHIAAAL 941
            K G +P+H+AA+ GQLE+   LLQ              P++     DN        D             TPLH AA   Q++I   LLE GA+ N   +  G +PLH +A +G    V  L       N+ N +  TPLHLA Q      T  L+  GA+I AQ + G TPLH    YG                                      H  +  +L+      N+   NG+TAL IA  L
Sbjct:  550 KKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTV-TRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRL 798          

HSP 8 Score: 77.411 bits (189), Expect = 6.602e-14
Identity = 40/125 (32.00%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  693 NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            N+ N +    LHLA + GH +    L++ GA++ A  + G+T LH     G   V R L++   ++N ++QNG T L++AA      + + L+E+ +S  I      TPL VAL++ H +++ +L
Sbjct:   47 NICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLL 171          

HSP 9 Score: 63.5438 bits (153), Expect = 1.200e-9
Identity = 51/172 (29.65%), Postives = 80/172 (46.51%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPN-----LVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDIN 893
            + + G SP+H+AA+ G ++++  LL      NVN  +    TPLH AA   +  + ++LL  GA+++ Q  + G TPLH +   G  +   +L      PN     +VN      +  + Q GH      L++ GA  +     G+T L    R G+  V   L  V TD N
Sbjct:  647 VTRQGISPLHLAAQEGSVDLVSLLLTK--QANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKS-GYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGV-TDEN 814          

HSP 10 Score: 62.003 bits (149), Expect = 3.491e-9
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 3
Query:  528 KAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIR 998
            +AA  G ++ +   L+ G  +NI +  +G   LH ++ +G+ + V  L  +G   +       T LH+A   G  +  R L+  GA+++AQ++ G TPL+   +  H  V R L+  ++  +   ++G T L +A      ++  LL+E+     +R
Sbjct:   26 RAARAGNLEKVLDYLKTGVDINICNQ-NGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR 181          

HSP 11 Score: 58.9214 bits (141), Expect = 2.409e-8
Identity = 30/112 (26.79%), Postives = 64/112 (57.14%), Query Frame = 3
Query:  732 AVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A + G+ +   + ++ G DI+  N+ G   LH   + GH  V   L+ +  +++   + G+TALHIA+   + ++ + LV +GA+++ ++    TPL +A +++H +++  L
Sbjct:   27 AARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFL 138          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 124.79 bits (312), Expect = 1.576e-28
Identity = 88/255 (34.51%), Postives = 134/255 (52.55%), Query Frame = 3
Query:  354 KVKEFI-RAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEI----IEILKTCSPNTNQ 1094
            KV E + + G +L  + + G +PIH+AA  G   I+K L    A P    NT +    T LH AA  GQID+++ LL+ GA+V+I+ +    T LH ++  G  + V+ L   G LPN    S +TPLHL+ + GH +    L+  G+ +SA  + G TPLH   +YG   V+ +L+      +   ++G T LH+AA    +++  LL++ GAS         TPL +A KK+  EI    +E    C+  T Q
Sbjct:  406 KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASP----NTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIK-AKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQ 655          

HSP 2 Score: 119.783 bits (299), Expect = 4.749e-27
Identity = 74/229 (32.31%), Postives = 122/229 (53.28%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            G++ +H+AA  GQ+++++YLLQ     ++   D  D T LH A+ +G+++I+Q LL++GA  N   +T G TPLH SA +G+ +    L   G   +      FTPLH+A + G  +    L++  A   A  + G TPLH    Y +  V+ +L+      +   +NG T LHIAA   + +I   L+E GA  +    Q  +PL +A ++   +++ +L T   N N
Sbjct:  458 GETALHMAARAGQIDVVRYLLQNGAKVDIKAKD--DQTALHIASRLGKLEIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVN 683          

HSP 3 Score: 106.686 bits (265), Expect = 6.359e-23
Identity = 86/282 (30.50%), Postives = 129/282 (45.74%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQA------------FPMYNVNTPDN-------FDS------------TPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILK-------TCSPNTNQKTVSFLPENLRE 1130
            K G +P+H+AA+ GQLE+   LLQ              P++     DN        D             TPLH AA   Q++I   LLE GA+ N   +  G +PLH +A +G    V  L       N+ N +  TPLHLA Q      T  L+  GA+I AQ + G TPLH    YG+  ++  L+      N + +NG T LH AA      I  +L++ GAS +   +   T L +A +  +  +++ L+       T +P T +  ++ +PE + E
Sbjct:  555 KKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTV-TRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTDENLTATPITEKHKIN-VPETMNE 834          

HSP 4 Score: 103.219 bits (256), Expect = 6.405e-22
Identity = 79/268 (29.48%), Postives = 124/268 (46.27%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLIID-KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAV-------------QGG-------------HNQTTRN-------LIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            A      D V+  ++ G  + I  KD ++ +HIA+  G+LEI++ LLQ   + N  T   +  TPLH +A  G  +I  +LLE+G+ ++   +  G TPLH +A  G  +    L      P+    S  TPLH+A              QG              H    +N       L+  GA+ +   R G +PLH   + G   +  +L++   ++N  N+NG T LH+AA   +  +T++L+  GA ID +     TPL VA
Sbjct:  465 AARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGY--TPLHLSAREGHQEIAALLLEQGSSLSAA-TKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVA 729          

HSP 5 Score: 102.064 bits (253), Expect = 1.455e-21
Identity = 71/245 (28.98%), Postives = 118/245 (48.16%), Query Frame = 3
Query:  372 RAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R+GH  +++             K+G SP+H+A +   L  ++ LLQ     +  T D    T LH AA  G   + ++++++ A  N + + +G TPLH +  K   + +E L   G     V  S  TP+H+A   GH    + L   GA  +  N  G+T LH   R G   V R L+     ++ + ++  TALHIA+ L + +I + L++ GA  +       TPL ++ ++ H EI  +L
Sbjct:  302 RSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYL--TALHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALL 543          

HSP 6 Score: 95.9005 bits (237), Expect = 1.123e-19
Identity = 65/224 (29.02%), Postives = 112/224 (50.00%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            KDG +P+H  A +G  ++++ LL         T +    +PLH A     ++ +Q+LL+  A V+  D T+   T LH +A  G+ +  + +      PN    + FTPLH+A +    +    L++ GA + A    G TP+H     GH  + + L       N  N  G+TALH+AA   +  + + L+++GA +DI+   ++T L +A +    EI++ L
Sbjct:  291 KDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGL--SPLHMATQGDHLNCVQLLLQHNAPVD--DVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQL 510          

HSP 7 Score: 87.4261 bits (215), Expect = 4.484e-17
Identity = 75/307 (24.43%), Postives = 130/307 (42.35%), Query Frame = 3
Query:  357 VKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNI----------QDSTH--------------------------GNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNG---------------------------------DTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            V+E +  G N+    ++G +P+++AA+   L+++++LL+     ++ T D F  TPL  A   G   ++ +LLE   +  +          +D T                           G TPLH +A  G       L   G   + +  +  TPLH+A + G+    + L+  G+ I A+ + G TPLH G R GH  V  +L+     I  + +NG                                  TALH+AA     K+ K++V+  A+ + + +   TPL +A KK+  +++E+L
Sbjct:  107 VRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGF--TPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 411          

HSP 8 Score: 77.0258 bits (188), Expect = 8.741e-14
Identity = 40/125 (32.00%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  693 NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            N+ N +    LHLA + GH +    L++ GA++ A  + G+T LH     G   V R L++   ++N ++QNG T L++AA      + + L+E+ +S  I      TPL VAL++ H +++ +L
Sbjct:   52 NICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLL 176          

HSP 9 Score: 61.6178 bits (148), Expect = 4.580e-9
Identity = 41/157 (26.11%), Postives = 78/157 (49.68%), Query Frame = 3
Query:  528 KAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIR 998
            +AA  G ++ +   L+ G  +NI +  +G   LH ++ +G+ + V  L  +G   +       T LH+A   G  +  R L+  GA+++AQ++ G TPL+   +  H  V R L+  ++  +   ++G T L +A      ++  LL+E+     +R
Sbjct:   31 RAARAGNLEKVLDYLKTGVDINICNQ-NGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR 186          

HSP 10 Score: 58.5362 bits (140), Expect = 3.297e-8
Identity = 30/112 (26.79%), Postives = 64/112 (57.14%), Query Frame = 3
Query:  732 AVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A + G+ +   + ++ G DI+  N+ G   LH   + GH  V   L+ +  +++   + G+TALHIA+   + ++ + LV +GA+++ ++    TPL +A +++H +++  L
Sbjct:   32 AARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFL 143          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd28b (ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GENE-070622-4])

HSP 1 Score: 123.635 bits (309), Expect = 2.204e-28
Identity = 75/239 (31.38%), Postives = 126/239 (52.72%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G LE+++ LL      N+N  D  D   +H AA +G ++++++L+  GA+V  +D     TPLH +A  G    V+YL  +G   N  N    TPLH+A   G +     LI CGA+++  N  G  PLH      H  +   +L+    D+N ++++G T LH+ A   R   ++ ++++GA ID  +    TPL +A +  H  +I  L T   +T ++ V
Sbjct:  135 VSDRAGRTALHHAAFSGHLEMVRLLLSRGA--NINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKK-AYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGV 370          

HSP 2 Score: 105.916 bits (263), Expect = 7.502e-23
Identity = 69/226 (30.53%), Postives = 115/226 (50.88%), Query Frame = 3
Query:  411 SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVALKKSHSEIIEIL 1067
            SP+H+AA +G  + L+ L+Q+    +V T      TPL  AA  G ++ + +L+ +GA + ++D T   TP+H +A  G+S+ +  L     L + V+       TPL L+V GGH     +LI  GA++ A++++G T LH G   GH      L+  S     R+  G + +H+A+A     +   L+ +  S++    I + Q  TPL  A    H   +E+L
Sbjct:  552 SPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGH--TPLDLAAFKGHVECVDVLINQGASILVKDYTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACYNGHDTCVEVL 775          

HSP 3 Score: 101.679 bits (252), Expect = 1.404e-21
Identity = 75/236 (31.78%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQ-TVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            A  + + + VK  +  G  +   DK   +P+H AA +G + ++KYLL      ++N P+ + +TPLH A   GQ  ++  L+E GA VN Q +  G  PLH +A   +    +E L   G   N+ +    TPLH+    G    ++ +I+ GA+I  +++ G+TPLH   RYGH  +   LI+   D  +R  +G   LH+AA        + L+ SG  ID  +    T L  A
Sbjct:  180 AAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMG--VDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVN-QVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAA 412          

HSP 4 Score: 92.0485 bits (227), Expect = 1.433e-18
Identity = 72/284 (25.35%), Postives = 124/284 (43.66%), Query Frame = 3
Query:  351 DKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTH--------------------------------GNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEI-IEILKTCSPNTNQKT 1100
            D+V+  I    ++ + D + ++P+H AA  G  EI++ L+       VN  DN   TPLH+A +    + +Q+LL+  A VN +D                                   G T LH +A+ G+ + V  L   G   N  +      +H A   GH +  + L+  GA++  +++   TPLH     G   V + L+ +  D+N+ N  G+T LH+A    +  +   L+E GA+++  N +   PL       H  + +E+L     + N K+
Sbjct:   22 DEVRSLIFKKEDVNVQDNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKS 303          

HSP 5 Score: 87.0409 bits (214), Expect = 4.245e-17
Identity = 71/228 (31.14%), Postives = 110/228 (48.25%), Query Frame = 3
Query:  357 VKEFIRAGHNL-IIDKDGKSPIHI--AAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            V E I  G N+  +++ G +P+H   A+ +G L  L+ L+      N+ + D    TPLH  A  G+    Q +++ GA+++ +D   GNTPLH +A  G+   +  L   G            PLHLA   G +   R L+  G DI   + FG T LH     G+     +L++   D N+++  G T LH AAA    +    LV SGA+++  + +  TPL  A
Sbjct:  255 VNELIECGANVNQVNEKGFAPLHFTAASRHGAL-CLELLVGNGADVNIKSKDG--KTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKN-GNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGANVNELDKRGCTPLHYA 478          

HSP 6 Score: 83.1889 bits (204), Expect = 7.886e-16
Identity = 74/256 (28.91%), Postives = 118/256 (46.09%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRR-KITKLLVESGASIDIRN---------------------IQNETPLDVALKKSHSEII---EILKTCSP 1082
            I  KDGK+P+H+ A +G+    + ++Q      ++  D   +TPLH AA  G   +I  L+  GA    +   HG  PLH +A  G+S     L   G   +  +    T LH A  GG+ +    L+  GAD + ++ FG TPLH      +      L+    ++N+ ++ G T LH AAA     K  + L+ + A+  IR+                     I +ETPLDV ++ S ++I+   ++L   SP
Sbjct:  301 IKSKDGKTPLHMTAIHGRFSRSQAIIQNGA--EIDCEDKNGNTPLHIAARYGHELLINTLITNGADT-AKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGANVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSP 553          

HSP 7 Score: 71.2478 bits (173), Expect = 3.329e-12
Identity = 68/266 (25.56%), Postives = 108/266 (40.60%), Query Frame = 3
Query:  408 KSPIHIAAENGQLEILKYLLQAFPMYN-VNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYL-----------------------C----LIGRL----------PNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDT------PLHTGVRYGHAGVSRILISVSTDI--NQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            ++PIH AA NG  E L+ L+    + + V+  D    TPL  +   G  D +  L+ +GA V+ +D   G T LH  A  G+ + VE L                       C    ++G L          P + ++  +TPLH A   GH+     L+        Q  F  T      PLH  V   + G   +LI   + +  N  +    T LH AA     +  +LL+   A ++  +   +TPL +A +   +  +E+L
Sbjct:  618 RTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAKDKW-GRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACYNGHDTCVEVLLE-------QELFHKTEGNPFSPLHCAVINDNEGAVELLIETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVL 875          

HSP 8 Score: 67.0106 bits (162), Expect = 7.515e-11
Identity = 54/173 (31.21%), Postives = 82/173 (47.40%), Query Frame = 3
Query:  411 SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLP-NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDT 917
            SP+H A  N     ++ L++      VN  D+ + TPLH AA    ++ +Q+LL   AQVN  D+  G TPL  +A  G +  VE L    +    L + +  T LHLA   GH  +   ++    D   I++ N    TPLH   R G   V + L++    +   ++NG T
Sbjct:  790 SPLHCAVINDNEGAVELLIETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAG-GKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSKGHETSALLILEKITDRNLINSTNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYT 961          

HSP 9 Score: 66.6254 bits (161), Expect = 8.914e-11
Identity = 70/257 (27.24%), Postives = 114/257 (44.36%), Query Frame = 3
Query:  351 DKVKEFIRAGHNLIIDKD-GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLH-ESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGH--------NQTTRNLIRCGADISAQNRFGD-------TPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQ-NETPLDVALKKSHSEIIEIL 1067
            D  ++ + +G ++    D G++ +H AA  G LE L  LL      + N  D+F  TPLH AA+      +  L+  GA VN  D   G TPLH  +A     + +EYL      P + +   +  +H A   GH        ++T  +++    + S  +   D       +PLH    +GH     +L+    D++ R   G T L +AA     +   +L+  GASI +++     TP+  A    HSE + +L
Sbjct:  386 DCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGA--DFNRKDSFGRTPLHYAAANCNYQCLFALVGSGANVNELDK-RGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLM---ETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKGHVECVDVLINQGASILVKDYTLKRTPIHAAATNGHSECLRLL 636          

HSP 10 Score: 66.2402 bits (160), Expect = 1.152e-10
Identity = 66/251 (26.29%), Postives = 111/251 (44.22%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLH-KAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSL------------FTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQN-GDTALHIAAALKRRKITKLLVESG---ASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            D  G++P+H AA N   + L  L+ +    NVN  D    TPLH  AAS      ++ LL   A   I+D+  G   +H ++  G+   +E +     L  L+  S              +PLHLA   GH+Q    L++   D+  +   G TPL      GH     +LI+    I  ++     T +H AA     +  +LL+ +    +++DI++   +TPL +++   H++ +  L     N + K
Sbjct:  435 DSFGRTPLHYAAANCNYQCLFALVGSGA--NVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDN-QGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKGHVECVDVLINQGASILVKDYTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAK 682          

HSP 11 Score: 65.4698 bits (158), Expect = 2.319e-10
Identity = 70/246 (28.46%), Postives = 112/246 (45.53%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQA------FPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN--TPLHESAWKGYSQTVEYLCLIGRL-PNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILIS-VSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQN------ETPLDVALKKSHSEIIEIL 1067
            ++ D  G+SP+H+A+  G + +L  LL A       P+      D+   TPLH A   G    +++LLE+     +   T GN  +PLH +        VE L  I  L P +VN +     TPLH A    H +  + L+   A ++  +  G TPL      G      +L+S    D+  ++ N +TALH+A +        L++E    I  RN+ N      +TPL VA +   + +++ L
Sbjct:  713 MVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVIT----DHQGYTPLHWACYNGHDTCVEVLLEQ----ELFHKTEGNPFSPLHCAVINDNEGAVELL--IETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSKGHETSALLILE---KITDRNLINSTNAALQTPLHVAARNGLTVVVQEL 945          

HSP 12 Score: 62.003 bits (149), Expect = 2.705e-9
Identity = 59/217 (27.19%), Postives = 100/217 (46.08%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQV--NIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCG-ADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTD---INQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETP 1019
            +I D  G +P+H A  NG    ++ LL+   +++    + F  +PLH A        +++L+E  + V  N  DS +  TPLH +A+  + + ++ L       N V+    TPL +A + G       L+    AD++ Q+   +T LH     GH   + +++   TD   IN  N    T LH+AA      + + L+  GAS+   +    TP
Sbjct:  750 VITDHQGYTPLHWACYNGHDTCVEVLLEQ-ELFHKTEGNPF--SPLHCAVINDNEGAVELLIETLSPVIVNANDSKN-RTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSKGHETSALLILEKITDRNLINSTNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTP 962          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:NCBI gene;Acc:100101692])

HSP 1 Score: 176.022 bits (445), Expect = 1.968e-45
Identity = 99/284 (34.86%), Postives = 159/284 (55.99%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNE 1172
            L+ A      D V + I  G  + + K G++ +H+AA  G + ++  L++A    +++  D+ + T LH+AA +G  +++ +L++ G  ++ QD   GNT LHE++W G+SQ+V+ L   G      N +  TPLHLA Q GH+Q+ R L+  G+    +N  GDT LH   RY H  V RIL+S    +N++NQ GDT LH+AAAL  RK+ K+L+E+GA   + N   +  LD A   ++S++  +L T +P   + +        RE    + R  S+P E
Sbjct:   14 LLVAAYKGQADNVVQLINKGAKVAVTKHGRTALHLAANKGHVNVVHILVKAG--CDLDIQDDGNQTALHRAAVVGNSEVLALLIQEGCALDRQDKD-GNTALHEASWHGFSQSVKLLVKAGANVLAKNKAGNTPLHLACQNGHSQSCRILLLAGSRADLKNNVGDTCLHVAARYNHLSVIRILLSAFCSVNEKNQAGDTPLHVAAALNHRKVIKVLLEAGADATLLNNAGQIALDTARHHNNSDVA-LLLTKAPQVLRFSRGRSLRKKREKLKEERRAQSVPRE 293          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:NCBI gene;Acc:100101692])

HSP 1 Score: 176.022 bits (445), Expect = 2.095e-45
Identity = 99/284 (34.86%), Postives = 159/284 (55.99%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNE 1172
            L+ A      D V + I  G  + + K G++ +H+AA  G + ++  L++A    +++  D+ + T LH+AA +G  +++ +L++ G  ++ QD   GNT LHE++W G+SQ+V+ L   G      N +  TPLHLA Q GH+Q+ R L+  G+    +N  GDT LH   RY H  V RIL+S    +N++NQ GDT LH+AAAL  RK+ K+L+E+GA   + N   +  LD A   ++S++  +L T +P   + +        RE    + R  S+P E
Sbjct:   14 LLVAAYKGQADNVVQLINKGAKVAVTKHGRTALHLAANKGHVNVVHILVKAG--CDLDIQDDGNQTALHRAAVVGNSEVLALLIQEGCALDRQDKD-GNTALHEASWHGFSQSVKLLVKAGANVLAKNKAGNTPLHLACQNGHSQSCRILLLAGSRADLKNNVGDTCLHVAARYNHLSVIRILLSAFCSVNEKNQAGDTPLHVAAALNHRKVIKVLLEAGADATLLNNAGQIALDTARHHNNSDVA-LLLTKAPQVLRFSRGRSLRKKREKLKEERRAQSVPRE 293          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:NCBI gene;Acc:100101692])

