bicaudal-C protein

Overview
Namebicaudal-C protein (ADK78219.1)
Smed IDSMED30015067
Length (bp)2627
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of bicaudal-C protein (SMED30015067) t-SNE clustered cells

Violin plots show distribution of expression levels for bicaudal-C protein (SMED30015067) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015067

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30015067SMESG000018259.1 dd_Smed_v4_38827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015067SMESG000018259.1 dd_Smed_v6_38277_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
ovarySMED30015067SMESG000018259.1 PL06009B1G02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30015067SMESG000018259.1 PL06009B1G02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30015067SMESG000018259.1 PL06009B1G02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30015067SMESG000018259.1 PL06009B1G02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30015067SMESG000018259.1 SMED_20902_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30015067SMESG000018259.1 SMED_20902_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of bicaudal-C protein vs. Ensembl Human
Match: BICC1 (BicC family RNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:19351])

HSP 1 Score: 210.305 bits (534), Expect = 8.844e-56
Identity = 118/313 (37.70%), Postives = 183/313 (58.47%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       +   +   +  + +   +++S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  +  I Q T A I+FPD            +NP       KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + ++   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L  L +
Sbjct:  129 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPVPDPNSPSIQHISQTYNISVSFKQRSRMY-GATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSN--IKHIMQRTGAQIHFPD-----------PSNPQ------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLES 419          

HSP 2 Score: 70.0922 bits (170), Expect = 1.374e-11
Identity = 27/62 (43.55%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+++  N +
Sbjct:  877 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRR 938          
BLAST of bicaudal-C protein vs. Ensembl Human
Match: ANKS6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:HGNC Symbol;Acc:HGNC:26724])

HSP 1 Score: 53.1434 bits (126), Expect = 1.284e-6
Identity = 21/58 (36.21%), Postives = 38/58 (65.52%), Query Frame = 3
Query: 2109 ENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            + +  +L  L L ++   F + EVD   F +LT+ DLKELG+ T G+R++++ AI+++
Sbjct:  246 DELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISEL 303          
BLAST of bicaudal-C protein vs. Ensembl Human
Match: ANKS6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:HGNC Symbol;Acc:HGNC:26724])

HSP 1 Score: 52.7582 bits (125), Expect = 2.655e-6
Identity = 21/58 (36.21%), Postives = 38/58 (65.52%), Query Frame = 3
Query: 2109 ENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            + +  +L  L L ++   F + EVD   F +LT+ DLKELG+ T G+R++++ AI+++
Sbjct:  475 DELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISEL 532          
BLAST of bicaudal-C protein vs. Ensembl Human
Match: ANKS6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:HGNC Symbol;Acc:HGNC:26724])

HSP 1 Score: 51.9878 bits (123), Expect = 5.391e-6
Identity = 21/58 (36.21%), Postives = 38/58 (65.52%), Query Frame = 3
Query: 2109 ENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            + +  +L  L L ++   F + EVD   F +LT+ DLKELG+ T G+R++++ AI+++
Sbjct:  776 DELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISEL 833          
BLAST of bicaudal-C protein vs. Ensembl Celegans
Match: bcc-1 (BiCaudal C (Drosophila) homolog [Source:UniProtKB/TrEMBL;Acc:Q21593])