HSP 1 Score: 171.014 bits (432), Expect = 1.818e-44
Identity = 91/249 (36.55%), Postives = 146/249 (58.63%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      D V + I  G  + + K G++ +H+AA  G + ++  L++A    +++  D+ + T LH+AA +G  +++ +L++ G  ++ QD   GNT LHE++W G+SQ+V+ L   G      N +  TPLHLA Q GH+Q+ R L+  G+    +N  GDT LH   RY H  V RIL+S    +N++NQ GDT LH+AAAL  RK+ K+L+E+GA   + N   +  LD A   ++S++  +L
Sbjct:   14 LLVAAYKGQADNVVQLINKGAKVAVTKHGRTALHLAANKGHVNVVHILVKAG--CDLDIQDDGNQTALHRAAVVGNSEVLALLIQEGCALDRQDKD-GNTALHEASWHGFSQSVKLLVKAGANVLAKNKAGNTPLHLACQNGHSQSCRILLLAGSRADLKNNVGDTCLHVAARYNHLSVIRILLSAFCSVNEKNQAGDTPLHVAAALNHRKVIKVLLEAGADATLLNNAGQIALDTARHHNNSDVALLL 259          

HSP 2 Score: 82.4185 bits (202), Expect = 1.150e-15
Identity = 55/189 (29.10%), Postives = 100/189 (52.91%), Query Frame = 3
Query:  531 AASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            AA  GQ D +  L+ +GA+V +  + HG T LH +A KG+   V  L   G   ++ +    T LH A   G+++    LI+ G  +  Q++ G+T LH    +G +   ++L+    ++  +N+ G+T LH+A      +  ++L+ +G+  D++N   +T L VA + +H  +I IL +   + N+K
Sbjct:   17 AAYKGQADNVVQLINKGAKVAV--TKHGRTALHLAANKGHVNVVHILVKAGCDLDIQDDGNQTALHRAAVVGNSEVLALLIQEGCALDRQDKDGNTALHEASWHGFSQSVKLLVKAGANVLAKNKAGNTPLHLACQNGHSQSCRILLLAGSRADLKNNVGDTCLHVAARYNHLSVIRILLSAFCSVNEK 203          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:NCBI gene;Acc:100101692])

HSP 1 Score: 171.4 bits (433), Expect = 3.180e-44
Identity = 91/249 (36.55%), Postives = 146/249 (58.63%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      D V + I  G  + + K G++ +H+AA  G + ++  L++A    +++  D+ + T LH+AA +G  +++ +L++ G  ++ QD   GNT LHE++W G+SQ+V+ L   G      N +  TPLHLA Q GH+Q+ R L+  G+    +N  GDT LH   RY H  V RIL+S    +N++NQ GDT LH+AAAL  RK+ K+L+E+GA   + N   +  LD A   ++S++  +L
Sbjct:   14 LLVAAYKGQADNVVQLINKGAKVAVTKHGRTALHLAANKGHVNVVHILVKAG--CDLDIQDDGNQTALHRAAVVGNSEVLALLIQEGCALDRQDKD-GNTALHEASWHGFSQSVKLLVKAGANVLAKNKAGNTPLHLACQNGHSQSCRILLLAGSRADLKNNVGDTCLHVAARYNHLSVIRILLSAFCSVNEKNQAGDTPLHVAAALNHRKVIKVLLEAGADATLLNNAGQIALDTARHHNNSDVALLL 259          

HSP 2 Score: 82.4185 bits (202), Expect = 1.388e-15
Identity = 55/189 (29.10%), Postives = 100/189 (52.91%), Query Frame = 3
Query:  531 AASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            AA  GQ D +  L+ +GA+V +  + HG T LH +A KG+   V  L   G   ++ +    T LH A   G+++    LI+ G  +  Q++ G+T LH    +G +   ++L+    ++  +N+ G+T LH+A      +  ++L+ +G+  D++N   +T L VA + +H  +I IL +   + N+K
Sbjct:   17 AAYKGQADNVVQLINKGAKVAV--TKHGRTALHLAANKGHVNVVHILVKAGCDLDIQDDGNQTALHRAAVVGNSEVLALLIQEGCALDRQDKDGNTALHEASWHGFSQSVKLLVKAGANVLAKNKAGNTPLHLACQNGHSQSCRILLLAGSRADLKNNVGDTCLHVAARYNHLSVIRILLSAFCSVNEK 203          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 126.716 bits (317), Expect = 2.727e-29
Identity = 74/239 (30.96%), Postives = 128/239 (53.56%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G +E++  LL      N+N  D  D   +H AA +G I+++++L+  GA+V  +D     TPLH +A  G    ++YL  +G   N  N    TPLH+A   G +     LI CGA+++  N  G TPLH      H  +   +L+    D+N ++++G T LH+ A   R   +++++++GA ID  +    TPL +A +  H  +I  L T   +T+++ +
Sbjct:  162 VSDRAGRTALHHAAFSGHVEMVSLLLSRGA--NINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKK-SYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGI 397          

HSP 2 Score: 111.309 bits (277), Expect = 1.787e-24
Identity = 84/286 (29.37%), Postives = 123/286 (43.01%), Query Frame = 3
Query:  345 NFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRC----------------------------------GADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            + + V   +  G N+   DK  +  IH AA  G +E++K L+       V   D    TPLH AAS G I +I+ LL+ G  +N + + +GNTPLH + + G    V  L   G   N VN   FTPLH A    H      L+ C                                  GA+I  +++ G+TPLH   RYGH  +   LI+   D ++R  +G   LH+AA        + L+ SG  ID  +    T L  A    + E + +L +   + N+K
Sbjct:  179 HVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGA--EVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMN-ESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKK 461          

HSP 3 Score: 101.679 bits (252), Expect = 2.218e-21
Identity = 65/228 (28.51%), Postives = 117/228 (51.32%), Query Frame = 3
Query:  411 SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF-----TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVALKKSHSEIIEIL 1067
            SP+H+AA +G  + L+ L+Q+  + +++  ++   TPL  AA  G ++ + +L+ +GA + ++D     TP+H +A  G+S+ +  L  IG         +      TPL L+V  GH +   +L+  GA++ A++++G T LH G   GH      L+  + +   R+  G T +H+AAA     +   L+++  S+D    I +    TPL  A    H   +E+L
Sbjct:  579 SPLHLAAYHGHHQALEVLVQS--LLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLL--IGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELL 802          

HSP 4 Score: 97.4413 bits (241), Expect = 4.315e-20
Identity = 86/324 (26.54%), Postives = 148/324 (45.68%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQ-KTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            L+ A+   + D+V+  I    ++   D + ++P+H AA  G  EI++ L+       VN  D+   TPLH+A +    D +Q+LL+  A VN +D     TPLH +A     +  E L  +    N+ + +  T LH A   GH +    L+  GA+I+A ++     +H     GH  V ++L++   ++  +++   T LH AA+     + K L++ G  ++  N    TPL VA       ++  L  C  N NQ     F P     +F+  S H ++  E+  ++ N      ++K     +   P     + G FSR
Sbjct:   39 LVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKN-WQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTP----LHFAAASTHGALCLEL--LVCNGADVNIKSK-----DGKTPLHMTAIHGRFSR 348          

HSP 5 Score: 92.8189 bits (229), Expect = 9.930e-19
Identity = 72/228 (31.58%), Postives = 112/228 (49.12%), Query Frame = 3
Query:  357 VKEFIRAGHNL-IIDKDGKSPIHIAAE--NGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            V E I  G N+  +++ G +P+H AA   +G L  L+ L+      N+ + D    TPLH  A  G+    Q++++ GA+++ +D   GNTPLH +A  G+   +  L       +        PLHLA   G +   R L+  G DI   + FG T LH     G+     +L+S   D N++++ G T LH AAA    +    LV SGAS++  + +  +PL  A
Sbjct:  282 VNELIDCGANVNQVNERGFTPLHFAAASTHGAL-CLELLVCNGADVNIKSKDG--KTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKN-GNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYA 505          

HSP 6 Score: 86.2705 bits (212), Expect = 1.342e-16
Identity = 72/254 (28.35%), Postives = 113/254 (44.49%), Query Frame = 3
Query:  351 DKVKEFIRAGHNLIIDKD-GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGY-SQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIR----------CGADI--SAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRN-IQNETPLDVALKKSHSEIIEIL 1067
            D  ++ + +G ++    D G++ +H AA  G LE L  LL      + N  D F  TPLH AA+      +  L+  GA VN  D   G +PLH +A      + +EYL      P + +   +  +H A   GH      + R           G D+   A+ R   +PLH    +GH     +L+    D++ RN  G T L +AA     +   +L+  GASI +++ +   TP+  A    HSE + +L
Sbjct:  413 DCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGA--DFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDE-RGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLL 663          

HSP 7 Score: 85.8853 bits (211), Expect = 1.736e-16
Identity = 57/200 (28.50%), Postives = 100/200 (50.00%), Query Frame = 3
Query:  474 FPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKT 1073
             P   + TP    + PL +A   G  D ++ L+ +   VN QD+    TPLH +A+ G ++ +E L L G   N  +    TPLH AV        + L++  AD++A+++   TPLH          +  L+ + +++N  ++ G TALH AA     ++  LL+  GA+I+  + ++   +  A    H E++++L T
Sbjct:   23 LPQRKILTPPGIVTPPLVQAIFNGDPDEVRALIFKKEDVNFQDNEK-RTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVT 221          

HSP 8 Score: 78.1814 bits (191), Expect = 4.198e-14
Identity = 78/305 (25.57%), Postives = 134/305 (43.93%), Query Frame = 3
Query:  147 FLMDNTDVFTSED--DGIGRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLII-DKDGKSPIHIAAENGQLEILKYLLQAFPMYNV--NTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTH-----GNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCG-ADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTD---INQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETP 1019
             L+ N DV  + D  DG G+  L+      +V N  +  + SL      +        + L       + + V+  ++   N ++ D  G++PIH+AA  G + +L  LLQ     +V     DN   TPLH A   G    +++LLE+     ++ ++        TPLH +A+  + + ++ L       N V+ +  TPL +A + G       L+    AD++ Q++  +T LH     GH   + +++   TD   IN  N    T LH+AA      + + L+  GAS+   +    TP
Sbjct:  662 LLIGNADVQAAVDIHDGNGQTPLM-----LSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTP 961          

HSP 9 Score: 62.7734 bits (151), Expect = 2.311e-9
Identity = 47/157 (29.94%), Postives = 73/157 (46.50%), Query Frame = 3
Query:  621 PLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            PL ++ + G    V  L       N  +    TPLH A   G  +    LI  GA ++A++    TPLH  V        ++L+  S D+N R++N  T LHIAAA K  K  + LV   +++++ +    T L  A    H E++ +L +   N N
Sbjct:   38 PLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANIN 194          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd6 (ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI:2154278])

HSP 1 Score: 171.785 bits (434), Expect = 2.614e-44
Identity = 92/249 (36.95%), Postives = 145/249 (58.23%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +I+  L+  G  ++ QD   GNT LHE+AW G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  V R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L
Sbjct:   14 LLIAAYKGQTENVVQLINKGAKVAVTKHGRTPLHLAANKGHLSVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEILTALIREGCALDRQDKD-GNTALHEAAWHGFSQSAKLLVKAGANVLARNKAGNTALHLACQNSHSQSTRILLLGGSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKKVVKVLLEAGADTTIVNNAGQTPLETARYHNNPEVALLL 259          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd6 (ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI:2154278])

HSP 1 Score: 171.785 bits (434), Expect = 2.614e-44
Identity = 92/249 (36.95%), Postives = 145/249 (58.23%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +I+  L+  G  ++ QD   GNT LHE+AW G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  V R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L
Sbjct:   14 LLIAAYKGQTENVVQLINKGAKVAVTKHGRTPLHLAANKGHLSVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEILTALIREGCALDRQDKD-GNTALHEAAWHGFSQSAKLLVKAGANVLARNKAGNTALHLACQNSHSQSTRILLLGGSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKKVVKVLLEAGADTTIVNNAGQTPLETARYHNNPEVALLL 259          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd6 (ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI:2154278])

HSP 1 Score: 171.785 bits (434), Expect = 2.614e-44
Identity = 92/249 (36.95%), Postives = 145/249 (58.23%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +I+  L+  G  ++ QD   GNT LHE+AW G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  V R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L
Sbjct:   14 LLIAAYKGQTENVVQLINKGAKVAVTKHGRTPLHLAANKGHLSVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEILTALIREGCALDRQDKD-GNTALHEAAWHGFSQSAKLLVKAGANVLARNKAGNTALHLACQNSHSQSTRILLLGGSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKKVVKVLLEAGADTTIVNNAGQTPLETARYHNNPEVALLL 259          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd6 (ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI:2154278])

HSP 1 Score: 170.629 bits (431), Expect = 3.918e-44
Identity = 92/249 (36.95%), Postives = 145/249 (58.23%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +I+  L+  G  ++ QD   GNT LHE+AW G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  V R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L
Sbjct:   14 LLIAAYKGQTENVVQLINKGAKVAVTKHGRTPLHLAANKGHLSVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEILTALIREGCALDRQDKD-GNTALHEAAWHGFSQSAKLLVKAGANVLARNKAGNTALHLACQNSHSQSTRILLLGGSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKKVVKVLLEAGADTTIVNNAGQTPLETARYHNNPEVALLL 259          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 129.798 bits (325), Expect = 2.741e-30
Identity = 77/239 (32.22%), Postives = 127/239 (53.14%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G  E++K LL      N+N  D  D   +H AA +G I+++++L+  GA+V  +D     TPLH +A  G    V+YL  +G   N  N    TPLH+A   G +     LI CGA+++ +N  G TPLH      H  +   +L+    D+N ++++G T LH+ A   R   ++ +++SGA ID  +    TPL +A +  H  +I  L T   +T ++ +
Sbjct:  165 VSDRAGRTALHHAAFSGHGEMVKLLLSRGA--NINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGI 400          

HSP 2 Score: 103.99 bits (258), Expect = 2.856e-22
Identity = 75/236 (31.78%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLII-DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQ-TVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            A  + + + VK  +  G  +   DK   +P+H AA +G + ++KYLL      ++N P+ + +TPLH A   GQ  ++  L++ GA VN Q +  G TPLH +A   +    +E L   G   N+ +    TPLH+    G    ++ +I+ GA I  +++ G+TPLH   RYGH  +   LI+   D  +R  +G   LH+AA        + L+ SG  ID  +    T L  A
Sbjct:  210 AAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLG--VDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVN-QKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAA 442          

HSP 3 Score: 101.679 bits (252), Expect = 1.466e-21
Identity = 87/325 (26.77%), Postives = 152/325 (46.77%), Query Frame = 3
Query:  318 NLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV-SFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            +L+ A+   + D+V+  I    ++   D + ++P+H AA  G  EI++ L+       VN  D+   TPLH+A +    + +Q+LL+  A VN +D  +  TPLH +A     +  E L  +    N+ + +  T LH A   GH +  + L+  GA+I+A ++     +H     GH  V ++L+S   ++  +++   T LH AA+     + K L++ G  ++  N    TPL VA       ++  L  C  N NQK    F P     +F+  S H ++  E+  ++ N      ++K     +   P     + G FSR
Sbjct:   41 SLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDK-NWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTP----LHFAAASTHGALCLEL--LVGNGADVNMKSK-----DGKTPLHMTALHGRFSR 351          

HSP 4 Score: 98.2117 bits (243), Expect = 1.822e-20
Identity = 66/241 (27.39%), Postives = 121/241 (50.21%), Query Frame = 3
Query:  375 AGHNLIIDKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVALKKSHSEIIEIL 1067
            +G +++ D D +   SP+H+AA +G  + L+ L+Q+  + +++  ++   TPL  AA  G ++ + +L+ +GA + ++D     TP+H +A  G+S+ +  L       N V+       TPL L+V  GH     +L+  GA++ A++++G T LH G   GH      L+        R+  G T +H++AA     +   L++S  S+D    + +    T L  A    H   +E+L
Sbjct:  567 SGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQS--LLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELL 805          

HSP 5 Score: 84.7297 bits (208), Expect = 2.834e-16
Identity = 70/226 (30.97%), Postives = 106/226 (46.90%), Query Frame = 3
Query:  357 VKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            V E I  G N+   ++ G +P+H AA +    +   LL      +VN       TPLH  A  G+    Q +++ GA ++ +D  +GNTPLH +A  G+   +  L   G            PLHLA   G +   R L+  G DI   + FG T LH     G+     +L++   D N++++ G + LH AAA    +    LV SGAS++  + +  TPL  A
Sbjct:  285 VNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGA-DVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDK-NGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYA 508          

HSP 6 Score: 80.4925 bits (197), Expect = 5.340e-15
Identity = 71/258 (27.52%), Postives = 119/258 (46.12%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRR-KITKLLVESGASIDIRN---------------------IQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            KDGK+P+H+ A +G+    + ++Q+  +  ++  D   +TPLH AA  G   +I  L+  GA    +   HG  PLH +A  G+S     L   G   +  +    T LH A  GG+ +    L+  GAD + +++FG +PLH      +      L+     +N  ++ G T LH AA      K  + L+ + A+  IR+                     I +ETPLDV ++ S ++++      S + N+ T+S
Sbjct:  334 KDGKTPLHMTALHGRFSRSQTIIQSGAV--IDCEDKNGNTPLHIAARYGHELLINTLITSGADT-AKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDML------SDSDNRATIS 582          

HSP 7 Score: 76.2554 bits (186), Expect = 1.232e-13
Identity = 61/179 (34.08%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLP-NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDT 917
            ID +  SP+H A  N      + L+ +     VN  D+   TPLH AA    ++ +Q+LL + AQVN  DST G TPL  +A  G + TVE L         L + S  T LHLA   GH  +   ++    D   I+A N    TPLH   R G   V + L+     +   ++NG T
Sbjct:  814 IDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADST-GKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYT 991          

HSP 8 Score: 73.9442 bits (180), Expect = 5.179e-13
Identity = 64/237 (27.00%), Postives = 109/237 (45.99%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVN--TPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN--TPLHESAWKGYSQTVEYLC--LIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILIS-VSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQN---ETPLDVALKKSHSEIIEIL 1067
            L+ D  G++PIH++A  G + +L  LLQ+    + N    DN   T LH A   G    +++LLE+    ++     GN  +PLH +         E L   L   + N  +    TPLH A    H +  + L+   A +++ +  G TPL      G      +L+S  S D+  ++++ +TALH+A          L++E     ++ N  N   +TPL VA +   + +++ L
Sbjct:  743 LLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQ----DVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQEL 975          

HSP 9 Score: 71.2478 bits (173), Expect = 3.694e-12
Identity = 70/251 (27.89%), Postives = 112/251 (44.62%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAA-SIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLV------------NYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQN-GDTALHIAAALKRRKITKLLV---ESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            DK G+SP+H AA N   + L  L+ +    +VN  D    TPLH AA S      ++ LL   A   I+D   G   +H SA  G+   ++ +     L  L+            N +  +PLHLA   GH+Q    L++   D+  +N  G TPL      GH     +LI+    I  ++     T +H AA     +  +LL+   E   ++DI++   +TPL +++   H++ +  L     N + K
Sbjct:  465 DKFGRSPLHYAAANCNYQCLFALVGSGA--SVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDK-QGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAK 712          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2G4|ANKR6_HUMAN (Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3)

HSP 1 Score: 174.096 bits (440), Expect = 2.974e-44
Identity = 98/284 (34.51%), Postives = 158/284 (55.63%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNE 1172
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +II  L+  G  ++ QD   GNT LHE++W G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  + R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L T +P   + +        RE    + R  S+P +
Sbjct:   14 LLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKD-GNTALHEASWHGFSQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVA-LLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRD 293          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q69ZU8|ANKR6_MOUSE (Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 1.829e-43
Identity = 92/249 (36.95%), Postives = 145/249 (58.23%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+ A      + V + I  G  + + K G++P+H+AA  G L +++ LL+A    +++  D+ D T LH+A  +G  +I+  L+  G  ++ QD   GNT LHE+AW G+SQ+ + L   G      N +  T LHLA Q  H+Q+TR L+  G+    +N  GDT LH   RY H  V R+L++    ++++NQ GDTALH+AAAL  +K+ K+L+E+GA   I N   +TPL+ A   ++ E+  +L
Sbjct:   14 LLIAAYKGQTENVVQLINKGAKVAVTKHGRTPLHLAANKGHLSVVQILLKAG--CDLDVQDDGDQTALHRATVVGNTEILTALIREGCALDRQDKD-GNTALHEAAWHGFSQSAKLLVKAGANVLARNKAGNTALHLACQNSHSQSTRILLLGGSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKKVVKVLLEAGADTTIVNNAGQTPLETARYHNNPEVALLL 259          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54KA7|SECG_DICDI (Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.171e-35
Identity = 96/310 (30.97%), Postives = 161/310 (51.94%), Query Frame = 3
Query:  345 NFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV--------SFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTK 1247
            N    K  I  G  + ++D+ G++P+H AA NG  E+ +YLL   P   ++  D+  ST LH AA  G +D++ +L+   AQ+NI+D   G TPLH++++ G+S   + L   G    +V+    TPLH A   G ++    LIR GA++  ++  G TPLH     GH+   RIL+    ++N  + +  T LH+A+A   R    +L++  A ID +N   +TPL  A+KK+HS++  +L     + +Q ++        +F  EN  E + + ++  S  +E+  +    EQ+      +   EK K
Sbjct:  280 NLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLLYLDPTM-IDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDE-EGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVLIRAGADLDQVSLRSSVDFTKTFGTENHDEIYQIVNKRESSNHEVDELQLALEQQAKEDMEQLAAEKQK 587          

HSP 2 Score: 108.997 bits (271), Expect = 5.613e-23
Identity = 75/231 (32.47%), Postives = 111/231 (48.05%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSP 1082
            I D  G +P+  A+  G LE +K L++   + +VNT D+ + TPLHKA+     + +  LL   A      +T+G TPLH ++  G  Q VE L       N V+    TPLH A   GH+     L++ GA +  ++  G +PLH     G+      L+    +IN  +  G T LH        ++TK L+E GA I++ +   ETPL  A    H E+ E L    P
Sbjct:   97 IKDSAGNTPLQWASSRGHLECIKLLVEKGGV-DVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAV-TTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLLYLDP 325          

HSP 3 Score: 96.6709 bits (239), Expect = 3.834e-19
Identity = 66/210 (31.43%), Postives = 110/210 (52.38%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGA-QVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPL 1022
            D + ++P+H AA  G    + +LL      N N  D+  +TPL  A+S G ++ I++L+E+G   VN +D  +G TPLH+++    ++ V YL      P  V  +  TPLH A  GG+ Q    LI+  + ++A +    TPLH     GH+    +L+     ++ R+ +G + LH AA+       + LV +G +I+  +I+  TPL
Sbjct:   66 DSEKRTPLHHAAFCGSAACVNFLLD--KKANANIKDSAGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNG-TPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPL 272          

HSP 4 Score: 87.0409 bits (214), Expect = 3.120e-16
Identity = 68/226 (30.09%), Postives = 105/226 (46.46%), Query Frame = 3
Query:  417 IHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLP-NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            +H  +  G +E L  LL      + +TPD+   TPLH AA  G    +  LL++ A  NI+DS  GNTPL  ++ +G+ + ++ L   G +  N  +    TPLH A      +    L+   AD  A    G+TPLH     G+     +LI   + +N  + +  T LH A+         LL++ GA +D R+I   +PL  A    + + +E L     N N
Sbjct:   39 VHYYSSTGDIEKLSNLLNN-SATSPDTPDSEKRTPLHHAAFCGSAACVNFLLDKKANANIKDSA-GNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENIN 262          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q505D1|ANR28_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus OX=10090 GN=Ankrd28 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.146e-29
Identity = 77/239 (32.22%), Postives = 127/239 (53.14%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G  E++K LL      N+N  D  D   +H AA +G I+++++L+  GA+V  +D     TPLH +A  G    V+YL  +G   N  N    TPLH+A   G +     LI CGA+++ +N  G TPLH      H  +   +L+    D+N ++++G T LH+ A   R   ++ +++SGA ID  +    TPL +A +  H  +I  L T   +T ++ +
Sbjct:  135 VSDRAGRTALHHAAFSGHGEMVKLLLSRGA--NINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGI 370          

HSP 2 Score: 103.605 bits (257), Expect = 3.042e-21
Identity = 75/236 (31.78%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLII-DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQ-TVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            A  + + + VK  +  G  +   DK   +P+H AA +G + ++KYLL      ++N P+ + +TPLH A   GQ  ++  L++ GA VN Q +  G TPLH +A   +    +E L   G   N+ +    TPLH+    G    ++ +I+ GA I  +++ G+TPLH   RYGH  +   LI+   D  +R  +G   LH+AA        + L+ SG  ID  +    T L  A
Sbjct:  180 AAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLG--VDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVN-QKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAA 412          

HSP 3 Score: 101.293 bits (251), Expect = 1.338e-20
Identity = 87/325 (26.77%), Postives = 152/325 (46.77%), Query Frame = 3
Query:  318 NLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV-SFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            +L+ A+   + D+V+  I    ++   D + ++P+H AA  G  EI++ L+       VN  D+   TPLH+A +    + +Q+LL+  A VN +D  +  TPLH +A     +  E L  +    N+ + +  T LH A   GH +  + L+  GA+I+A ++     +H     GH  V ++L+S   ++  +++   T LH AA+     + K L++ G  ++  N    TPL VA       ++  L  C  N NQK    F P     +F+  S H ++  E+  ++ N      ++K     +   P     + G FSR
Sbjct:   11 SLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDK-NWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTP----LHFAAASTHGALCLEL--LVGNGADVNMKSK-----DGKTPLHMTALHGRFSR 321          

HSP 4 Score: 97.8265 bits (242), Expect = 1.814e-19
Identity = 66/241 (27.39%), Postives = 121/241 (50.21%), Query Frame = 3
Query:  375 AGHNLIIDKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVALKKSHSEIIEIL 1067
            +G +++ D D +   SP+H+AA +G  + L+ L+Q+  + +++  ++   TPL  AA  G ++ + +L+ +GA + ++D     TP+H +A  G+S+ +  L       N V+       TPL L+V  GH     +L+  GA++ A++++G T LH G   GH      L+        R+  G T +H++AA     +   L++S  S+D    + +    T L  A    H   +E+L
Sbjct:  537 SGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQS--LLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELL 775          

HSP 5 Score: 84.3445 bits (207), Expect = 2.640e-15
Identity = 70/226 (30.97%), Postives = 106/226 (46.90%), Query Frame = 3
Query:  357 VKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            V E I  G N+   ++ G +P+H AA +    +   LL      +VN       TPLH  A  G+    Q +++ GA ++ +D  +GNTPLH +A  G+   +  L   G            PLHLA   G +   R L+  G DI   + FG T LH     G+     +L++   D N++++ G + LH AAA    +    LV SGAS++  + +  TPL  A
Sbjct:  255 VNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGA-DVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDK-NGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYA 478          

HSP 6 Score: 80.1073 bits (196), Expect = 4.977e-14
Identity = 71/258 (27.52%), Postives = 119/258 (46.12%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRR-KITKLLVESGASIDIRN---------------------IQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            KDGK+P+H+ A +G+    + ++Q+  +  ++  D   +TPLH AA  G   +I  L+  GA    +   HG  PLH +A  G+S     L   G   +  +    T LH A  GG+ +    L+  GAD + +++FG +PLH      +      L+     +N  ++ G T LH AA      K  + L+ + A+  IR+                     I +ETPLDV ++ S ++++      S + N+ T+S
Sbjct:  304 KDGKTPLHMTALHGRFSRSQTIIQSGAV--IDCEDKNGNTPLHIAARYGHELLINTLITSGADT-AKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDML------SDSDNRATIS 552          

HSP 7 Score: 75.8702 bits (185), Expect = 1.064e-12
Identity = 61/179 (34.08%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLP-NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDT 917
            ID +  SP+H A  N      + L+ +     VN  D+   TPLH AA    ++ +Q+LL + AQVN  DST G TPL  +A  G + TVE L         L + S  T LHLA   GH  +   ++    D   I+A N    TPLH   R G   V + L+     +   ++NG T
Sbjct:  784 IDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADST-GKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYT 961          

HSP 8 Score: 73.559 bits (179), Expect = 4.874e-12
Identity = 64/237 (27.00%), Postives = 109/237 (45.99%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVN--TPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN--TPLHESAWKGYSQTVEYLC--LIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILIS-VSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQN---ETPLDVALKKSHSEIIEIL 1067
            L+ D  G++PIH++A  G + +L  LLQ+    + N    DN   T LH A   G    +++LLE+    ++     GN  +PLH +         E L   L   + N  +    TPLH A    H +  + L+   A +++ +  G TPL      G      +L+S  S D+  ++++ +TALH+A          L++E     ++ N  N   +TPL VA +   + +++ L
Sbjct:  713 LLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQ----DVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQEL 945          

HSP 9 Score: 70.8626 bits (172), Expect = 3.886e-11
Identity = 70/251 (27.89%), Postives = 112/251 (44.62%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAA-SIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLV------------NYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQN-GDTALHIAAALKRRKITKLLV---ESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            DK G+SP+H AA N   + L  L+ +    +VN  D    TPLH AA S      ++ LL   A   I+D   G   +H SA  G+   ++ +     L  L+            N +  +PLHLA   GH+Q    L++   D+  +N  G TPL      GH     +LI+    I  ++     T +H AA     +  +LL+   E   ++DI++   +TPL +++   H++ +  L     N + K
Sbjct:  435 DKFGRSPLHYAAANCNYQCLFALVGSGA--SVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDK-QGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAK 682          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O15084|ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 128.257 bits (321), Expect = 5.452e-29
Identity = 77/239 (32.22%), Postives = 126/239 (52.72%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G  E++K LL      N+N  D  D   +H AA +G I+++++L+  GA+V  +D     TPLH +A  G    V+YL  +G   N  N    TPLH+A   G +     LI CGA ++ +N  G TPLH      H  +   +L+    D+N ++++G T LH+ A   R   ++ +++SGA ID  +    TPL +A +  H  +I  L T   +T ++ +
Sbjct:  135 VSDRAGRTALHHAAFSGHGEMVKLLLSRGA--NINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGI 370          

HSP 2 Score: 103.219 bits (256), Expect = 3.872e-21
Identity = 75/236 (31.78%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLII-DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQ-TVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            A  + + + VK  +  G  +   DK   +P+H AA +G + ++KYLL      ++N P+ + +TPLH A   GQ  ++  L++ GA VN Q +  G TPLH +A   +    +E L   G   N+ +    TPLH+    G    ++ +I+ GA I  +++ G+TPLH   RYGH  +   LI+   D  +R  +G   LH+AA        + L+ SG  ID  +    T L  A
Sbjct:  180 AAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLG--VDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVN-QKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAA 412          

HSP 3 Score: 98.2117 bits (243), Expect = 1.232e-19
Identity = 86/325 (26.46%), Postives = 151/325 (46.46%), Query Frame = 3
Query:  318 NLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV-SFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            +L+ A+   + D+V+  I    ++   D + ++P+H AA  G  EI++ L+       VN  D+   TPLH+A +    + +Q+LL+  A VN +D  +  TPLH +A     +  E L  +    N+ + +  T LH A   GH +  + L+  GA+I+A ++     +H     GH  V ++L+S   ++  +++   T LH AA+     + K L++ G  ++  N    TPL VA       ++  L  C    NQK    F P     +F+  S H ++  E+  ++ N      ++K     +   P     + G FSR
Sbjct:   11 SLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDK-NWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTP----LHFAAASTHGALCLEL--LVGNGADVNMKSK-----DGKTPLHMTALHGRFSR 321          

HSP 4 Score: 97.8265 bits (242), Expect = 1.752e-19
Identity = 67/241 (27.80%), Postives = 121/241 (50.21%), Query Frame = 3
Query:  375 AGHNLIIDKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVALKKSHSEIIEIL 1067
            +G +++ D D +   SP+H+AA +G  + L+ L+Q+  + +++  ++   TPL  AA  G ++ + +L+ +GA + ++D     TP+H +A  G+S+ +  L       N V+       TPL L+V  GH     +L+  GA++ A++++G T LH G   GH      L+        R+  G T +H++AA     +   L++S AS+D      +    T L  A    H   +E+L
Sbjct:  537 SGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQS--LLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELL 775          

HSP 5 Score: 82.4185 bits (202), Expect = 9.956e-15
Identity = 65/209 (31.10%), Postives = 98/209 (46.89%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            G +P+H AA +    +   LL      +VN       TPLH  A  G+    Q +++ GA ++ +D  +GNTPLH +A  G+   +  L   G            PLHLA   G +   R L+  G DI   + FG T LH     G+     +L++   D N++++ G + LH AAA    +    LV SGAS++  + +  TPL  A
Sbjct:  272 GFTPLHFAAASTHGALCLELLVGNGA-DVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDK-NGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYA 478          

HSP 6 Score: 80.1073 bits (196), Expect = 5.020e-14
Identity = 71/258 (27.52%), Postives = 119/258 (46.12%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRR-KITKLLVESGASIDIRN---------------------IQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            KDGK+P+H+ A +G+    + ++Q+  +  ++  D   +TPLH AA  G   +I  L+  GA    +   HG  PLH +A  G+S     L   G   +  +    T LH A  GG+ +    L+  GAD + +++FG +PLH      +      L+     +N  ++ G T LH AA      K  + L+ + A+  IR+                     I +ETPLDV ++ S ++++      S + N+ T+S
Sbjct:  304 KDGKTPLHMTALHGRFSRSQTIIQSGAV--IDCEDKNGNTPLHIAARYGHELLINTLITSGADT-AKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDML------SDSDNRATIS 552          

HSP 7 Score: 75.485 bits (184), Expect = 1.387e-12
Identity = 65/237 (27.43%), Postives = 110/237 (46.41%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVN--TPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN--TPLHESAWKGYSQTVEYL--CLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI-SVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQN---ETPLDVALKKSHSEIIEIL 1067
            L+ D  G++PIH++A  G + +L  LLQ+    + N  T DN   T LH A   G    +++LLE+     +   T GN  +PLH +         E L   L   + N  +    TPLH A    H +  + L+   A +++ +  G TPL      G      +L+ S S ++  ++ + +TALH+A +        L++E     ++ N  N   +TPL VA +   + +++ L
Sbjct:  713 LLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQ----EVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQEL 945          

HSP 8 Score: 71.633 bits (174), Expect = 2.013e-11
Identity = 59/173 (34.10%), Postives = 79/173 (45.66%), Query Frame = 3
Query:  411 SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLP-NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDT 917
            SP+H A  N      + L+       VN  D+   TPLH AA    ++ +Q+LL   AQVN  DST G TPL  +A  G + TVE L         L + S  T LHLA   GH  +   ++    D   I+A N    TPLH   R G   V + L+     +   ++NG T
Sbjct:  790 SPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDST-GKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYT 961          

HSP 9 Score: 70.8626 bits (172), Expect = 3.788e-11
Identity = 70/251 (27.89%), Postives = 112/251 (44.62%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAA-SIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLV------------NYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQN-GDTALHIAAALKRRKITKLLV---ESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            DK G+SP+H AA N   + L  L+ +    +VN  D    TPLH AA S      ++ LL   A   I+D   G   +H SA  G+   ++ +     L  L+            N +  +PLHLA   GH+Q    L++   D+  +N  G TPL      GH     +LI+    I  ++     T +H AA     +  +LL+   E   ++DI++   +TPL +++   H++ +  L     N + K
Sbjct:  435 DKFGRSPLHYAAANCNYQCLFALVGSGA--SVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDK-QGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAK 682          

HSP 10 Score: 66.2402 bits (160), Expect = 9.471e-10
Identity = 49/148 (33.11%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERG-AQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGR-----LPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTP 821
            D  G++P+H AA    +E L+ LL       VN+ D+   TPL  AA  GQ + ++ML+    A++ +QD++  NT LH +  KG+  +   L ++ +     L N  N +L TPLH+A + G     + L+  GA + A +  G TP
Sbjct:  820 DSKGRTPLHAAAFTDHVECLQLLLSHNA--QVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSK-NTALHLACSKGHETSA--LLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTP 962          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: F2WMR2 (Diversin (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 4.310e-88
Identity = 150/191 (78.53%), Postives = 155/191 (81.15%), Query Frame = 3
Query:  717 TPLHLAVQGGHNQTTRNLIRCGADISAQNR-FGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            TPLH A   G     + L+  GA ++ Q+  FGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPE                    SVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR
Sbjct:    4 TPLHKAASIGQIDIIQMLLERGAQVNIQDSTFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPE--------------------SVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 174          

HSP 2 Score: 115.161 bits (287), Expect = 1.444e-25
Identity = 62/131 (47.33%), Postives = 80/131 (61.07%), Query Frame = 3
Query:  507 FDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQR 899
            FDSTPLHKAASIGQIDIIQMLLERGAQVNIQDST G+TPLH     G++     L  +    N  N +  T LH+A      + T+ L+  GA I  +N   +TPL   ++  H+ +  IL + S + NQ+
Sbjct:    1 FDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 131          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3HDS3 (trithorax group protein osa isoform X4 OS=Lingula unguis OX=7574 GN=LOC106153724 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.429e-65
Identity = 120/246 (48.78%), Postives = 167/246 (67.89%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A S    + V+E ++ G +L  D+DG++ +H+AA+NGQ E+ K L+ A    ++N  D+   TPLH+AA+ G ++++ +LLE G   + Q+  HGNT LHE+AW G+S T++ L   G      N + F PLHLA Q GHNQ+TR L+  G     +N +GDT LHT  RYGHAGV+RI +S   + N++N+NGDTALHIAAAL+RRKI KLLVE+G +  I+N QNETP+DVA +K H EII I+
Sbjct:   21 AASRGELETVQELLQLGASLEPDRDGRTVLHLAAQNGQAEVTKVLINAG--CDINAVDSLGGTPLHRAAAQGHVEVVTLLLEEGCAYDRQEDVHGNTALHEAAWNGFSDTIKALIKGGANIFATNKAGFGPLHLAAQNGHNQSTRELLYSGCSADDKNNYGDTCLHTAARYGHAGVTRIALSAKCNANEQNKNGDTALHIAAALRRRKIAKLLVEAGVNSTIKNKQNETPIDVARRKEHPEIIVII 264          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3HDR8 (trithorax group protein osa isoform X3 OS=Lingula unguis OX=7574 GN=LOC106153724 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.665e-65
Identity = 120/246 (48.78%), Postives = 167/246 (67.89%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A S    + V+E ++ G +L  D+DG++ +H+AA+NGQ E+ K L+ A    ++N  D+   TPLH+AA+ G ++++ +LLE G   + Q+  HGNT LHE+AW G+S T++ L   G      N + F PLHLA Q GHNQ+TR L+  G     +N +GDT LHT  RYGHAGV+RI +S   + N++N+NGDTALHIAAAL+RRKI KLLVE+G +  I+N QNETP+DVA +K H EII I+
Sbjct:   32 AASRGELETVQELLQLGASLEPDRDGRTVLHLAAQNGQAEVTKVLINAG--CDINAVDSLGGTPLHRAAAQGHVEVVTLLLEEGCAYDRQEDVHGNTALHEAAWNGFSDTIKALIKGGANIFATNKAGFGPLHLAAQNGHNQSTRELLYSGCSADDKNNYGDTCLHTAARYGHAGVTRIALSAKCNANEQNKNGDTALHIAAALRRRKIAKLLVEAGVNSTIKNKQNETPIDVARRKEHPEIIVII 275          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3HB53 (trithorax group protein osa isoform X2 OS=Lingula unguis OX=7574 GN=LOC106153724 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.705e-65
Identity = 120/246 (48.78%), Postives = 167/246 (67.89%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A S    + V+E ++ G +L  D+DG++ +H+AA+NGQ E+ K L+ A    ++N  D+   TPLH+AA+ G ++++ +LLE G   + Q+  HGNT LHE+AW G+S T++ L   G      N + F PLHLA Q GHNQ+TR L+  G     +N +GDT LHT  RYGHAGV+RI +S   + N++N+NGDTALHIAAAL+RRKI KLLVE+G +  I+N QNETP+DVA +K H EII I+
Sbjct:   36 AASRGELETVQELLQLGASLEPDRDGRTVLHLAAQNGQAEVTKVLINAG--CDINAVDSLGGTPLHRAAAQGHVEVVTLLLEEGCAYDRQEDVHGNTALHEAAWNGFSDTIKALIKGGANIFATNKAGFGPLHLAAQNGHNQSTRELLYSGCSADDKNNYGDTCLHTAARYGHAGVTRIALSAKCNANEQNKNGDTALHIAAALRRRKIAKLLVEAGVNSTIKNKQNETPIDVARRKEHPEIIVII 279          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3HB21 (trithorax group protein osa isoform X1 OS=Lingula unguis OX=7574 GN=LOC106153724 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.766e-65
Identity = 120/246 (48.78%), Postives = 167/246 (67.89%), Query Frame = 3
Query:  330 AVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A S    + V+E ++ G +L  D+DG++ +H+AA+NGQ E+ K L+ A    ++N  D+   TPLH+AA+ G ++++ +LLE G   + Q+  HGNT LHE+AW G+S T++ L   G      N + F PLHLA Q GHNQ+TR L+  G     +N +GDT LHT  RYGHAGV+RI +S   + N++N+NGDTALHIAAAL+RRKI KLLVE+G +  I+N QNETP+DVA +K H EII I+
Sbjct:   81 AASRGELETVQELLQLGASLEPDRDGRTVLHLAAQNGQAEVTKVLINAG--CDINAVDSLGGTPLHRAAAQGHVEVVTLLLEEGCAYDRQEDVHGNTALHEAAWNGFSDTIKALIKGGANIFATNKAGFGPLHLAAQNGHNQSTRELLYSGCSADDKNNYGDTCLHTAARYGHAGVTRIALSAKCNANEQNKNGDTALHIAAALRRRKIAKLLVEAGVNSTIKNKQNETPIDVARRKEHPEIIVII 324          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd6b (ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE-030916-4])