HSP 1 Score: 89.7373 bits (221), Expect = 3.051e-18
Identity = 95/376 (25.27%), Postives = 170/376 (45.21%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAA---NNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVI---IRTTEQNVNALFEVKNILNKL-RTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSE 1340
            + +RV++K+++ ++ HSH+IGKGG+ I+ +M  T CHIHFPDSN+ +   KS+QVSISG    V  A + +R++ PL     +P+  +N  +   R LM+Q+   L+V++         +  ++ +K    +    + A+ L+L HHF         ++T E         LN   Q         L R  +N+           L      N + I    +  +++I+G        R+ LIG   V + +D          M ++++  ++ +    I++  K+    ++   +++TE  +  + + + +L  L  T Y  P      P     M++  S LT L +E  SGV         PP++  K  D E
Sbjct:  100 KKERVSLKMELHHSLHSHIIGKGGRGIQKVMKMTSCHIHFPDSNKYSDSNKSDQVSISGTPVNVFEALKHLRSMCPLTVYMKLPW--YNPGQPDLRPLMSQMD--LDVSVEQ-------NIYSLAIKMTGSQDASVLFAIRLVL-HHF---------LLTEE--------YLNISTQ--------VLAREELNYQLENVEEHRERLREVCNKNNVTIQTFPETQSISIVGPPSGVLNVRKLLIGLSSVTVQFDCN--------MMDIHYPVQQLEQERGIQVTCKRKNGDIMTITMKSTESKLAEVLQSRELLLALPPTTYSSPDDYDPNP----VMSRPPS-LTPLQTEMASGVRVF----LTPPIESPKSPDPE 421          
BLAST of bicaudal-C protein vs. Ensembl Fly
Match: BicC (gene:FBgn0000182 transcript:FBtr0080805)

HSP 1 Score: 177.563 bits (449), Expect = 7.649e-46
Identity = 116/333 (34.83%), Postives = 182/333 (54.65%), Query Frame = 3
Query:  231 NQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIE---QQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSW 1220
            ++  RV MK+DVSYTDHS++IG+GG +IK IM DT  HIHFPDSNR+N  EKSNQVS+ G   GVE AR  +R   PL+ SF++P    N  +   +   + M + +  ++V  S +P    L  + + VKG  + + Q   A  L++N        Q+ V + +EI P+HH  +  +G  N  +  I + T+  I FPD +             M +  L KKS V I G  ++ + ARQQL+G LPV L++D         E+ +L   N +Y V I+++ K +Q T +++++  E+ ++ ++E +  + +L T +       VKP IP +
Sbjct:   48 SRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIFSTRP---KLHTSLVLVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIV--KGKNNVNLLSIMERTQTKIIFPDLS------------DMNVKPL-KKSQVTISGRIDDVYLARQQLLGNLPVALIFDFPDNHNDASEIMSL---NTKYGVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEILRLATPF-------VKPEIPDY 352          

HSP 2 Score: 65.0846 bits (157), Expect = 2.554e-10
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 3
Query: 2058 FDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSN 2291
             D    N + + AK+  +++  +LTSL L  +   F+ NE+D   F +LTEE+L ELG+  FGAR+KL+ AI+ + +N
Sbjct:  673 LDATPVNRRMQLAKH--KDIQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLAN 748          
BLAST of bicaudal-C protein vs. Ensembl Fly
Match: BicC (gene:FBgn0000182 transcript:FBtr0080804)

HSP 1 Score: 177.948 bits (450), Expect = 1.054e-45
Identity = 116/333 (34.83%), Postives = 182/333 (54.65%), Query Frame = 3
Query:  231 NQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIE---QQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSW 1220
            ++  RV MK+DVSYTDHS++IG+GG +IK IM DT  HIHFPDSNR+N  EKSNQVS+ G   GVE AR  +R   PL+ SF++P    N  +   +   + M + +  ++V  S +P    L  + + VKG  + + Q   A  L++N        Q+ V + +EI P+HH  +  +G  N  +  I + T+  I FPD +             M +  L KKS V I G  ++ + ARQQL+G LPV L++D         E+ +L   N +Y V I+++ K +Q T +++++  E+ ++ ++E +  + +L T +       VKP IP +
Sbjct:  168 SRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIFSTRP---KLHTSLVLVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIV--KGKNNVNLLSIMERTQTKIIFPDLS------------DMNVKPL-KKSQVTISGRIDDVYLARQQLLGNLPVALIFDFPDNHNDASEIMSL---NTKYGVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEILRLATPF-------VKPEIPDY 472          

HSP 2 Score: 64.6994 bits (156), Expect = 3.257e-10
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 3
Query: 2058 FDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSN 2291
             D    N + + AK+  +++  +LTSL L  +   F+ NE+D   F +LTEE+L ELG+  FGAR+KL+ AI+ + +N
Sbjct:  793 LDATPVNRRMQLAKH--KDIQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLAN 868          
BLAST of bicaudal-C protein vs. Ensembl Fly
Match: BicC (gene:FBgn0000182 transcript:FBtr0080803)

HSP 1 Score: 177.948 bits (450), Expect = 1.054e-45
Identity = 116/333 (34.83%), Postives = 182/333 (54.65%), Query Frame = 3
Query:  231 NQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIE---QQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSW 1220
            ++  RV MK+DVSYTDHS++IG+GG +IK IM DT  HIHFPDSNR+N  EKSNQVS+ G   GVE AR  +R   PL+ SF++P    N  +   +   + M + +  ++V  S +P    L  + + VKG  + + Q   A  L++N        Q+ V + +EI P+HH  +  +G  N  +  I + T+  I FPD +             M +  L KKS V I G  ++ + ARQQL+G LPV L++D         E+ +L   N +Y V I+++ K +Q T +++++  E+ ++ ++E +  + +L T +       VKP IP +
Sbjct:  168 SRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIFSTRP---KLHTSLVLVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIV--KGKNNVNLLSIMERTQTKIIFPDLS------------DMNVKPL-KKSQVTISGRIDDVYLARQQLLGNLPVALIFDFPDNHNDASEIMSL---NTKYGVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEILRLATPF-------VKPEIPDY 472          

HSP 2 Score: 64.6994 bits (156), Expect = 3.257e-10
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 3
Query: 2058 FDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSN 2291
             D    N + + AK+  +++  +LTSL L  +   F+ NE+D   F +LTEE+L ELG+  FGAR+KL+ AI+ + +N
Sbjct:  793 LDATPVNRRMQLAKH--KDIQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLAN 868          
BLAST of bicaudal-C protein vs. Ensembl Zebrafish
Match: bicc1a (BicC family RNA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-101223-3])

HSP 1 Score: 202.216 bits (513), Expect = 1.317e-55
Identity = 122/309 (39.48%), Postives = 182/309 (58.90%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQD--RLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            ++ RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR +  EKSNQVSI+G   GVE AR KIR +LPL+  F+       V++  D    ++  +     V+IS++P  +L  G T  V+     +    +   L+L H  G     V V   ++I P+HH FLL + G N  +  I Q T A I+FP+ +  +++A               +S V I G+ +    ARQQ++G LP++L++DI  E  V  ++  +  + E+ DV ISIK K KQ +KSVI+++ E+N  +L+EV+ IL
Sbjct:  127 KSHRVTLKMDVSHTEHSHVIGKGGHNIKRVMEETGCHIHFPDSNRHSQAEKSNQVSIAGQLTGVEAARVKIRELLPLVLMFECS----GVVQLVDCSSPVVQHISHTYNVSISFRPPSRLY-GNTAIVRANQNNSSGVKRGTALLLEHLAGSLASSVMVSTQLDIAPQHHHFLLGRNGAN--IKLISQRTGAHIHFPEISPHNSNA--------------SRSAVYIQGSIDAVCAARQQIMGCLPLVLLFDIKEETEVASQV--ITTLMEQLDVFISIKPKPKQPSKSVIVKSVERNAGSLYEVRRIL 412          
BLAST of bicaudal-C protein vs. Ensembl Zebrafish
Match: bicc1a (BicC family RNA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-101223-3])