HSP 1 Score: 182.185 bits (461), Expect = 4.939e-48
Identity = 107/293 (36.52%), Postives = 163/293 (55.63%), Query Frame = 3
Query:  300 IHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIP-NEM 1175
            + T    L+ A      D V + I  G  + + K G++P+H+AA  G LE+++ LL+A    +++  D+ + T LH+AA +G  D+I  L++ G  ++ QD   GNT LHE AW G+SQ+V+ L   G   +  N +  T LHLA Q GH Q+ + L+  GA   ++N  GDT LH   RY H  V RIL+ V   +++RNQ GDTALH+AA L  +K  +LL+E+G    IRN   +T LD A + ++ E+  +L T +P     +        R+    + R  S+P +EM
Sbjct:    9 VRTLSERLLVASHKGQADHVVQLINKGAKVAVTKYGRTPLHLAAYKGHLEVVRILLKAG--CDLDIEDDGEQTALHRAAVVGNSDVISALIQEGCALDRQDKD-GNTSLHEVAWHGFSQSVKLLVKAGVNLHAKNKAGNTALHLACQNGHTQSCKVLLLGGARPDSKNNVGDTCLHVAARYNHVCVIRILLGVFCSVSERNQAGDTALHVAAVLNHKKTARLLLEAGTDSTIRNNVGQTALDQAREHNNPEVA-LLLTKAPQIQSFSRGRSVRKRRDKLKAEGRAQSVPRDEM 297          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd6a (ankyrin repeat domain 6a [Source:ZFIN;Acc:ZDB-GENE-120525-1])

HSP 1 Score: 149.443 bits (376), Expect = 7.537e-37
Identity = 84/219 (38.36%), Postives = 122/219 (55.71%), Query Frame = 3
Query:  516 TPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNE 1172
            T LH+AA +G  ++I  L++ G  +++QD   GNT LHE AW G+SQ+V+ L   G   ++ N +  TPLHLA Q GH Q+ R L+  G+    +N+ GDT LH   RY H  V +IL+     + ++NQ GDTALH+AAAL  +K   LL+E+GA   I+N    T LD A   ++ E + +L   S    + T        R+    Q R  S+P +
Sbjct:   81 TALHRAAVVGNREVISALVQGGCALDLQDKQEGNTALHEVAWHGFSQSVKVLVKAGANLHIQNKAGSTPLHLACQNGHAQSARVLLLGGSVPDIKNKAGDTCLHIAARYNHVVVVKILLGAFCSVAEKNQVGDTALHVAAALNHKKTVSLLLEAGADCSIKNNAGRTALDKARDNNNRE-VSLLLARSNQVQRFTRGRTVRKRRDVLRAQRRAQSVPRD 298          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 124.79 bits (312), Expect = 1.083e-28
Identity = 87/253 (34.39%), Postives = 131/253 (51.78%), Query Frame = 3
Query:  354 KVKEFI-RAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            KV E + + G +L  + + G +PIH+AA  G   I+K L    A P    NT +    T LH AA  GQ D+++ LL+ GA+V+I+ +    T LH ++  G ++ V+ L   G   +    S +TPLHLAV+ GH +T   L+  GA +SA  + G TPLH   +YG    +++L+      +   + G T LH+AA    +++  LL++ GAS         TPL +A KK+  EI   L      TN  T
Sbjct:  368 KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASP----NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIK-AKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVT 615          

HSP 2 Score: 117.087 bits (292), Expect = 3.032e-26
Identity = 71/229 (31.00%), Postives = 122/229 (53.28%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            G++ +H+AA  GQ ++++YLLQ     ++   D  D T LH A+ +G+ +I+Q+LL++GA  +   +T G TPLH +  +G+ +T   L   G   +      FTPLH+A + G  +  + L++  A      + G TPLH    Y +  V+ +L+      +   +NG T LHIAA   + +I   L+E GA  +    Q  +PL +A ++   +++ +L T + N N
Sbjct:  420 GETALHMAARAGQADVVRYLLQNGAKVDIKAKD--DQTALHIASRLGKAEIVQLLLQKGAWASAA-TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVN 645          

HSP 3 Score: 110.538 bits (275), Expect = 3.102e-24
Identity = 77/262 (29.39%), Postives = 127/262 (48.47%), Query Frame = 3
Query:  324 IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQ-AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            IDA + +    +    R+GH  +++             K+G SP+H+A +   L  ++ LLQ   P+ +V    N   T LH AA  G   + ++++++ A  N + + +G TPLH +  K   + +E L   G     V  S  TP+H+A   GH    + L   GA  +  N  G+T LH   R G A V R L+     ++ + ++  TALHIA+ L + +I +LL++ GA          TPL +A+++ H E   +L
Sbjct:  248 IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVT---NDYLTALHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLL 505          

HSP 4 Score: 104.76 bits (260), Expect = 1.828e-22
Identity = 75/237 (31.65%), Postives = 117/237 (49.37%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            K G +P+H+AA+ GQ+E  K LLQ  A P    +T      TPLH AA      +  +LL+ GA  +   + +G TPLH +A K   +    L   G   N V     +PLHLA Q G       L+   A+++  N+ G TPLH   +    GV+ +L++   +++   + G T LH+A      K+   L+E+ A I+ +     TPL  A ++ H+ II +L     + N+ T+
Sbjct:  517 KKGFTPLHVAAKYGQIEAAKLLLQKRAAP----DTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAA-AKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTL 748          

HSP 5 Score: 104.76 bits (260), Expect = 1.908e-22
Identity = 76/232 (32.76%), Postives = 117/232 (50.43%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGD--TPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILK--TCSPNT 1088
            G +P+HIAA  G + +   LL      +    +  D TPLH AA  G  +++++LL+RGA+++ + +  G TPLH  A  G+ Q VE L   G        +  +PLH+A QG H    + L++   D+   +   D  T LH     GH  V+++++    + N +  NG T LHIA    R K+ +LL++ GAS+        TP+ VA    H  I++ L     SPNT
Sbjct:  189 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARN--DITPLHVAAKRGNGNMVKLLLDRGAKIDAK-TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ--HDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNT 415          

HSP 6 Score: 93.9745 bits (232), Expect = 4.295e-19
Identity = 77/309 (24.92%), Postives = 131/309 (42.39%), Query Frame = 3
Query:  351 DKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQ-----------------------------VNIQDSTH-------GNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNG---------------------------------DTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            D V+E +  G N+    ++G +P+++AA+   LE++++LL+     ++ T D F  TPL  A   G   ++ +LLE   +                              +++   H       G TPLH +A  G       L   G   + +  +  TPLH+A + G+    + L+  GA I A+ + G TPLH G R GH  V  +L+     I  + +NG                                  TALH+AA     K+ K++V+  A+ + + +   TPL +A KK+  +++E+L
Sbjct:   67 DVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGF--TPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 373          

HSP 7 Score: 81.2629 bits (199), Expect = 3.355e-15
Identity = 42/125 (33.60%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  693 NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            N+ N +    LHLA + GH +    L++ GA + A  + G+T LH     G   V R L++   ++N ++QNG T L++AA     ++ + L+E GAS  I      TPL VAL++ H +++ +L
Sbjct:   14 NICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLL 138          

HSP 8 Score: 71.2478 bits (173), Expect = 4.279e-12
Identity = 51/159 (32.08%), Postives = 77/159 (48.43%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRIL 869
            + + G SP+H+AA+ G ++++  LL      NVN  +    TPLH AA   ++ + ++LL  GA+V+    T G TPLH +   G  + V +L       N    S +TPLH A Q GH      L++  A  +     G+T L    R G+  V   L
Sbjct:  614 VTRQGISPLHLAAQEGSVDLVSLLLTK--NANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKT-GYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 769          

HSP 9 Score: 56.6102 bits (135), Expect = 1.055e-7
Identity = 29/101 (28.71%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  765 NLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + ++ G DI+  N+ G   LH   + GH  V   L+ +   ++   + G+TALHIA+   +  + + LV +GA+++ ++    TPL +A +++H E++  L
Sbjct:    5 DYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFL 105          

HSP 10 Score: 55.4546 bits (132), Expect = 2.964e-7
Identity = 38/143 (26.57%), Postives = 68/143 (47.55%), Query Frame = 3
Query:  570 LERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIR 998
            L+ G  +NI +  +G   LH ++ +G+ + V  L  +G   +       T LH+A   G     R L+  GA+++AQ++ G TPL+   +  H  V R L+      +   ++G T L +A      ++  LL+E+     +R
Sbjct:    7 LKTGVDINICNQ-NGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR 148          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 124.02 bits (310), Expect = 1.955e-28
Identity = 87/253 (34.39%), Postives = 131/253 (51.78%), Query Frame = 3
Query:  354 KVKEFI-RAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            KV E + + G +L  + + G +PIH+AA  G   I+K L    A P    NT +    T LH AA  GQ D+++ LL+ GA+V+I+ +    T LH ++  G ++ V+ L   G   +    S +TPLHLAV+ GH +T   L+  GA +SA  + G TPLH   +YG    +++L+      +   + G T LH+AA    +++  LL++ GAS         TPL +A KK+  EI   L      TN  T
Sbjct:  416 KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASP----NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIK-AKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVT 663          

HSP 2 Score: 115.931 bits (289), Expect = 5.349e-26
Identity = 71/229 (31.00%), Postives = 122/229 (53.28%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            G++ +H+AA  GQ ++++YLLQ     ++   D  D T LH A+ +G+ +I+Q+LL++GA  +   +T G TPLH +  +G+ +T   L   G   +      FTPLH+A + G  +  + L++  A      + G TPLH    Y +  V+ +L+      +   +NG T LHIAA   + +I   L+E GA  +    Q  +PL +A ++   +++ +L T + N N
Sbjct:  468 GETALHMAARAGQADVVRYLLQNGAKVDIKAKD--DQTALHIASRLGKAEIVQLLLQKGAWASAA-TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVN 693          

HSP 3 Score: 108.612 bits (270), Expect = 1.188e-23
Identity = 77/262 (29.39%), Postives = 127/262 (48.47%), Query Frame = 3
Query:  324 IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQ-AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            IDA + +    +    R+GH  +++             K+G SP+H+A +   L  ++ LLQ   P+ +V    N   T LH AA  G   + ++++++ A  N + + +G TPLH +  K   + +E L   G     V  S  TP+H+A   GH    + L   GA  +  N  G+T LH   R G A V R L+     ++ + ++  TALHIA+ L + +I +LL++ GA          TPL +A+++ H E   +L
Sbjct:  296 IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVT---NDYLTALHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLL 553          

HSP 4 Score: 106.301 bits (264), Expect = 4.897e-23
Identity = 79/241 (32.78%), Postives = 122/241 (50.62%), Query Frame = 3
Query:  381 HNLIID-KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGD--TPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILK--TCSPNT 1088
            HN  ++ K G +P+HIAA  G + +   LL      +    +  D TPLH AA  G  +++++LL+RGA+++ + +  G TPLH  A  G+ Q VE L   G        +  +PLH+A QG H    + L++   D+   +   D  T LH     GH  V+++++    + N +  NG T LHIA    R K+ +LL++ GAS+        TP+ VA    H  I++ L     SPNT
Sbjct:  228 HNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARN--DITPLHVAAKRGNGNMVKLLLDRGAKIDAK-TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ--HDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNT 463          

HSP 5 Score: 104.375 bits (259), Expect = 1.916e-22
Identity = 75/237 (31.65%), Postives = 117/237 (49.37%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            K G +P+H+AA+ GQ+E  K LLQ  A P    +T      TPLH AA      +  +LL+ GA  +   + +G TPLH +A K   +    L   G   N V     +PLHLA Q G       L+   A+++  N+ G TPLH   +    GV+ +L++   +++   + G T LH+A      K+   L+E+ A I+ +     TPL  A ++ H+ II +L     + N+ T+
Sbjct:  565 KKGFTPLHVAAKYGQIEAAKLLLQKRAAP----DTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAA-AKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTL 796          

HSP 6 Score: 96.2857 bits (238), Expect = 7.314e-20
Identity = 79/301 (26.25%), Postives = 133/301 (44.19%), Query Frame = 3
Query:  351 DKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLE---------------------RGAQVNIQ-------DSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNG---------------------------------DTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            D V+E +  G N+    ++G +P+++AA+   LE++++LL+     ++ T D F  TPL  A   G   ++ +LLE                     + A + +Q       +S  G TPLH +A  G       L   G   + +  +  TPLH+A + G+    + L+  GA I A+ + G TPLH G R GH  V  +L+     I  + +NG                                  TALH+AA     K+ K++V+  A+ + + +   TPL +A KK+  +++E+L
Sbjct:  123 DVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGF--TPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 421          

HSP 7 Score: 80.1073 bits (196), Expect = 5.936e-15
Identity = 42/125 (33.60%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  693 NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            N+ N +    LHLA + GH +    L++ GA + A  + G+T LH     G   V R L++   ++N ++QNG T L++AA     ++ + L+E GAS  I      TPL VAL++ H +++ +L
Sbjct:   70 NICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLL 194          

HSP 8 Score: 70.4774 bits (171), Expect = 6.451e-12
Identity = 51/159 (32.08%), Postives = 77/159 (48.43%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRIL 869
            + + G SP+H+AA+ G ++++  LL      NVN  +    TPLH AA   ++ + ++LL  GA+V+    T G TPLH +   G  + V +L       N    S +TPLH A Q GH      L++  A  +     G+T L    R G+  V   L
Sbjct:  662 VTRQGISPLHLAAQEGSVDLVSLLLTKNA--NVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKT-GYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 9 Score: 58.9214 bits (141), Expect = 2.074e-8
Identity = 31/112 (27.68%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  732 AVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A + G+ +   + ++ G DI+  N+ G   LH   + GH  V   L+ +   ++   + G+TALHIA+   +  + + LV +GA+++ ++    TPL +A +++H E++  L
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFL 161          

HSP 10 Score: 57.3806 bits (137), Expect = 6.583e-8
Identity = 41/157 (26.11%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  528 KAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIR 998
            +AA  G ++     L+ G  +NI +  +G   LH ++ +G+ + V  L  +G   +       T LH+A   G     R L+  GA+++AQ++ G TPL+   +  H  V R L+      +   ++G T L +A      ++  LL+E+     +R
Sbjct:   49 RAARAGNLEKALDYLKTGVDINICNQ-NGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR 204          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 123.635 bits (309), Expect = 2.082e-28
Identity = 87/253 (34.39%), Postives = 131/253 (51.78%), Query Frame = 3
Query:  354 KVKEFI-RAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            KV E + + G +L  + + G +PIH+AA  G   I+K L    A P    NT +    T LH AA  GQ D+++ LL+ GA+V+I+ +    T LH ++  G ++ V+ L   G   +    S +TPLHLAV+ GH +T   L+  GA +SA  + G TPLH   +YG    +++L+      +   + G T LH+AA    +++  LL++ GAS         TPL +A KK+  EI   L      TN  T
Sbjct:  388 KVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASP----NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIK-AKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVT 635          

HSP 2 Score: 115.931 bits (289), Expect = 6.143e-26
Identity = 71/229 (31.00%), Postives = 122/229 (53.28%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            G++ +H+AA  GQ ++++YLLQ     ++   D  D T LH A+ +G+ +I+Q+LL++GA  +   +T G TPLH +  +G+ +T   L   G   +      FTPLH+A + G  +  + L++  A      + G TPLH    Y +  V+ +L+      +   +NG T LHIAA   + +I   L+E GA  +    Q  +PL +A ++   +++ +L T + N N
Sbjct:  440 GETALHMAARAGQADVVRYLLQNGAKVDIKAKD--DQTALHIASRLGKAEIVQLLLQKGAWASAA-TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVN 665          

HSP 3 Score: 108.997 bits (271), Expect = 8.126e-24
Identity = 77/262 (29.39%), Postives = 127/262 (48.47%), Query Frame = 3
Query:  324 IDAVSINNFDKVKEFIRAGHNLIID-------------KDGKSPIHIAAENGQLEILKYLLQ-AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            IDA + +    +    R+GH  +++             K+G SP+H+A +   L  ++ LLQ   P+ +V    N   T LH AA  G   + ++++++ A  N + + +G TPLH +  K   + +E L   G     V  S  TP+H+A   GH    + L   GA  +  N  G+T LH   R G A V R L+     ++ + ++  TALHIA+ L + +I +LL++ GA          TPL +A+++ H E   +L
Sbjct:  268 IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVT---NDYLTALHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLL 525          

HSP 4 Score: 104.76 bits (260), Expect = 1.769e-22
Identity = 75/237 (31.65%), Postives = 117/237 (49.37%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQ--AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            K G +P+H+AA+ GQ+E  K LLQ  A P    +T      TPLH AA      +  +LL+ GA  +   + +G TPLH +A K   +    L   G   N V     +PLHLA Q G       L+   A+++  N+ G TPLH   +    GV+ +L++   +++   + G T LH+A      K+   L+E+ A I+ +     TPL  A ++ H+ II +L     + N+ T+
Sbjct:  537 KKGFTPLHVAAKYGQIEAAKLLLQKRAAP----DTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAA-AKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTL 768          

HSP 5 Score: 104.76 bits (260), Expect = 1.815e-22
Identity = 76/232 (32.76%), Postives = 117/232 (50.43%), Query Frame = 3
Query:  405 GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGD--TPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILK--TCSPNT 1088
            G +P+HIAA  G + +   LL      +    +  D TPLH AA  G  +++++LL+RGA+++ + +  G TPLH  A  G+ Q VE L   G        +  +PLH+A QG H    + L++   D+   +   D  T LH     GH  V+++++    + N +  NG T LHIA    R K+ +LL++ GAS+        TP+ VA    H  I++ L     SPNT
Sbjct:  209 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARN--DITPLHVAAKRGNGNMVKLLLDRGAKIDAK-TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ--HDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNT 435          

HSP 6 Score: 92.8189 bits (229), Expect = 9.216e-19
Identity = 80/309 (25.89%), Postives = 134/309 (43.37%), Query Frame = 3
Query:  351 DKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLE---------------------RGAQVNIQDS--------------TH-GNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNG---------------------------------DTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            D V+E +  G N+    ++G +P+++AA+   LE++++LL+     ++ T D F  TPL  A   G   ++ +LLE                     + A + +Q+               TH G TPLH +A  G       L   G   + +  +  TPLH+A + G+    + L+  GA I A+ + G TPLH G R GH  V  +L+     I  + +NG                                  TALH+AA     K+ K++V+  A+ + + +   TPL +A KK+  +++E+L
Sbjct:   87 DVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGF--TPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 393          

HSP 7 Score: 80.1073 bits (196), Expect = 6.297e-15
Identity = 42/125 (33.60%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  693 NLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            N+ N +    LHLA + GH +    L++ GA + A  + G+T LH     G   V R L++   ++N ++QNG T L++AA     ++ + L+E GAS  I      TPL VAL++ H +++ +L
Sbjct:   34 NICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLL 158          

HSP 8 Score: 70.4774 bits (171), Expect = 5.956e-12
Identity = 51/159 (32.08%), Postives = 77/159 (48.43%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRIL 869
            + + G SP+H+AA+ G ++++  LL      NVN  +    TPLH AA   ++ + ++LL  GA+V+    T G TPLH +   G  + V +L       N    S +TPLH A Q GH      L++  A  +     G+T L    R G+  V   L
Sbjct:  634 VTRQGISPLHLAAQEGSVDLVSLLLTK--NANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKT-GYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          

HSP 9 Score: 58.9214 bits (141), Expect = 2.244e-8
Identity = 31/112 (27.68%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  732 AVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A + G+ +   + ++ G DI+  N+ G   LH   + GH  V   L+ +   ++   + G+TALHIA+   +  + + LV +GA+++ ++    TPL +A +++H E++  L
Sbjct:   14 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFL 125          

HSP 10 Score: 57.3806 bits (137), Expect = 6.823e-8
Identity = 41/157 (26.11%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  528 KAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIR 998
            +AA  G ++     L+ G  +NI +  +G   LH ++ +G+ + V  L  +G   +       T LH+A   G     R L+  GA+++AQ++ G TPL+   +  H  V R L+      +   ++G T L +A      ++  LL+E+     +R
Sbjct:   13 RAARAGNLEKALDYLKTGVDINICNQ-NGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR 168          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ankrd6b (ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE-030916-4])

HSP 1 Score: 154.451 bits (389), Expect = 2.535e-39
Identity = 98/285 (34.39%), Postives = 151/285 (52.98%), Query Frame = 3
Query:  312 VSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIP 1166
               L+ A        V E I  G    I+K G+SP+H+AA  G  E+++ L  A    N++  D+   T LH+A   G   ++ +LL+ G  ++ QD T+  T  H+ + +GY   V  +C+   +  L N +  TPLHLA Q GH+Q+ R L+  G+   A+N  GDT  H   RY H  V RILIS    ++++N+ GDTALH+ A L  RK+T+LL+ +GA+   +N    TPLDVA +  ++++  +L   +P+             RE  + Q R  S+P
Sbjct:   11 AEKLLVAAHRGRVGDVVELINRGAPSAINKHGRSPLHLAASRGHAEVVRLLASAG--CNLDLQDDGGQTALHRAVEAGSTAVLSVLLDEGCSLDRQD-TNCLTLAHDCSTRGYKVPV-CVCVQSSINILFNKAGSTPLHLACQNGHSQSCRGLLLGGSRPDAKNHMGDTCTHIAARYNHVTVVRILISAFCSVDEKNELGDTALHVTAQLNHRKVTRLLLAAGANPTPKNNAELTPLDVAREHDNADVALLLSR-APHAASVVPRRRSGKEREPPAQQRRSRSVP 290          

HSP 2 Score: 70.4774 bits (171), Expect = 9.451e-13
Identity = 59/243 (24.28%), Postives = 113/243 (46.50%), Query Frame = 3
Query:  372 RAGHNLIIDKDGKSPIHIAAENGQL-EILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            R G +L+ +K     + +AA  G++ ++++ + +  P    +  +    +PLH AAS G  +++++L   G  +++QD   G T LH +   G +  +  L   G   +  + +  T  H     G+       ++   +I   N+ G TPLH   + GH+   R L+   +  + +N  GDT  HIAA      + ++L+ +  S+D +N   +T L V  + +H ++  +L     N   K
Sbjct:    4 RDGVDLLAEK-----LLVAAHRGRVGDVVELINRGAP----SAINKHGRSPLHLAASRGHAEVVRLLASAGCNLDLQDDG-GQTALHRAVEAGSTAVLSVLLDEGCSLDRQDTNCLTLAHDCSTRGYKVPVCVCVQSSINILF-NKAGSTPLHLACQNGHSQSCRGLLLGGSRPDAKNHMGDTCTHIAARYNHVTVVRILISAFCSVDEKNELGDTALHVTAQLNHRKVTRLLLAAGANPTPK 235          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 6.914e-29
Identity = 78/234 (33.33%), Postives = 124/234 (52.99%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            + G +PIH+A+  G L +++ LLQ     + N  +    TPLH A+  GQ+++++ LL+ GA+V ++ +    TPLH ++  G ++ V+ L   G  PN    S  TPL+ A + GH      L+  GADIS   + G TPLH   +YG   V+ +L+      + + +NG T LH+A     +K+  LL++ GAS         TPL +A KK+  E+ ++L      TN  T
Sbjct:  408 ESGLTPIHVASFMGHLNVVQLLLQNGA--SSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVK-AREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLT 638          

HSP 2 Score: 120.553 bits (301), Expect = 2.362e-28
Identity = 85/292 (29.11%), Postives = 157/292 (53.77%), Query Frame = 3
Query:  201 RLLLGFTRPYAVPNTPSR--KIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R L GFT P  +    +R   ++ L K+  ++ T+  + ++ +  A  + + + V+  ++ G +    +  G++P+H+A+  GQLE++K LLQ+     V   +  D TPLH A+ +G+ +I+Q+LL+RG+  N   ++ G+TPL+ ++ +G+      L   G   + V    FTPLH+A + G  +    L+   A    + + G TPLH    Y H  V+ +L+      +   +NG T LHIAA   + ++ K+L+E GA  ++   Q   PL +A ++ H++++ +L
Sbjct:  373 RALNGFT-PLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKARE--DQTPLHIASRLGKAEIVQLLLQRGSDPNAPTAS-GSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALL 660          

HSP 3 Score: 108.227 bits (269), Expect = 2.152e-24
Identity = 78/268 (29.10%), Postives = 125/268 (46.64%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLER-------------------------------GAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            ++G +P+H+AA+ G   ++K LL      +  T D    TPLH AA  G   +I+MLLER                               G Q  + D T    TPLH +A  G+ +  + L   G  PN    + FTPLH+A +    +    L++ GA I      G TP+H     GH  V ++L+      N  N  G+T LH+A+   + ++ K L++SGA + ++  +++TPL +A +   +EI+++L     + N  T S
Sbjct:  243 RNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGL--TPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTAS 508          

HSP 4 Score: 91.6633 bits (226), Expect = 2.656e-19
Identity = 80/307 (26.06%), Postives = 127/307 (41.37%), Query Frame = 3
Query:  258 IQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNI------------------------------------QDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            +  L K    + T+     + L  A      D V+  +  G N+    ++G +P+++AA+   LEI+K+LL      +V T D F  TPL  A   G   ++ +LLE   +  +                                    Q +  G TPLH +A  G       L  +G   +    +  TPLH+A + G+N   + L+  GA I  + R G TPLH   R GH  V  +L+     I  + +NG + LH+A   +     +LL+   A +D   +   TPL VA    H  + ++L
Sbjct:   59 VTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGF--TPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLL 363          

HSP 5 Score: 89.7373 bits (221), Expect = 1.118e-18
Identity = 66/233 (28.33%), Postives = 110/233 (47.21%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL--KTCSPN 1085
            + K G +P+HIA++ G+LE+   LL+ +   +    +    TPLH A       +  +LL++GA  +   + +G TPLH +A K   +  + L  +G   N++      PLHLA Q GH      L+   A IS   + G T +H   +     V+ IL     D+N   +   T LH+A+     K+   L+ + A ++ +     TPL  A ++ H+ ++  L     SPN
Sbjct:  538 VTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGL--TPLHVATHYDHQKVALLLLDKGASPH-STAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPN 767          

HSP 6 Score: 88.1965 bits (217), Expect = 3.165e-18
Identity = 76/275 (27.64%), Postives = 120/275 (43.64%), Query Frame = 3
Query:  390 IIDK-DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTD-------------------------------------INQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            ++DK D  +    AA NG LE L   L+     ++NT +      LH A+  G +D++  LL+R A+++      GNT LH +A  G +  V  L   G   N  + + FTPL++A Q  H +  + L+  GA+ S     G TPL   ++ GH  V  +L+   T                                      +NQ  ++G T LHIAA      +  LL+  GA++D       TPL VA K+ ++ ++++L       + KT
Sbjct:    4 LLDKSDAATSFLRAARNGNLERLMDHLKGG--MDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKV-GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKT 275          

HSP 7 Score: 87.4261 bits (215), Expect = 4.993e-18
Identity = 72/275 (26.18%), Postives = 121/275 (44.00%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIG-----RLPNL--------------------------------VNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            K G + +HIAA  GQ +I++ L++     N  + + F  TPL+ AA    ++I++ LL+ GA  ++  +  G TPL  +  +G+ Q V  L         RLP L                                   S FTPLH+A   G+      L+  GA +    R G TPLH   + G+  + ++L+     I+ + ++G T LH AA     K+ ++L+E  A I  +     +PL +A +  H   +++L       +  T+ +L
Sbjct:   74 KVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGF--TPLYMAAQENHLEIVKFLLDNGANQSVA-TEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYL 345          

HSP 8 Score: 85.1149 bits (209), Expect = 3.115e-17
Identity = 61/178 (34.27%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIA 932
            K+G +P+HIAA+  QLE+ K LL+     N+ T       PLH AA  G  D++ +LL R A +++  +  G T +H +A +      E L       N      +TPLH+A   G+ +    L+R  A ++A+ R G TPLH   + GH  V   L+      N+   NG+TAL IA
Sbjct:  606 KNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGV--APLHLAAQEGHADMVALLLGRHASISLA-TKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 780          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.853e-26
Identity = 77/236 (32.63%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            + + G +P+H++A  G L I+  LLQ     + N  +    T LH AA  GQ ++++ LL  GAQV+ + +    TPLH +A  G  + V+ L      P+    + +TPLH+A + GH   T  L+  GA ++   + G TPLH   +YG   V+ +L+      +   +NG T LH+A+    +K+  LL++ GAS         TPL +A KK   EI   L      TN  T
Sbjct:   44 VTESGLTPMHVSAFMGNLNIVLILLQGGA--SPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAK-AREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAIT 276          

HSP 2 Score: 108.612 bits (270), Expect = 1.748e-24
Identity = 69/233 (29.61%), Postives = 119/233 (51.07%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            +G +P+H+AA  G  ++   LL+      V T   F  TPLH A+  G++++  +LL+R A  +     +G TPLH ++     +    L   G  P+    + +TPLH+A +    +    L+  GA+ +A  R G  PLH G + GHA V+ +L++   D+N   ++G + LH+AA   +  + ++LV+ GA ++       TPL VA    + +++  L     + N KT
Sbjct:  146 NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGF--TPLHVASKYGKMEVASLLLQRFASPDAAGK-NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKT 375          

HSP 3 Score: 105.145 bits (261), Expect = 1.780e-23
Identity = 84/306 (27.45%), Postives = 148/306 (48.37%), Query Frame = 3
Query:  201 RLLLGFTRPY-AVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            R L GFT  + A      R ++ L K   +++    + ++ +  +  + N + V   ++ G +    +  G++ +H+AA  GQ E+++ LL+      V+     + TPLH AA +G+++I+Q+LL+  A  +   S +G TPLH +A +G+      L   G    +     FTPLH+A + G  +    L++  A   A  + G TPLH    Y +  V+ +L+      +   +NG T LHIAA   + +I   L+E GA  +    Q   PL +  ++ H+++  +L     + N  T S L
Sbjct:   11 RALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGA--QVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATS-NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGL 313          

HSP 4 Score: 105.145 bits (261), Expect = 2.247e-23
Identity = 69/206 (33.50%), Postives = 103/206 (50.00%), Query Frame = 3
Query:  486 NVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL--KTCSPNTNQK 1097
            NV   + F  TPLH A    +I ++++LL+ GA +     + G TP+H SA+ G    V  L   G  PN  N    T LH+A + G  +  R+L+R GA + A+ R   TPLH   R G   + ++L+      +    NG T LH+AA      +T +L+E GAS+ +   +  TPL VA K    E+  +L  +  SP+   K
Sbjct:    9 NVRALNGF--TPLHIACKKNRIRVMELLLKYGASIEAVTES-GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK 211          

HSP 5 Score: 102.064 bits (253), Expect = 1.631e-22
Identity = 88/322 (27.33%), Postives = 135/322 (41.93%), Query Frame = 3
Query:  327 DAVSINNFDKVKEFIRAGHN-------------LIIDKDGKSPIHIAAENGQLEILKYLLQAF------------PMYNVNTPDN-------FDS------------TPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNT-NQKTVS-----FLPENLRENFSV 1142
            DA + N +  +    R GH               +  K G +P+H+A++ G++E+   LLQ F            P++  +  DN        D             TPLH AA   Q++I   LLE GA+ N   +  G  PLH  A +G++     L       N    S  +PLHLA Q         L++ GA ++A  + G TPL     YG+  +   L+    D+N + +NG T LH AA      I  LL++ GA  +   +   T L +A +  +  +++ LK  +  T    TVS      +PE + E   V
Sbjct:  141 DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETN-AITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRNVPETMTEVLEV 461          

HSP 6 Score: 75.0998 bits (183), Expect = 4.298e-14
Identity = 40/126 (31.75%), Postives = 68/126 (53.97%), Query Frame = 3
Query:  690 PNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            PN+   + FTPLH+A +    +    L++ GA I A    G TP+H     G+  +  IL+      N  N  G+TALH+AA   + ++ + L+ +GA +D +  + +TPL +A +    EI+++L
Sbjct:    8 PNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL 133          

HSP 7 Score: 48.1358 bits (113), Expect = 7.983e-6
Identity = 27/100 (27.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:  768 LIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L+  GA+ + +   G TPLH   +     V  +L+     I    ++G T +H++A +    I  +L++ GAS +  N++ ET L +A +   +E++  L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSL 100          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 2.627e-26
Identity = 77/236 (32.63%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            + + G +P+H++A  G L I+  LLQ     + N  +    T LH AA  GQ ++++ LL  GAQV+ + +    TPLH +A  G  + V+ L      P+    + +TPLH+A + GH   T  L+  GA ++   + G TPLH   +YG   V+ +L+      +   +NG T LH+A+    +K+  LL++ GAS         TPL +A KK   EI   L      TN  T
Sbjct:  134 VTESGLTPMHVSAFMGNLNIVLILLQGGA--SPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAK-AREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAIT 366          

HSP 2 Score: 114.005 bits (284), Expect = 3.584e-26
Identity = 78/237 (32.91%), Postives = 115/237 (48.52%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL--KTCSPNTNQK 1097
            I  D  + +H+AA  G     K LL      NV   + F  TPLH A    +I ++++LL+ GA +     + G TP+H SA+ G    V  L   G  PN  N    T LH+A + G  +  R+L+R GA + A+ R   TPLH   R G   + ++L+      +    NG T LH+AA      +T +L+E GAS+ +   +  TPL VA K    E+  +L  +  SP+   K
Sbjct:   68 ITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGF--TPLHIACKKNRIRVMELLLKYGASIEAVTES-GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK 301          

HSP 3 Score: 108.612 bits (270), Expect = 1.937e-24
Identity = 69/233 (29.61%), Postives = 119/233 (51.07%), Query Frame = 3
Query:  402 DGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            +G +P+H+AA  G  ++   LL+      V T   F  TPLH A+  G++++  +LL+R A  +     +G TPLH ++     +    L   G  P+    + +TPLH+A +    +    L+  GA+ +A  R G  PLH G + GHA V+ +L++   D+N   ++G + LH+AA   +  + ++LV+ GA ++       TPL VA    + +++  L     + N KT
Sbjct:  236 NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGF--TPLHVASKYGKMEVASLLLQRFASPDAA-GKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKT 465          

HSP 4 Score: 105.145 bits (261), Expect = 2.267e-23
Identity = 84/306 (27.45%), Postives = 148/306 (48.37%), Query Frame = 3
Query:  201 RLLLGFTRPY-AVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            R L GFT  + A      R ++ L K   +++    + ++ +  +  + N + V   ++ G +    +  G++ +H+AA  GQ E+++ LL+      V+     + TPLH AA +G+++I+Q+LL+  A  +   S +G TPLH +A +G+      L   G    +     FTPLH+A + G  +    L++  A   A  + G TPLH    Y +  V+ +L+      +   +NG T LHIAA   + +I   L+E GA  +    Q   PL +  ++ H+++  +L     + N  T S L
Sbjct:  101 RALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGA--QVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATS-NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGL 403          

HSP 5 Score: 104.76 bits (260), Expect = 2.884e-23
Identity = 68/224 (30.36%), Postives = 118/224 (52.68%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN-TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            +DG +P+H AA +G  ++++ LL+        T +    +PLH A     ++ +Q+L++  A V+  D T    T LH +A  G+ +T + L   G  PN+   + FTPLH+A +    +    L++ GA I A    G TP+H     G+  +  IL+      N  N  G+TALH+AA   + ++ + L+ +GA +D +  + +TPL +A +    EI+++L
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGL--SPLHMATQGDHVECVQVLMQYRAPVD--DITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL 223          

HSP 6 Score: 102.834 bits (255), Expect = 1.297e-22
Identity = 88/332 (26.51%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  327 DAVSINNFDKVKEFIRAGHN-------------LIIDKDGKSPIHIAAENGQLEILKYLLQAF------------PMYNVNTPDN-------FDS------------TPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVIN 1190
            DA + N +  +    R GH               +  K G +P+H+A++ G++E+   LLQ F            P++  +  DN        D             TPLH AA   Q++I   LLE GA+ N   +  G  PLH  A +G++     L       N    S  +PLHLA Q         L++ GA ++A  + G TPL     YG+  +   L+    D+N + +NG T LH AA      I  LL++ GA  +   +   T L +A +  +  +++ LK  +  T   T    P          S  V++P  M  V+ 
Sbjct:  231 DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETN-AITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNP----------SSRVNVPETMTEVLE 551          

HSP 7 Score: 70.0922 bits (170), Expect = 1.338e-12
Identity = 52/162 (32.10%), Postives = 77/162 (47.53%), Query Frame = 3
Query:  612 GNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL--KTCSPNTN 1091
            G TPLH +A  G+ Q VE L   G        +  +PLH+A QG H +  + L++  A +        T LH     GH   +++L+    + N R  NG T LHIA    R ++ +LL++ GASI+       TP+ V+    +  I+ IL     SPN  
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNAT 167          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 2.324e-25
Identity = 69/239 (28.87%), Postives = 123/239 (51.46%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA NG  E++ +L+      N+N  D  D   +H AA +G  +++++L+  GA V  +D   G +PLH ++  G    V+ L  +G   +  N    T LH+A   G +     LI CGA+++  N  G TPLH      H  +   +L++   D+N ++++G + LH+ A   R   ++ L+++G  ID  +    TPL +A +  H  +I  L T   +T ++ +
Sbjct:  133 VSDRAGRTALHHAAFNGHSEMVNFLVAKGA--NINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKK-GYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGI 368          

HSP 2 Score: 106.686 bits (265), Expect = 6.613e-24
Identity = 80/248 (32.26%), Postives = 121/248 (48.79%), Query Frame = 3
Query:  336 SINNFDKVKEFIRA-GHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD-STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNL-IRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            + N   ++  F+ A G N+   DK  +  IH AA  G  E++K L+      +V   D    +PLH A+S GQI ++++LL+ G  V+I D ++ GNT LH + + G    V  L   G   N  N   FTPLH A    H      L +  GAD++ Q++ G +PLH    +G    S+ LI    +I+  +++G+T LHIAA      +   L+ +GA    R I    PL +A     S+    L
Sbjct:  146 AFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGA--DVRCKDKKGYSPLHAASSSGQIGVVKLLLDLG--VDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKL 389          

HSP 3 Score: 106.301 bits (264), Expect = 8.275e-24
Identity = 89/324 (27.47%), Postives = 152/324 (46.91%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV-SFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            LI A+   + D+V+  I     +  +D + ++P+H AA  G+ EI++ L+       VN+ DN   TPLH+A +      +Q LL+  A VN +D     TPLH +A     +  E +  +    N+ + +  T LH A   GH++    L+  GA+I+A ++     +H     GH  V ++L++   D+  +++ G + LH A++  +  + KLL++ G  ID  N    T L VA       ++  L  C  N NQ     F P     +F+  S H ++  E+  ++NN      ++K     +   P     V G F+R
Sbjct:   10 LIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLV--LSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKN-WQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTP----LHFAAASTHGALCLEL--LVNNGADVNVQSK-----DGKSPLHMTAVHGRFTR 319          

HSP 4 Score: 98.9821 bits (245), Expect = 1.752e-21
Identity = 77/250 (30.80%), Postives = 118/250 (47.20%), Query Frame = 3
Query:  402 DGKS-----PIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVE----SGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLP 1115
            DGKS     P+H+AA +G    L+ L+++    +V   + +  TPL  AA  G  D +++L++ GA V +++     T LH +A  G+ + +  L         V+ S     TP+ LAV  GH      L+  GA I+A++  G T LH G   GH     +L+  S D++ R + G   LH+AAA     I   LV+    SGA I + +    TPL  A    H   +E+L        Q+  +F P
Sbjct:  577 DGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGY--TPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSP 824          

HSP 5 Score: 97.0561 bits (240), Expect = 6.417e-21
Identity = 75/247 (30.36%), Postives = 121/247 (48.99%), Query Frame = 3
Query:  303 HTNVSNLIDA--VSINNFDK-----VKEFIRAGHNLII-------------DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQ-TVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESG 980
            H+ + N + A   +IN FDK     +      GH  ++             DK G SP+H A+ +GQ+ ++K LL      +++ P++F +T LH A   GQ  ++  L++ GA VN Q +  G TPLH +A   +    +E L   G   N+ +    +PLH+    G    ++ LI+ G +I  ++R G+TPLH   RYGH  +   LI+   D  +R  +G   LH+AA        + L+ +G
Sbjct:  150 HSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLG--VDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVN-QANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAG 393          

HSP 6 Score: 84.7297 bits (208), Expect = 3.917e-17
Identity = 76/285 (26.67%), Postives = 125/285 (43.86%), Query Frame = 3
Query:  351 DKVKEFIRAGHNLIIDK--DGKSPIHIAAENGQLEILKYLLQ-AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF-----TPLHLAVQGGHNQTTRNLIRC----GADISAQNRFGDTPLHTGVRYGHAGVSRILI------------------SVSTD----------------INQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            D V+  I+ G ++++ +  D ++ +H AA NG +E L+ L++ A     V+  D  + TP+  A   G  D   +LL +GA +N +D+  G T LH  A  G+ + V+ L     L   V+ SL       PLH+A   GH      L++     GA I   +R G TPLH     GH G   +L+                  +V  D                IN  +  G   LH AA     +  +LL+   A +++ ++  ++PL +A +   +  +E+L
Sbjct:  630 DCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNK-GCTALHRGAATGHEECVDLL-----LQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVL 908          

HSP 7 Score: 82.4185 bits (202), Expect = 2.117e-16
Identity = 75/291 (25.77%), Postives = 117/291 (40.21%), Query Frame = 3
Query:  372 RAGHNLIIDK-------------DGKSPIHIAAENGQLEILKYLLQAFPMYNV----------------NTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTT----------------------------RNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGD--TALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            R GH L+I+               G  P+H+AA +G  +  + LL A   Y++                +TPD F  T LH AAS G ++ + +LL  GA +N +D     T LH +A     Q V  L   G   N  +    TPLH A     + +T                             +L+R  AD   Q++ G TP+H    YGH     +L+          ++G   + LH+AA        ++L+ S   +D+R     TPL +A  + H++ + +L
Sbjct:  346 RYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFE-RTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVL 635          

HSP 8 Score: 82.4185 bits (202), Expect = 2.386e-16
Identity = 63/211 (29.86%), Postives = 100/211 (47.39%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            KDGKSP+H+ A +G+    + L+Q      ++  D   +TPLH AA  G   +I  L+  GA    +   HG  PLH +A  G+S     L   G+      YS+ +            +  +++  G +I   + FG T LH     G+     +L+S   D+N++++   TALH AAA    +    LV SGA ++ ++ +  TPL  A
Sbjct:  302 KDGKSPLHMTAVHGRFTRSQTLIQNGG--EIDCEDRDGNTPLHIAARYGHELLINTLITNGAD-TAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQ-----KYSIVSSF----------SNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYA 494          

HSP 9 Score: 73.9442 bits (180), Expect = 1.009e-13
Identity = 51/184 (27.72%), Postives = 90/184 (48.91%), Query Frame = 3
Query:  516 TPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
             PL +A   G  D ++ L+ +  +VN  D     TPLH +A+ G ++ +E L L G   N  +    TPLH A         + L++  AD++A+++   TPLH          +  +I + +  N  ++ G TALH AA     ++   LV  GA+I+  + ++   +  A    H+E++++L
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEK-RTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVL 190          

HSP 10 Score: 68.1662 bits (165), Expect = 5.217e-12
Identity = 60/234 (25.64%), Postives = 108/234 (46.15%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTP--DNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGN--TPLHESAWKGYSQTVEYL--CLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI-SVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQN---ETPLDVALKKSHSEIIEIL 1067
            ++ G++P+H+AA  G + IL  L+QA        P  D    TPLH A   G    +++LLE    +++     GN  +PLH +         E L      ++ N  +     PLH A    H +  + L+   A ++  +  G +PL      G A    +L+ S  TD+  ++ N +TALH+A +        L+++    +++ N  N   +TPL +A +   + ++++L
Sbjct:  749 ERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLE----LDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVL 978          

HSP 11 Score: 60.4622 bits (145), Expect = 1.145e-9
Identity = 52/173 (30.06%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  411 SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLP-NLVNYSLFTPLHLAVQGGHNQTT---RNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDT 917
            SP+H A  N      + L+  F    +N PD     PLH AA    ++ +Q+LL   A VN+ D   G +PL  +   G +  VE L    +    L + +  T LHLA    H        + +     I+A N    TPLH   R G A V ++L++    I   + NG T
Sbjct:  823 SPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMA-GKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYT 994          

HSP 12 Score: 55.0694 bits (131), Expect = 5.435e-8
Identity = 43/158 (27.22%), Postives = 70/158 (44.30%), Query Frame = 3
Query:  618 TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
             PL ++ + G    V  L       N V+    TPLH A   G  +    L+  GA +++++    TPLH           + L+  S D+N R++N  T LH+AAA +  K  + ++   +S ++ +    T L  A    HSE++  L     N N
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANIN 165          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 68.5514 bits (166), Expect = 2.250e-13
Identity = 62/239 (25.94%), Postives = 104/239 (43.51%), Query Frame = 3
Query:  342 NNFDKVKEFIRAGHNLII--DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNT---PDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDST-HGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVS-TDINQRNQNGDTALHIAAALKRRKITKLLVES-GASIDIRNIQNETPLDVAL 1034
            N F KV+E + +  +L++  D+DG+ P+H +      EI  +LL    M NVN    PD+   TP H A S+G +++++ L +R  + ++   T  G T LH +  K + +  ++L                                 I  GA +  +++F   PLH     G   +  +L  +  + +N +++ G T L  A A        LLVE  GA  D+ + +     DVAL
Sbjct:   13 NEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLS--KMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFL---------------------------------IENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVAL 216          

HSP 2 Score: 55.4546 bits (132), Expect = 5.028e-9
Identity = 48/186 (25.81%), Postives = 78/186 (41.94%), Query Frame = 3
Query:  519 PLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNY---SLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            PLH+A    +   +Q LL     + +Q    G  PLH S      +   +L       NL +Y   S +TP H+A   G+ +  ++L              D PL                    D+N+    G T LH+A   K  ++++ L+E+GAS+ I++  N+ PL  A      ++IE+L
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLY-------------DRPL------------------KPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELL 159          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 66.2402 bits (160), Expect = 6.667e-12
Identity = 55/189 (29.10%), Postives = 96/189 (50.79%), Query Frame = 3
Query:  438 GQLEILKYLLQAFP--MYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVN-IQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNY---SLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILIS---VSTDINQRNQNGDTALHIAAALKRRKI-TKLLVE 974
            G L I+K LL+  P  + N+++ + + S  LH A+  G+  I   L++ G   + +  +  GNT +H +  KG+ QT+    L+ + P  +N+   +   P+H+A    + Q    LI  GAD+   +  GDTPLH  + YG     ++L++   VS D N R++     + +A   +   I +K+L E
Sbjct:   16 GNLLIVKRLLRRNPDLLTNIDSENGWSS--LHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLH--LLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKE 200          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 62.7734 bits (151), Expect = 1.492e-10
Identity = 62/207 (29.95%), Postives = 85/207 (41.06%), Query Frame = 3
Query:  357 VKEFIRAGHNLIIDKDGKSP-----IHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF----------TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIA 932
            VKE I  G  L ++ DG S      +H A+ N +L ++ +L+      N        +TPLH AA  G + I+  LL+ GA   + D   G   LH S        V Y+     L N+V+  L           T L  A   G + T   L++ GA I   +  G TPLH G   G   V + LI    D  Q+   G     IA
Sbjct:   89 VKEMIH-GKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARA-GALHATPLHWAARYGYVYIVDFLLKHGADPTMTDD-QGFNLLHLSVNSSNIMLVLYV-----LFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287          

HSP 2 Score: 48.521 bits (114), Expect = 3.677e-6
Identity = 61/216 (28.24%), Postives = 94/216 (43.52%), Query Frame = 3
Query:  489 VNTPDNFDSTPL----HKAASIGQIDII-QMLLERGAQVNIQ-DSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF-TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAG-VSRILISVST----DINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            VN  D  +  PL    H A   G +  + +M+  +  +VN   DST   T LH ++       V++L   G   N    +L  TPLH A + G+      L++ GAD +  +  G   LH  V   +   V  +L +V +    DI+ R+  G T+L  AA          L++ GASI I + +  TPL     K    +++ L     +  QKT
Sbjct:   62 VNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKT 277          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 61.2326 bits (147), Expect = 5.379e-10
Identity = 60/223 (26.91%), Postives = 104/223 (46.64%), Query Frame = 3
Query:  453 LKYLLQAFPMY---NVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD-------STHGN----TPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGA-DISAQ-NRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQ-NGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILK 1070
            L Y+L+  P++    +   DN+  TPLH +   G  ++ +++++   + NI +       S  G+    TPLH      + +T E L L    PN V     + LHLA +  +      L+     DI+ Q N   +TPL+   R      +  L+    D+  R +  G TA+ +AAA     I KLL+ + A+ DI +    TP++ A+ + H  I ++++
Sbjct:  406 LSYILEELPIHLRPCLFQHDNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVL-LQSLDPN-VKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQ 626          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 57.7658 bits (138), Expect = 5.859e-9
Identity = 37/108 (34.26%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  516 TPLHKAASIGQIDIIQMLLERGA-QVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF--TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHT 830
            T L  A   G+ D+++ ++E G   +N QD+  GNT LHE+A +G+ + VE L   G   N+ +  +F  TPL  A   GH    + L++ GAD + +N  G T   +
Sbjct:  332 TRLQIACDKGKYDVVKKMIEEGGYDINDQDNA-GNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFES 438          

HSP 2 Score: 51.9878 bits (123), Expect = 3.022e-7
Identity = 29/88 (32.95%), Postives = 52/88 (59.09%), Query Frame = 3
Query:  348 FDKVKEFIRAGHNLIIDKD--GKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDS 605
            +D VK+ I  G   I D+D  G + +H AA  G +EI++ L++     N+ + + F  TPL  A++ G +D+++ LL+ GA   I+++
Sbjct:  343 YDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNA 430          

HSP 3 Score: 48.521 bits (114), Expect = 4.018e-6
Identity = 33/106 (31.13%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  717 TPLHLAVQGGHNQTTRNLIRCGA-DISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQN--GDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLD 1025
            T L +A   G     + +I  G  DI+ Q+  G+T LH     GH  +  +LI    D+N ++    GDT L  A+A     + K L+++GA   IRN +  T  +
Sbjct:  332 TRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 90.8929 bits (224), Expect = 1.303e-20
Identity = 66/222 (29.73%), Postives = 107/222 (48.20%), Query Frame = 3
Query:  414 PIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHN-QTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGD---TALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            P+H+A   G  E  K LL  F   +VN  DN D TPLH AA  G ++ +++L+ +    N  D   G  PLH +A     + V  L   G   N  +    TPLH A     + +   +L+R   + S +++ G + +H     GH     +L+ VS +      +G    T LH+AA    +   ++L++S   +++R+ +  TPLD+A  + H E +E L
Sbjct:    3 PLHLACLGGFTECCKKLL--FYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKL-GRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECL 221          

HSP 2 Score: 61.6178 bits (148), Expect = 1.110e-10
Identity = 54/172 (31.40%), Postives = 78/172 (45.35%), Query Frame = 3
Query:  372 RAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLH-KAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYS----LFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI 872
            +AG    IDK G++P+H AA +     +  L+ A    NVN PD    TPLH  AAS      ++ LL      + +D   G + +H ++  G+   +E L L     +L+N S      TPLHLA   GH      LI+   D+  ++  G TPL      GH      L+
Sbjct:   55 QAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGS--NVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDK-QGYSAVHYASANGHKLAIEML-LDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLL 222          

HSP 3 Score: 49.2914 bits (116), Expect = 1.614e-6
Identity = 40/157 (25.48%), Postives = 68/157 (43.31%), Query Frame = 3
Query:  621 PLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAA--LKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPN 1085
            PLH +   G+++  + L   G   N  + +  TPLH A   G+      L+    D +  ++ G  PLH    + +      L++  +++N+ +    T LH AAA  L  + +  LL   G +   R+ Q  + +  A    H   IE+L   S N
Sbjct:    3 PLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRG-NASKRDKQGYSAVHYASANGHKLAIEMLLDVSAN 158          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 84.7297 bits (208), Expect = 6.673e-19
Identity = 58/215 (26.98%), Postives = 106/215 (49.30%), Query Frame = 3
Query:  426 AAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILI-SVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A  +G+ + ++ LL+   + N+NT D    +PLH A +   +DI+QMLL+ GA V+++ S                        I R+P ++  + F  +         ++ R L+R GAD++  N +G T LH   R GH+ +  +L+     D+N  +++  T+LH+AA +    I K L+  GA+I  ++    T   +A ++   E+++ L
Sbjct:    2 ACRDGRKDCVRKLLRG-NLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPS----------------------IQRIPPIICAAKFNAI---------ESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTL 184          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 85.1149 bits (209), Expect = 9.427e-19
Identity = 67/228 (29.39%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  306 TNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASI 989
            T  S L  A   N  + + E IR G      +D  +P+H+A + G +E+ + L++      ++  ++   TPLH AA IG  D ++ LL +G  ++ +D +H  TP   +   G ++    L     L    N    +PLHLA   G       L R G   + ++  G + LH     G   V   L+    DIN R+ N  T L  AA     K    L++SGASI
Sbjct:    7 TGFSALHHATRYNRVEAMAELIRNGSI----EDLSTPLHVACKKGSMEVGRLLVEKGAA--LDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSH-RTPFLSAVAAGRTENAMLL-----LEKDENQK--SPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 80.4925 bits (197), Expect = 4.464e-17
Identity = 63/228 (27.63%), Postives = 109/228 (47.81%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKK-SHSEIIEILKT 1073
            +D  G S +H A    ++E +  L++   + ++       STPLH A   G +++ ++L+E+GA ++ ++   G TPLH +A  G    +++L   G   +  ++S  TP   AV  G  +    L+        ++    +PLH     G A     L       N+R++ G +ALH+AA    RK+   L+  GA I+ R+    TPL  A K  S    +E+L++
Sbjct:    4 MDDTGFSALHHATRYNRVEAMAELIRNGSIEDL-------STPLHVACKKGSMEVGRLLVEKGAALDKKNDK-GETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQS 216          

HSP 3 Score: 58.151 bits (139), Expect = 1.520e-9
Identity = 39/131 (29.77%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  714 FTPLHLAVQGGHNQTTRNLIRCGA--DISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
            F+ LH A +    +    LIR G+  D+S       TPLH   + G   V R+L+     ++++N  G+T LH+AA +      K L+  G +ID R+  + TP   A+    +E   +L     + NQK+
Sbjct:    9 FSALHHATRYNRVEAMAELIRNGSIEDLS-------TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLL--LEKDENQKS 130          

HSP 4 Score: 50.447 bits (119), Expect = 5.882e-7
Identity = 36/129 (27.91%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  711 LFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQK 1097
            L TPLH+A + G  +  R L+  GA +  +N  G+TPLH     G     + L+S    I++R+ +  T    A A  R +   LL+E       ++   ++PL +A     +  +E L     +TN++
Sbjct:   36 LSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNER 157          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 77.7962 bits (190), Expect = 3.782e-16
Identity = 45/143 (31.47%), Postives = 76/143 (53.15%), Query Frame = 3
Query:  522 LHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSL--FTPLHLAVQGGHNQTTRNLIRCGADI---SAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAA 935
            + + A  G + +  MLL+ GA++N++  ++ ++PL  + WKG+   VE L  + R  N+ + +   FTPL  A  GGH      L+  GA +   S  N   D PL +    GH  V ++L+  +++I  R ++G T L +AA
Sbjct:   57 MSRDALAGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELL--LARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNN--DIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAA 195          

HSP 2 Score: 55.0694 bits (131), Expect = 1.580e-8
Identity = 32/96 (33.33%), Postives = 49/96 (51.04%), Query Frame = 3
Query:  384 NLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYL 671
            N+  D +  SP+  A   G  ++++ LL         T + F  TPL  AA  G  D+   LLE+GA+VNI   ++ + PL  + WKG+   V+ L
Sbjct:   80 NVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGF--TPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLL 173          

HSP 3 Score: 53.9138 bits (128), Expect = 4.576e-8
Identity = 35/122 (28.69%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  741 GGHNQTTRNLIRCGADISAQNRFG-DTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDI-RNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT 1100
             GH +    L+  GA+I+ ++    D+PL      GH  V  +L++ S +I  R + G T L  AA      +   L+E GA ++I     N+ PL  A  K H +++++L   + N   +T
Sbjct:   63 AGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRT 184          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO30889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZG9])

HSP 1 Score: 70.4774 bits (171), Expect = 1.399e-14
Identity = 32/105 (30.48%), Postives = 62/105 (59.05%), Query Frame = 3
Query:  756 TTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILK 1070
            T   L+R GAD+ A +  G+TPLH     G   ++++LI   +D+N  N+   + LH++A +   ++T+LL++ GA   + + Q  TP+++A+     ++IE ++
Sbjct:   10 TADVLVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSGRIDVIEAIE 114          

HSP 2 Score: 53.5286 bits (127), Expect = 9.665e-9
Identity = 31/107 (28.97%), Postives = 56/107 (52.34%), Query Frame = 3
Query:  348 FDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVE 665
            F      +R G ++  +D  G +P+H AA  G+ +I K L+  +   +VN  +  D +PLH +A +G  ++ Q+LL++GA   + D+    TP+  +   G    +E
Sbjct:    8 FGTADVLVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWS--DVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDA-QARTPMEMAIDSGRIDVIE 111          

HSP 3 Score: 51.9878 bits (123), Expect = 3.436e-8
Identity = 29/87 (33.33%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  486 NVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGG 746
            +V   D+  +TPLH AA+ G+ DI ++L+++ + VN  +     +PLH SA  G S+  + L   G  P L++    TP+ +A+  G
Sbjct:   20 DVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNK-EDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSG 105          

HSP 4 Score: 48.9062 bits (115), Expect = 4.686e-7
Identity = 21/72 (29.17%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  852 GVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            G + +L+    D+   + +G+T LH AAA  R  I KLL++  + ++  N ++++PL ++ +   SE+ ++L
Sbjct:    9 GTADVLVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLL 80          

HSP 5 Score: 46.9802 bits (110), Expect = 2.159e-6
Identity = 35/101 (34.65%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  564 MLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGV 857
            +L+ RGA V   D  HGNTPLH +A  G     + L       N +N    +PLHL+ + G ++ T+ L+  GAD   + AQ R   TP+   +  G   V
Sbjct:   13 VLVRRGADVKAVDH-HGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQAR---TPMEMAIDSGRIDV 109          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd6b (ankyrin repeat domain 6 [Source:NCBI gene;Acc:101160867])

HSP 1 Score: 171.014 bits (432), Expect = 3.351e-44
Identity = 105/303 (34.65%), Postives = 163/303 (53.80%), Query Frame = 3
Query:  321 LIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSES 1229
            L+ A      D V + I  G  + + K G+SP+H+AA  G LE++  LL+A    +++  D+ + T LH+AA +G  D+I  L++ G  ++ QD   GNT LHE AW G+SQ+V+ L   G   +  N +  T LHLA Q GH Q+++ L+  G    ++N  GDT LH   RY H  + RIL+     ++++N  GDT LH+AAAL  +K  +LL+E+GA   + N   +T LD A   ++ E+  +L T +P +  +  S      R+    + R  S+P +   V   P    +  K ES
Sbjct:   16 LLIAAHKGQADNVVQLINKGAKVALTKYGRSPLHLAAHKGHLEVVHILLKAG--CDLDIEDDGEQTALHRAAVVGNTDVIGALIQEGCALDRQDKD-GNTALHEVAWHGFSQSVKLLVKAGANVHAKNKAGNTALHLACQNGHAQSSKVLLLGGCRPDSKNTAGDTCLHVAARYNHVAMIRILLGAFCSVSEKNLVGDTPLHVAAALNHKKTVRLLLEAGADSHVCNNAGQTALDQARDHNNPEVA-LLLTKAPQSFLRGRSV--RKRRDKLKSERRAQSVPRDQM-VWGGPSSPQWYRKVES 311          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 122.865 bits (307), Expect = 2.541e-28
Identity = 75/239 (31.38%), Postives = 124/239 (51.88%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G LE+++ LL      N+N  D  D   +H AA +G I+++++L   GA+V  +D     TPLH +A  G    V++L  +G   N  N    TPLH+A   G +     LI CGA ++  N  G  PLH      H  +   +L+    D+N ++++G T LH+ A   R   ++ ++E+GA ID  +    TPL +A +  H  +I  L T   +T ++ +
Sbjct:  135 VSDRAGRTALHHAAFSGHLEMVRLLLSRGS--NINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKK-SYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGI 370          

HSP 2 Score: 115.161 bits (287), Expect = 7.915e-26
Identity = 85/281 (30.25%), Postives = 127/281 (45.20%), Query Frame = 3
Query:  231 AVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRC-GADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A  N   R  ++L      +  S     + L  A    + + V+  +  G N+   DK  +  IH AA  G +E++K L  A     V   D    TPLH AAS G I +++ LL+ G  +N + + +GNTPLH + + G    V  L   G   N VN   F PLH      H      L+ C GAD++ +++ G TPLH    +G    S+ +I    +I+  ++NG+T LHIAA      +   L+ + A    R I    PL +A     S+    L
Sbjct:  114 AAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLL--ASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDIN-EPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKL 391          

HSP 3 Score: 100.138 bits (248), Expect = 3.934e-21
Identity = 86/298 (28.86%), Postives = 139/298 (46.64%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQ-KTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            D + ++P+H AA  G  EI++ L+       VN  DN   TPLH+A +    + +Q+LL+  A VN +D  +  TPLH +A     +  E L  +    N+ + +  T LH A   GH +  R L+  G++I+A ++     +H     GH  V ++L S   ++  +++   T LH AA+     + K L++ G  I+  N    TPL VA       ++  L  C  + NQ     F P     +F+  SRH ++  E+  V N  +        +S + KT P     + G FSR
Sbjct:   38 DNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDK-NWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAP----LHFTAASRHGALCLELL-VCNGAD-----VNIKSKDGKT-PLHMTAIHGRFSR 321          

HSP 4 Score: 93.2041 bits (230), Expect = 4.608e-19
Identity = 65/228 (28.51%), Postives = 118/228 (51.75%), Query Frame = 3
Query:  375 AGHNLIIDKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESA--WKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVA 1031
            +G +++ D D +   SP+H+AA +G  + ++ L+Q+  + +++  ++   TPL  AA  G ++ + +L+ +GA + ++D T   TP+H +    K     +  LC + RL N+ N +  TPL LAV  GH     +L+  GA + A++++G T LH G   GH      L+  +     R+  G T +H+AAA     +   L+ +  S++    + +    TPL  A
Sbjct:  533 SGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQS--LLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAGKNCKKEKTKLPGLCNL-RLKNMRNANGLTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWA 757          

HSP 5 Score: 80.1073 bits (196), Expect = 5.232e-15
Identity = 53/188 (28.19%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  510 DSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKT 1073
            D  PL KA      D ++ L+ +   VN QD+    TPLH +A+ G ++ +E L L G   N  +    TPLH AV     +  + L++  AD++A+++   TPLH          +  L+ + +++N  ++ G TALH AA     ++ +LL+  G++I+  + ++   +  A    H E++++L +
Sbjct:    8 DQPPLLKAIFNVDPDEVRSLIFKKEDVNAQDNEK-RTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLAS 194          

HSP 6 Score: 69.707 bits (169), Expect = 8.529e-12
Identity = 77/282 (27.30%), Postives = 111/282 (39.36%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDN-----FDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESA-----WKGYSQTVEYLCLIGRLPNLVNYSLF-TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLH------------------------------TGVRYGHAGVSRILISV---------------STDI-NQRNQNGDTA-LHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            DK+G +P+HIAA  G   ++  L+        N  D          PLH AA  G  D  + LL  G  ++  D   G T LH +A     WK    T+ + C I        +S F TPLH A    + Q    L+  GA ++  +  G TPLH                                V Y  A   R+ + +                TDI N  +     + LH+AA     +  ++LV+S   +D+RN Q  TPLD+A  K H E +++L
Sbjct:  336 DKNGNTPLHIAARYGHELLINTLI-------TNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDD-FGRTCLHAAAESNLSWK---PTLFFSCFI--------FSQFRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELVRNAFPPCYPLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVL 598          

HSP 7 Score: 67.3958 bits (163), Expect = 5.214e-11
Identity = 57/201 (28.36%), Postives = 90/201 (44.78%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENG--QLEIL------------------KYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF-TPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDT 917
            ++ D  G +P+H A  NG  Q+++L                  + L+       VN  D  + TPLH AA    ++ +Q+LL   AQVN  D+  G +PL  +A  G +  VE L    +    +  ++  T LHLA   GH  +   ++   +D   I+A N    TPLH   R G   V + L++    +   ++NG T
Sbjct:  744 VLTDSHGYTPLHWACYNGKYQMDLLLDISFFAFLRIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAA-GKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYT 943          

HSP 8 Score: 65.4698 bits (158), Expect = 1.813e-10
Identity = 73/276 (26.45%), Postives = 123/276 (44.57%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNT----PDNFDSTPLHKAASIG--QIDII------------------QMLLERGAQ--VNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCG-ADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTD---INQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETP-LDVALKKSHSE----IIEILKTCSPNTNQKTVSF 1109
            L+ D  G++P+H+AA  G + +L  LL A    +V T     D+   TPLH A   G  Q+D++                  +ML++      VN +D  +  TPLH +A+  + + ++ L       N V+ +  +PL +A + G       L+    AD++ Q+   +T LH     GH   + +++   +D   IN  N    T LH+AA      + + L+  GAS+   +    TP L  A  K  ++    I+  +   SP T+  T+ F
Sbjct:  707 LVRDCRGRTPVHLAAACGHIGVLGGLLHA--AQSVETLPVLTDSHGYTPLHWACYNGKYQMDLLLDISFFAFLRIRDNEGAAEMLIDTLGPTIVNAKDGKN-RTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTPALACAPNKDVADCLALILATMMPVSPCTSAPTLPF 979          

HSP 9 Score: 62.7734 bits (151), Expect = 1.126e-9
Identity = 52/156 (33.33%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  378 GHNLIIDKDGK--SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERG-AQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGR-----LPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTP 821
            G  ++  KDGK  +P+H AA    +E L+ LL       VNT D    +PL  AA  GQ + +++L+    A + IQD+   NT LH +  KG+  +   L ++ +     L N  N +L TPLH+A + G     + L+  GA + A +  G TP
Sbjct:  794 GPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNA--QVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVK-NTALHLACSKGHETSA--LLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTP 944          

HSP 10 Score: 58.151 bits (139), Expect = 3.107e-8
Identity = 72/289 (24.91%), Postives = 108/289 (37.37%), Query Frame = 3
Query:  408 KSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLH-KAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVE---------YLCLIGRLPNLVNYSLF----TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDI-----------------------------------NQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLR 1127
            ++P+H AA N   + L  L+ +    +VN  D    TPLH  AAS      ++ LL   A   I+D+  G   +H ++  G+   +E         Y  +     +++N S      +PLHLA   GH+Q    L++   D+  +N  G TPL      GH     +LI+    I                                   N RN NG T L +A           L+  GAS++ ++    T L       H E +E L        Q   SFL  + R
Sbjct:  434 RTPLHYAAANCNYQCLFALVGSGA--SVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDN-QGYNAVHYASAYGHRLCLELVRNAFPPCYPLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAGKNCKKEKTKLPGLCNLRLKNMRNANGLTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALL-------QHNASFLVRDCR 712          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 122.479 bits (306), Expect = 4.273e-28
Identity = 75/239 (31.38%), Postives = 124/239 (51.88%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G LE+++ LL      N+N  D  D   +H AA +G I+++++L   GA+V  +D     TPLH +A  G    V++L  +G   N  N    TPLH+A   G +     LI CGA ++  N  G  PLH      H  +   +L+    D+N ++++G T LH+ A   R   ++ ++E+GA ID  +    TPL +A +  H  +I  L T   +T ++ +
Sbjct:  135 VSDRAGRTALHHAAFSGHLEMVRLLLSRGS--NINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKK-SYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGI 370          

HSP 2 Score: 103.219 bits (256), Expect = 3.860e-22
Identity = 85/302 (28.15%), Postives = 122/302 (40.40%), Query Frame = 3
Query:  231 AVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRC----------------------------------GADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            A  N   R  ++L      +  S     + L  A    + + V+  +  G N+   DK  +  IH AA  G +E++K L  A     V   D    TPLH AAS G I +++ LL+ G  +N + + +GNTPLH + + G    V  L   G   N VN   F PLH      H      L+ C                                  GA+I  +++ G+TPLH   RYGH  +   LI+   D  +R  +G   LH+AA        + L+ SG  ID  +    T L  A
Sbjct:  114 AAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLL--ASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDIN-EPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAA 412          

HSP 3 Score: 99.7525 bits (247), Expect = 4.528e-21
Identity = 67/241 (27.80%), Postives = 123/241 (51.04%), Query Frame = 3
Query:  375 AGHNLIIDKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVALKKSHSEIIEIL 1067
            +G +++ D D +   SP+H+AA +G  + ++ L+Q+  + +++  ++   TPL  AA  G ++ + +L+ +GA + ++D T   TP+H +A  G+S+ +  L     L + V+       TPL LAV  GH     +L+  GA + A++++G T LH G   GH      L+  +     R+  G T +H+AAA     +   L+ +  S++    + +    TPL  A    H   +E+L
Sbjct:  537 SGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQS--LLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVL 775          

HSP 4 Score: 99.3673 bits (246), Expect = 6.901e-21
Identity = 83/298 (27.85%), Postives = 137/298 (45.97%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQ-KTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            D + ++P+H AA  G  EI++ L+       VN  DN   TPLH+A +    + +Q+LL+  A VN +D     TPLH +A     +  E L  +    N+ + +  T LH A   GH +  R L+  G++I+A ++     +H     GH  V ++L S   ++  +++   T LH AA+     + K L++ G  I+  N    TPL VA       ++  L  C  + NQ     F P     +F+  SRH ++  E+  ++ N      ++K     +   P     + G FSR
Sbjct:   38 DNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKN-WQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAP----LHFTAASRHGALCLEL--LVCNGADVNIKSK-----DGKTPLHMTAIHGRFSR 321          

HSP 5 Score: 85.8853 bits (211), Expect = 9.338e-17
Identity = 74/230 (32.17%), Postives = 113/230 (49.13%), Query Frame = 3
Query:  357 VKEFIRAG-HNLIIDKDGKSPIHI--AAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVN--YSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            V E I  G H   +++ G +P+H   A+ +G L  L+ L+      N+ + D    TPLH  A  G+    Q ++E GA+++ +D   GNTPLH +A  G+   +  L +  R        + +F PLHLA   G +   R L+  G DI   + FG T LH     G+     +L++   D N+++  G T LH AAA    +    LV SGAS++  + +  TPL  A
Sbjct:  255 VNELIECGAHVNQVNEKGFAPLHFTAASRHGAL-CLELLVCNGADVNIKSKDG--KTPLHMTAIHGRFSRSQAIIENGAEIDCEDKN-GNTPLHIAARYGHELLINTL-ITNRADTAKRGIHGMF-PLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYA 478          

HSP 6 Score: 78.9518 bits (193), Expect = 1.189e-14
Identity = 53/188 (28.19%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  510 DSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKT 1073
            D  PL KA      D ++ L+ +   VN QD+    TPLH +A+ G ++ +E L L G   N  +    TPLH AV     +  + L++  AD++A+++   TPLH          +  L+ + +++N  ++ G TALH AA     ++ +LL+  G++I+  + ++   +  A    H E++++L +
Sbjct:    8 DQPPLLKAIFNVDPDEVRSLIFKKEDVNAQDNEK-RTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLAS 194          

HSP 7 Score: 75.0998 bits (183), Expect = 1.744e-13
Identity = 64/239 (26.78%), Postives = 111/239 (46.44%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGY----------SQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQ-NRFGDTPLHTGVRYGHAGVSRILISV--STDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            I D +G++P+ +A  +G  + +  LL      +V   D +  T LH+ A  G  + ++ LL+  A   ++D   G TP+H +A  G+          +Q+VE       LP L +   +TPLH A   GH+     L+       A+ N F  +PLH  V   + G + +LI     T +N ++    T LH AA     +  +LL+   A ++  +   ++PL +A +   +  +E+L
Sbjct:  648 IQDGNGQTPLMLAVLSGHTDCVYSLLNKGA--SVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRD-CRGRTPVHLAAACGHIGVLGGLLHAAQSVE------TLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPF--SPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELL 875          

HSP 8 Score: 64.3142 bits (155), Expect = 4.545e-10
Identity = 52/173 (30.06%), Postives = 79/173 (45.66%), Query Frame = 3
Query:  411 SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF-TPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDT 917
            SP+H A         + L+       VN  D  + TPLH AA    ++ +Q+LL   AQVN  D+  G +PL  +A  G +  VE L    +    +  ++  T LHLA   GH  +   ++   +D   I+A N    TPLH   R G   V + L++    +   ++NG T
Sbjct:  790 SPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAA-GKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYT 961          

HSP 9 Score: 62.7734 bits (151), Expect = 1.389e-9
Identity = 52/156 (33.33%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  378 GHNLIIDKDGK--SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERG-AQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGR-----LPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTP 821
            G  ++  KDGK  +P+H AA    +E L+ LL       VNT D    +PL  AA  GQ + +++L+    A + IQD+   NT LH +  KG+  +   L ++ +     L N  N +L TPLH+A + G     + L+  GA + A +  G TP
Sbjct:  812 GPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNA--QVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVK-NTALHLACSKGHETSA--LLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTP 962          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 122.094 bits (305), Expect = 5.259e-28
Identity = 75/239 (31.38%), Postives = 124/239 (51.88%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVS-RILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTV 1103
            + D+ G++ +H AA +G LE+++ LL      N+N  D  D   +H AA +G I+++++L   GA+V  +D     TPLH +A  G    V++L  +G   N  N    TPLH+A   G +     LI CGA ++  N  G  PLH      H  +   +L+    D+N ++++G T LH+ A   R   ++ ++E+GA ID  +    TPL +A +  H  +I  L T   +T ++ +
Sbjct:  135 VSDRAGRTALHHAAFSGHLEMVRLLLSRGS--NINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKK-SYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGI 370          

HSP 2 Score: 102.834 bits (255), Expect = 4.702e-22
Identity = 78/264 (29.55%), Postives = 111/264 (42.05%), Query Frame = 3
Query:  345 NFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRC----------------------------------GADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            + + V+  +  G N+   DK  +  IH AA  G +E++K L  A     V   D    TPLH AAS G I +++ LL+ G  +N + + +GNTPLH + + G    V  L   G   N VN   F PLH      H      L+ C                                  GA+I  +++ G+TPLH   RYGH  +   LI+   D  +R  +G   LH+AA        + L+ SG  ID  +    T L  A
Sbjct:  152 HLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLL--ASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDIN-EPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAA 412          

HSP 3 Score: 99.3673 bits (246), Expect = 6.010e-21
Identity = 67/241 (27.80%), Postives = 123/241 (51.04%), Query Frame = 3
Query:  375 AGHNLIIDKDGK---SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASID----IRNIQNETPLDVALKKSHSEIIEIL 1067
            +G +++ D D +   SP+H+AA +G  + ++ L+Q+  + +++  ++   TPL  AA  G ++ + +L+ +GA + ++D T   TP+H +A  G+S+ +  L     L + V+       TPL LAV  GH     +L+  GA + A++++G T LH G   GH      L+  +     R+  G T +H+AAA     +   L+ +  S++    + +    TPL  A    H   +E+L
Sbjct:  537 SGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQS--LLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVL 775          

HSP 4 Score: 98.9821 bits (245), Expect = 7.389e-21
Identity = 86/298 (28.86%), Postives = 139/298 (46.64%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQ-KTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSR 1286
            D + ++P+H AA  G  EI++ L+       VN  DN   TPLH+A +    + +Q+LL+  A VN +D  +  TPLH +A     +  E L  +    N+ + +  T LH A   GH +  R L+  G++I+A ++     +H     GH  V ++L S   ++  +++   T LH AA+     + K L++ G  I+  N    TPL VA       ++  L  C  + NQ     F P     +F+  SRH ++  E+  V N  +        +S + KT P     + G FSR
Sbjct:   38 DNEKRTPLHAAAYLGDAEIIELLI--LSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDK-NWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAP----LHFTAASRHGALCLELL-VCNGAD-----VNIKSKDGKT-PLHMTAIHGRFSR 321          

HSP 5 Score: 85.5001 bits (210), Expect = 1.361e-16
Identity = 74/230 (32.17%), Postives = 114/230 (49.57%), Query Frame = 3
Query:  357 VKEFIRAG-HNLIIDKDGKSPIHI--AAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVN--YSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVA 1031
            V E I  G H   +++ G +P+H   A+ +G L  L+ L+      N+ + D    TPLH  A  G+    Q ++E GA+++ +D  +GNTPLH +A  G+   +  L +  R        + +F PLHLA   G +   R L+  G DI   + FG T LH     G+     +L++   D N+++  G T LH AAA    +    LV SGAS++  + +  TPL  A
Sbjct:  255 VNELIECGAHVNQVNEKGFAPLHFTAASRHGAL-CLELLVCNGADVNIKSKDG--KTPLHMTAIHGRFSRSQAIIENGAEIDCEDK-NGNTPLHIAARYGHELLINTL-ITNRADTAKRGIHGMF-PLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYA 478          

HSP 6 Score: 78.5666 bits (192), Expect = 1.472e-14
Identity = 53/188 (28.19%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  510 DSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKT 1073
            D  PL KA      D ++ L+ +   VN QD+    TPLH +A+ G ++ +E L L G   N  +    TPLH AV     +  + L++  AD++A+++   TPLH          +  L+ + +++N  ++ G TALH AA     ++ +LL+  G++I+  + ++   +  A    H E++++L +
Sbjct:    8 DQPPLLKAIFNVDPDEVRSLIFKKEDVNAQDNEK-RTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLAS 194          

HSP 7 Score: 74.7146 bits (182), Expect = 2.371e-13
Identity = 64/239 (26.78%), Postives = 111/239 (46.44%), Query Frame = 3
Query:  390 IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGY----------SQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQ-NRFGDTPLHTGVRYGHAGVSRILISV--STDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            I D +G++P+ +A  +G  + +  LL      +V   D +  T LH+ A  G  + ++ LL+  A   ++D   G TP+H +A  G+          +Q+VE       LP L +   +TPLH A   GH+     L+       A+ N F  +PLH  V   + G + +LI     T +N ++    T LH AA     +  +LL+   A ++  +   ++PL +A +   +  +E+L
Sbjct:  648 IQDGNGQTPLMLAVLSGHTDCVYSLLNKGA--SVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRD-CRGRTPVHLAAACGHIGVLGGLLHAAQSVE------TLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPF--SPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELL 875          

HSP 8 Score: 67.781 bits (164), Expect = 3.422e-11
Identity = 67/265 (25.28%), Postives = 110/265 (41.51%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVN---IQDSTHGNTPLHESAWKGYSQTVEYL------------------CLIGR-------------LPNLVNYSLF---TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILIS-VSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQN---ETPLDVALKKSHSEIIEIL 1067
            DK G++ +H  A  G  E ++ LLQ    + V   D    TP+H AA+ G I ++  LL     V    +   +HG TPLH + + G+   VE L                  C + R              P +VN       TPLH A    H +  + L+   A ++  +  G +PL      G      +L+S    D+  ++   +TALH+A +        L++E  +  ++ N  N   +TPL VA +   + +++ L
Sbjct:  683 DKWGRTALHRGAVTGHEECMEALLQHNASFLVR--DCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQEL 945          

HSP 9 Score: 63.5438 bits (153), Expect = 7.843e-10
Identity = 51/171 (29.82%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  411 SPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLF-TPLHLAVQGGHNQTTRNLIRCGAD---ISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNG 911
            SP+H A         + L+       VN  D  + TPLH AA    ++ +Q+LL   AQVN  D+  G +PL  +A  G +  VE L    +    +  ++  T LHLA   GH  +   ++   +D   I+A N    TPLH   R G   V + L++    +   ++NG
Sbjct:  790 SPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAA-GKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENG 959          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 120.553 bits (301), Expect = 1.918e-27
Identity = 87/303 (28.71%), Postives = 158/303 (52.15%), Query Frame = 3
Query:  201 RLLLGFTRPY-AVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAG-----HNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTN 1091
            R L GFT  + A      R +  L K+S +++    + ++ L  A  + + + VK  ++ G      N+ ++    +P+H+A+  G  E+ ++LLQ     +    D  D TPLH AA +G  +++++LL+  A  +   +T G+TPLH +A +G+  T+  L   G     +    FTPLH+A + G       L+  GA+ +A  + G TPLH  V + +  V ++L+S     +   +NG T LHIAA   + ++  +L+++GAS +  ++Q  TPL +A ++   +++ +L +   N N
Sbjct:  365 RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVE----TPLHMASRAGHCEVAQFLLQNAAQVDARAKD--DQTPLHCAARMGHKELVKLLLDHKANPD-SATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVN 660          

HSP 2 Score: 115.546 bits (288), Expect = 8.238e-26
Identity = 82/280 (29.29%), Postives = 134/280 (47.86%), Query Frame = 3
Query:  231 AVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNL-IIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            A  N  +R    L +N         T  + L  A    N    +  +  G N+    K+G +P+HIA+  G + +++ LL      +  T D    TPLH AA  G + II++LLE GA +  + + +G +P+H +A   +   V  L       + +     TPLH+A   GH++  + L+  GA  +A+   G TPLH   +  H     +L+  S  +    ++G T LH+AA +    I K L++ GAS +  N++ ETPL +A +  H E+ + L
Sbjct:  178 AARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDEL--TPLHCAARNGHVRIIEILLEHGAPIQAK-TKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFL 454          

HSP 3 Score: 113.62 bits (283), Expect = 3.156e-25
Identity = 77/253 (30.43%), Postives = 122/253 (48.22%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHV 1157
            K+G +P+H+A  +  L+++K L+      +    + +  TPLH AA   QI++  +LL+ GA  N + S  G TPLH ++ +G    V  L       NL N +  TPLHL  Q GH      L++ GA + A +R G TPLH    YG+  + + L+     +N + + G T LH AA      I  LL++ GA  +       +PL +A +  +  +I++LK  +  +        PE + E   V    V
Sbjct:  565 KNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGY--TPLHIAAKQNQIEVASVLLQNGASPNCE-SLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSTHRMSFPETVDEILDVSEDEV 814          

HSP 4 Score: 104.76 bits (260), Expect = 1.533e-22
Identity = 75/232 (32.33%), Postives = 113/232 (48.71%), Query Frame = 3
Query:  417 IHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFL 1112
            +HIAA N        LLQ  P  +V +   F  TPLH AA    + + Q+LL RGA VN     +G TPLH ++ +G    V  L   G   +       TPLH A + GH +    L+  GA I A+ + G +P+H   +  H    R L+  + +I+    +  T LH+AA     ++ K+L++ GA  + R +   TPL +A KK+H   +++L   S +    T S L
Sbjct:  175 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGF--TPLHIAAHYENMSVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGL 403          

HSP 5 Score: 101.293 bits (251), Expect = 2.149e-21
Identity = 88/301 (29.24%), Postives = 137/301 (45.51%), Query Frame = 3
Query:  399 KDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQ--------------GGHNQTTRN-------------------LIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKT-VSFLP------ENLRENFSVQSRHVSIPNEMCS 1181
            KD ++P+H AA  G  E++K LL      N ++      TPLH AA  G I  I++LL+ GAQ  ++ +  G TPLH ++  G     E L   G  PN    +  TPLH+AV               G  + T RN                   L++ GA  + ++  G TPLH   + G   +  +LIS   ++N  N+NG T LH+ A      I   LV+ GAS+   +    TPL VA    + ++++ L     + N KT + + P      +   +  ++  +H ++PNE+ S
Sbjct:  466 KDDQTPLHCAARMGHKELVKLLLDH--KANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQ-QVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITS 763          

HSP 6 Score: 72.7886 bits (177), Expect = 1.106e-12
Identity = 67/256 (26.17%), Postives = 110/256 (42.97%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTD---------INQRNQN--------------------GDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            L +  D  +    AA +G L+  K L       N+N  +      LH A+  G + ++  LL  G ++    +  GNT LH +A  G  + V  L   G   N  ++  F+PL++A Q  H +  + L+  GA+ S     G TPL   ++ GH  V  +LI+  T          I  RN +                    G T LHIAA  +   + +LL+  GA+++       TPL +A ++ +  ++ +L
Sbjct:    4 LFLQADAATSFLRAARSGNLD--KALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELE-ATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLL 256          

HSP 7 Score: 62.3882 bits (150), Expect = 1.658e-9
Identity = 38/118 (32.20%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGH 749
            +K+G +P+H+ A+ G + I   L++     +V        TPLH A   G I +++ LL++ A VN + +  G TPLH++A +G++  V  L   G LPN +  +  +PL +A + G+
Sbjct:  663 NKNGLTPLHLVAQEGHVGIADTLVKQGA--SVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAK-TRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGY 777          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 1322.76 bits (3422), Expect = 0.000e+0
Identity = 670/671 (99.85%), Postives = 670/671 (99.85%), Query Frame = 3
Query:  153 MDNTDVFTSEDDGIGRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRXXXXXXXXXXXXXXXSKENPKPLPAQTAASKSILCXXXXXXXXXXXXXVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV 2165
            MDNTDVFTSEDDGI RRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRKKKEKVDKTEKNQKKSKENPKPLPAQTAASKSILCNNISRRNSNFNSSVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV
Sbjct:    1 MDNTDVFTSEDDGINRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRKKKEKVDKTEKNQKKSKENPKPLPAQTAASKSILCNNISRRNSNFNSSVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV 671          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 1311.59 bits (3393), Expect = 0.000e+0
Identity = 667/671 (99.40%), Postives = 668/671 (99.55%), Query Frame = 3
Query:  153 MDNTDVFTSEDDGIGRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRXXXXXXXXXXXXXXXSKENPKPLPAQTAASKSILCXXXXXXXXXXXXXVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV 2165
            MDNTDVFTSEDDGI RRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRKKKEKVDKTEKNQKKSKENPKPLPAQTAASKSILCNNISRRNSNFNSSVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPK+  ESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV
Sbjct:    1 MDNTDVFTSEDDGINRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRKKKEKVDKTEKNQKKSKENPKPLPAQTAASKSILCNNISRRNSNFNSSVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKE--ESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV 669          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 1124 bits (2906), Expect = 0.000e+0
Identity = 593/673 (88.11%), Postives = 606/673 (90.04%), Query Frame = 3
Query:  153 MDNTDVFTSEDDGIGRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD-STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVN-YSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRXXXXXXXXXXXXXXXSKENPKPLPAQTAASKSILCXXXXXXXXXXXXXVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV 2165
            MDNTDVFTSEDDGI RRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHI                                   AA  GQ++I++ LL+     N+       +TPLH++A  G    ++ L   G   N+ +  SLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRKKKEKVDKTEKNQKKSKENPKPLPAQTAASKSILCNNISRRNSNFNSSVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV
Sbjct:    1 MDNTDVFTSEDDGINRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSIHTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHI-----------------------------------AAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQKPYRAKSESPNEKTKPSKKNIVKGIFSRKKKEKVDKTEKNQKKSKENPKPLPAQTAASKSILCNNISRRNSNFNSSVKQDSPLTKVTPVPGMMNMYQPRLGSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMDHGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDESLNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKLESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRYKVDWRAGKYRPDKIILPPSKV 638          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000017135.1 (SMESG000017135.1)

HSP 1 Score: 112.464 bits (280), Expect = 8.825e-28
Identity = 64/226 (28.32%), Postives = 111/226 (49.12%), Query Frame = 3
Query:  393 IDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILK 1070
            +DK  K PIH A E   LEI K L++     N+   D  +  P+H A S G  +I+ +L +    + +Q++     P+H +   G+ + ++ L       N VN    +P++ A   GH +  + LI    D  A ++    P+H   R GH  ++++LI    DI   ++     +H A A     I KLL++    I+ RN   E P+D+A +K+  +I+++L+
Sbjct:    1 MDKCNKRPIHFACEKDHLEIAKVLIE--KKCNIEAWDINNLRPIHLACSYGHAEIVTLLFDAKCNIEVQENIGLLRPIHFACNNGHLEIMKLLIAQKCDINAVNKCFRSPVYFACSKGHLEIVKLLIDQNCDTEAVDKDNSKPIHQACRQGHLNITKLLIDHKCDIEAVDKCNRRPIHFACAQGHFDIVKLLIDQNCDIEARNKWEERPIDIAKRKNQVKIVQLLE 224          

HSP 2 Score: 63.929 bits (154), Expect = 4.848e-11
Identity = 38/157 (24.20%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  414 PIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVST 884
            PIH A  NG LEI+K L+      ++N  +    +P++ A S G ++I+++L+++       D    + P+H++  +G+    + L         V+     P+H A   GH    + LI    DI A+N++ + P+    R     + ++L  + +
Sbjct:   75 PIHFACNNGHLEIMKLLIA--QKCDINAVNKCFRSPVYFACSKGHLEIVKLLIDQNCDTEAVDKD-NSKPIHQACRQGHLNITKLLIDHKCDIEAVDKCNRRPIHFACAQGHFDIVKLLIDQNCDIEARNKWEERPIDIAKRKNQVKIVQLLEKIKS 228          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000010549.1 (SMESG000010549.1)

HSP 1 Score: 116.316 bits (290), Expect = 2.086e-26
Identity = 62/227 (27.31%), Postives = 120/227 (52.86%), Query Frame = 3
Query:  387 LIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            ++ D DG+ PIH+A  +G + + K LL      N+   D     P+H A+  G  +I+++LL+R      +D + GN P+H ++W+G+S+ V+ L          N S   P+H A   GH++  + L+    +   +++ G  P+H   R GH+ + ++L+  + +     ++G+  +H A+   R +I KLL++   + +  +   E P+ VA +  H+EI+++L
Sbjct:   20 IVDDYDGEFPIHVACRSGFVAVAKLLLD--RNCNIECKDKSGERPIHVASWKGDSEIVKLLLDRNCNTECEDKS-GNRPIHWASWQGHSEIVKLLLDRNCNTECENESGMRPIHCASWQGHSEIVKLLLDRNCNTECEDKSGWRPIHWASRQGHSEIVKLLLDRNCNTECETKSGERPIHCASGRGRSEIVKLLLDRNCNTECEDKSGERPIHVASRNGHTEIVKLL 243          

HSP 2 Score: 106.301 bits (264), Expect = 2.889e-23
Identity = 62/226 (27.43%), Postives = 119/226 (52.65%), Query Frame = 3
Query:  396 DKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTP--DNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 1067
            DK G+ PIH+A+  G  EI+K LL      N NT   D   + P+H A+  G  +I+++LL+R      ++ + G  P+H ++W+G+S+ V+ L          + S + P+H A + GH++  + L+    +   + + G+ P+H     G + + ++L+  + +    +++G+  +H+A+     +I KLL+E    ID +     TPLD+A   +  + +E+L
Sbjct:   56 DKSGERPIHVASWKGDSEIVKLLLD----RNCNTECEDKSGNRPIHWASWQGHSEIVKLLLDRNCNTECENES-GMRPIHCASWQGHSEIVKLLLDRNCNTECEDKSGWRPIHWASRQGHSEIVKLLLDRNCNTECETKSGERPIHCASGRGRSEIVKLLLDRNCNTECEDKSGERPIHVASRNGHTEIVKLLLERKCRIDSKTKDGRTPLDIAKAGNRKDCMELL 276          

HSP 3 Score: 63.5438 bits (153), Expect = 5.044e-10
Identity = 42/203 (20.69%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  501 DNFDST-PLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEILKTCSPNTNQKTVS 1106
            D++D   P+H A   G + + ++LL+R   +  +D + G  P+H ++WK                                 G ++  + L+    +   +++ G+ P+H     GH+ + ++L+  + +    N++G   +H A+     +I KLL++   + +  +     P+  A ++ HSEI+++L   + NT  +T S
Sbjct:   22 DDYDGEFPIHVACRSGFVAVAKLLLDRNCNIECKDKS-GERPIHVASWK---------------------------------GDSEIVKLLLDRNCNTECEDKSGNRPIHWASWQGHSEIVKLLLDRNCNTECENESGMRPIHCASWQGHSEIVKLLLDRNCNTECEDKSGWRPIHWASRQGHSEIVKLLLDRNCNTECETKS 190          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD62.595e-4636.22ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HG... [more]
ANKRD66.192e-4534.51ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HG... [more]
ANKRD66.192e-4534.51ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HG... [more]
ANKRD66.690e-4534.51ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HG... [more]
ANKRD64.906e-4436.55ankyrin repeat domain 6 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-442.910e-2728.48AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.910e-2728.48AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.107e-2728.48AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.107e-2728.48AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.470e-2728.48AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgo1.023e-4338.84gene:FBgn0086898 transcript:FBtr0088249[more]
dgo1.023e-4338.84gene:FBgn0086898 transcript:FBtr0088250[more]
Ank23.123e-3032.19gene:FBgn0261788 transcript:FBtr0303118[more]
Ank23.391e-3031.97gene:FBgn0261788 transcript:FBtr0303119[more]
Ank23.797e-3032.19gene:FBgn0261788 transcript:FBtr0334060[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd6b3.338e-4936.01ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd6b2.625e-4835.69ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE... [more]
BX469921.18.679e-2934.51ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a1.576e-2834.51ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ankrd28b2.204e-2831.38ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd61.968e-4534.86ankyrin repeat domain 6 [Source:NCBI gene;Acc:1001... [more]
ankrd62.095e-4534.86ankyrin repeat domain 6 [Source:NCBI gene;Acc:1001... [more]
ankrd61.818e-4436.55ankyrin repeat domain 6 [Source:NCBI gene;Acc:1001... [more]
ankrd63.180e-4436.55ankyrin repeat domain 6 [Source:NCBI gene;Acc:1001... [more]
rev12.727e-2930.96REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd62.614e-4436.95ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI... [more]
Ankrd62.614e-4436.95ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI... [more]
Ankrd62.614e-4436.95ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI... [more]
Ankrd63.918e-4436.95ankyrin repeat domain 6 [Source:MGI Symbol;Acc:MGI... [more]
Ankrd282.741e-3032.22ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y2G4|ANKR6_HUMAN2.974e-4434.51Ankyrin repeat domain-containing protein 6 OS=Homo... [more]
sp|Q69ZU8|ANKR6_MOUSE1.829e-4336.95Ankyrin repeat domain-containing protein 6 OS=Mus ... [more]
sp|Q54KA7|SECG_DICDI1.171e-3530.97Ankyrin repeat, PH and SEC7 domain containing prot... [more]
sp|Q505D1|ANR28_MOUSE2.146e-2932.22Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|O15084|ANR28_HUMAN5.452e-2932.22Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F2WMR24.310e-8878.53Diversin (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A1S3HDS31.429e-6548.78trithorax group protein osa isoform X4 OS=Lingula ... [more]
A0A1S3HDR81.665e-6548.78trithorax group protein osa isoform X3 OS=Lingula ... [more]
A0A1S3HB531.705e-6548.78trithorax group protein osa isoform X2 OS=Lingula ... [more]
A0A1S3HB211.766e-6548.78trithorax group protein osa isoform X1 OS=Lingula ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd6b4.939e-4836.52ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd6a7.537e-3738.36ankyrin repeat domain 6a [Source:ZFIN;Acc:ZDB-GENE... [more]
ank3a1.083e-2834.39ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.955e-2834.39ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a2.082e-2834.39ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd6b2.535e-3934.39ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000000093.16.914e-2933.33pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007449.11.853e-2632.63pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.12.627e-2632.63pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000003991.12.324e-2528.87pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAS62.250e-1325.94Evolutionarily conserved 19S regulatory particle a... [more]
AVO26.667e-1229.10Component of a complex containing the Tor2p kinase... [more]
AKR11.492e-1029.95Palmitoyl transferase involved in protein palmitoy... [more]
GDE15.379e-1026.91Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
HOS45.859e-934.26Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494851.303e-2029.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391136.673e-1926.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387259.427e-1929.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281783.782e-1631.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308891.399e-1430.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd6b3.351e-4434.65ankyrin repeat domain 6 [Source:NCBI gene;Acc:1011... [more]
ankrd28b2.541e-2831.38ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b4.273e-2831.38ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b5.259e-2831.38ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ank1b1.918e-2728.71ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063648.10.000e+099.85SMESG000063648.1[more]
SMESG000063648.10.000e+099.40SMESG000063648.1[more]
SMESG000063648.10.000e+088.11SMESG000063648.1[more]
SMESG000017135.18.825e-2828.32SMESG000017135.1[more]
SMESG000010549.12.086e-2627.31SMESG000010549.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015069 ID=SMED30015069|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2307bp
TGTGCACCAGTAGCTACTTATTAGTGTTGTCAACTGCACAGCTATGTCAA
TAGATCACTGTGATCTGACAGAGATAGTATCACATAGTTATTCTATTCTG
AGATCGAATTTCTGATGGATATTGAATCAACTTCGTGATTTAATCATTTT
TAATGGATAATACTGATGTGTTCACGAGTGAAGATGATGGCATCGGCCGA
CGGCTACTGCTTGGATTCACGAGACCATATGCTGTCCCGAATACTCCAAG
CCGGAAAATACAGTCATTGAGGAAAAATTCAAAAACAATGAAAACCTCAA
TCCACACAAACGTTTCGAATCTTATTGATGCGGTTTCCATTAATAATTTC
GACAAAGTCAAAGAATTTATTCGGGCTGGGCATAACTTAATTATTGATAA
AGATGGAAAATCACCCATTCATATTGCAGCAGAAAATGGACAGCTCGAGA
TTCTGAAATATCTCCTTCAGGCATTTCCTATGTACAATGTTAATACACCA
GACAATTTTGATAGCACTCCTCTACATAAGGCGGCAAGCATTGGGCAAAT
TGATATAATACAAATGCTACTCGAGAGAGGTGCCCAAGTCAATATCCAGG
ATTCAACGCATGGTAATACTCCGTTGCATGAATCCGCATGGAAAGGCTAT
TCTCAAACTGTTGAATACCTTTGTCTAATAGGCAGGCTCCCTAACCTTGT
AAATTATTCTCTTTTTACTCCTCTTCATCTCGCTGTTCAAGGTGGACACA
ATCAGACTACTCGCAATTTGATAAGGTGTGGAGCTGATATTTCAGCCCAA
AATAGGTTTGGTGACACTCCATTGCATACCGGCGTTCGATACGGCCATGC
TGGAGTATCAAGAATACTGATCTCTGTCAGTACAGACATCAATCAACGAA
ATCAAAATGGAGACACCGCTTTACATATAGCCGCCGCTTTAAAGAGACGA
AAAATCACTAAATTGCTTGTTGAGTCTGGCGCAAGCATTGACATAAGAAA
CATTCAAAATGAAACACCTTTGGATGTTGCATTGAAAAAATCTCATTCCG
AAATCATAGAAATATTGAAAACATGCAGTCCAAATACAAATCAAAAAACT
GTCTCATTTCTTCCTGAAAATTTAAGAGAGAATTTCTCTGTGCAATCTCG
CCACGTTTCTATACCGAATGAAATGTGCAGTGTAATAAATAATCCCGAAC
AAAAGCCTTACCGGGCGAAATCTGAATCCCCAAATGAAAAAACTAAACCG
TCAAAGAAGAACATTGTTAAAGGTATTTTTAGTCGAAAGAAAAAGGAAAA
AGTGGACAAAACTGAAAAAAACCAAAAGAAATCAAAAGAAAATCCCAAGC
CACTTCCGGCACAGACCGCAGCCAGTAAATCAATATTATGCAACAATATC
AGTCGACGCAATTCCAATTTCAATTCCAGCGTCAAACAAGACTCCCCACT
AACAAAAGTGACTCCAGTCCCAGGTATGATGAATATGTATCAACCTCGTT
TAGGAAGTCAACTTTTCAAAGATCTTGCGGGAAACATAAAGCAGGGACCC
ATCGGGTACATGCCCATAGCCAACAATTCCACCTGCAACTGCTCACAGAA
TCACAACAAGAGATTGACCAACCAATTCTATCCGTCGAATGTTTGCATGG
ACCATGGATACATTGACTATCACGGCTCATTAAATCACACATCAAACAAA
CCGTCCAATGATGGACCGTTTCTCTCAAGAAATCCGGAAAAGTCGAAAGA
AAATTTTGATTCAGCAGGATATAGTCTAATTCGATCCAAATCAGACGAAT
CTTTGAATCAGTCAGAACATAAATCAAGAATGCAAGAGGAACGATTAAAA
CAAAATTACATGAAAAACTCCCCAGTCAAAGGTAGAAAACAAAATATTGA
TAACTCGAATTGGAATTTCCGACAGAATTCGCTAATTAGACCTGCCAAAC
TCGAGTCTAATCAAAATAAAATTTCAGTCCAAGTTGCACAGAAACCAAAA
GATTTTAGGGAATCTAAAGACATTATACGAAATATGATGCGTCCAAGTCC
GGATGGTCAGACAGACTCAATTACCACGCCGATTTCAGAGTATCCTAGGT
ATAAAGTAGATTGGAGAGCGGGAAAGTATCGACCTGATAAAATTATTTTA
CCTCCTAGTAAAGTGTGAAGATTTTTTATTTACATATTTTGTACAAAATT
TGTGATTTATATATTGTCGTTTAGATAAATATGAATATTTACTCCGTTAG
TCATTTTTACAGAATGTTGAATTTGTTTTATGAATAGGTTGAATGAGGTA
GTTTCGA
back to top

protein sequence of SMED30015069-orf-1

>SMED30015069-orf-1 ID=SMED30015069-orf-1|Name=SMED30015069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=672bp
MDNTDVFTSEDDGIGRRLLLGFTRPYAVPNTPSRKIQSLRKNSKTMKTSI
HTNVSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEI
LKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQD
STHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHN
QTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRN
QNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSE
IIEILKTCSPNTNQKTVSFLPENLRENFSVQSRHVSIPNEMCSVINNPEQ
KPYRAKSESPNEKTKPSKKNIVKGIFSRKKKEKVDKTEKNQKKSKENPKP
LPAQTAASKSILCNNISRRNSNFNSSVKQDSPLTKVTPVPGMMNMYQPRL
GSQLFKDLAGNIKQGPIGYMPIANNSTCNCSQNHNKRLTNQFYPSNVCMD
HGYIDYHGSLNHTSNKPSNDGPFLSRNPEKSKENFDSAGYSLIRSKSDES
LNQSEHKSRMQEERLKQNYMKNSPVKGRKQNIDNSNWNFRQNSLIRPAKL
ESNQNKISVQVAQKPKDFRESKDIIRNMMRPSPDGQTDSITTPISEYPRY
KVDWRAGKYRPDKIILPPSKV*
back to top
Aliases
The feature 'ANK_REP_REGION domain-containing protein' has the following synonyms
Synonym
diversin
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0043231intracellular membrane-bounded organelle
Vocabulary: biological process
TermDefinition
GO:0046330positive regulation of JNK cascade
GO:0090090negative regulation of canonical Wnt signaling pathway
GO:2000096positive regulation of Wnt signaling pathway, planar cell polarity pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 85..100
score: 37.23
coord: 135..149
score: 36.19
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 52..81
e-value: 4000.0
score: 0.5
coord: 84..115
e-value: 5.9E-5
score: 32.5
coord: 153..182
e-value: 0.15
score: 21.1
coord: 252..281
e-value: 4.8E-4
score: 29.4
coord: 219..248
e-value: 0.21
score: 20.7
coord: 186..215
e-value: 0.0044
score: 26.2
coord: 119..148
e-value: 7.5E-5
score: 32.1
coord: 285..314
e-value: 13.0
score: 14.7
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 119..151
score: 14.265
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 186..218
score: 12.155
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 219..251
score: 11.461
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 84..106
score: 11.167
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 252..284
score: 12.93
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 191..283
e-value: 3.1E-15
score: 56.5
coord: 57..150
e-value: 1.1E-16
score: 61.2
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 84..317
score: 66.85
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 33..336
e-value: 1.2E-72
score: 246.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 57..307
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 355..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 543..562
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 341..407
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 377..396
NoneNo IPR availablePANTHERPTHR24198ANKYRIN REPEAT AND PROTEIN KINASE DOMAIN-CONTAINING PROTEINcoord: 188..304
NoneNo IPR availablePANTHERPTHR24198:SF168coord: 58..174
NoneNo IPR availablePANTHERPTHR24198ANKYRIN REPEAT AND PROTEIN KINASE DOMAIN-CONTAINING PROTEINcoord: 58..174
coord: 111..229
NoneNo IPR availablePANTHERPTHR24198:SF168coord: 111..229
coord: 188..304