HSP 1 Score: 204.142 bits (518), Expect = 4.403e-54
Identity = 122/309 (39.48%), Postives = 182/309 (58.90%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQD--RLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            ++ RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR +  EKSNQVSI+G   GVE AR KIR +LPL+  F+       V++  D    ++  +     V+IS++P  +L  G T  V+     +    +   L+L H  G     V V   ++I P+HH FLL + G N  +  I Q T A I+FP+ +  +++A               +S V I G+ +    ARQQ++G LP++L++DI  E  V  ++  +  + E+ DV ISIK K KQ +KSVI+++ E+N  +L+EV+ IL
Sbjct:  127 KSHRVTLKMDVSHTEHSHVIGKGGHNIKRVMEETGCHIHFPDSNRHSQAEKSNQVSIAGQLTGVEAARVKIRELLPLVLMFECS----GVVQLVDCSSPVVQHISHTYNVSISFRPPSRLY-GNTAIVRANQNNSSGVKRGTALLLEHLAGSLASSVMVSTQLDIAPQHHHFLLGRNGAN--IKLISQRTGAHIHFPEISPHNSNA--------------SRSAVYIQGSIDAVCAARQQIMGCLPLVLLFDIKEETEVASQV--ITTLMEQLDVFISIKPKPKQPSKSVIVKSVERNAGSLYEVRRIL 412          

HSP 2 Score: 66.2402 bits (160), Expect = 1.328e-10
Identity = 26/62 (41.94%), Postives = 45/62 (72.58%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT+ DLKELG+ TFGARRK++LAI+++  + +
Sbjct:  858 DLPELFSKLGLGKYTDIFQQQEIDLQTFITLTDPDLKELGITTFGARRKMLLAISELNKSRR 919          
BLAST of bicaudal-C protein vs. Ensembl Zebrafish
Match: bicc2 (bicaudal C homolog 2 [Source:ZFIN;Acc:ZDB-GENE-110110-3])

HSP 1 Score: 183.341 bits (464), Expect = 1.906e-47
Identity = 112/307 (36.48%), Postives = 172/307 (56.03%), Query Frame = 3
Query:  240 DRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTI-EKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPF-NVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            ++VT+K+DV++T+HSHVIGKGG +IK +M +T CHIHFPDSNR+N+  EKSNQVSI+G   GVE AR++IR + PL+ +FD+P T    V+      ++  + +   VT+S++   KL   +T  V+G+        KA+ +++    G  ++ V V   +++  + H FLL Q G N L   +   T   I  PD            ++P     L       I GTA+    ARQQL+  LPV LM+D+  E  ++   F     N    V IS+K K+KQ  KSV+++  E+N+  ++E + +L
Sbjct:  135 NKVTLKMDVTHTEHSHVIGKGGGNIKKVMEETSCHIHFPDSNRSNSSGEKSNQVSIAGPVEGVESARKQIRDLQPLVLTFDLPVTLVGGVVADTSSPVIQHVAQAFGVTVSFRTQPKLYC-STCSVRGVTANTAALKKAICVLMELLLGSGVNGVMVSTQLDVTSQQHLFLLGQNGANFLT--VMHQTHTQIILPD-----------LSSPQHTPSLL------IQGTADGVCLARQQLMDCLPVCLMFDLKDEGELDPRRFTQMMQN--LGVFISVKPKVKQTAKSVVVKGLERNIVNVYEARRLL 419          

HSP 2 Score: 75.485 bits (184), Expect = 2.263e-13
Identity = 30/65 (46.15%), Postives = 51/65 (78.46%), Query Frame = 3
Query: 2106 SENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKI 2300
            +++++++L  L L ++ D F + E+D+ TF +L++EDLKE+GV+TFGARRK++LAI D++   KI
Sbjct:  751 ADDLIELLAQLGLEKYIDIFQQQEIDYQTFLTLSDEDLKEVGVSTFGARRKMLLAIADLSKKRKI 815          
BLAST of bicaudal-C protein vs. Ensembl Zebrafish
Match: bicc1b (BicC family RNA binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-080522-3])

HSP 1 Score: 71.2478 bits (173), Expect = 2.696e-12
Identity = 27/62 (43.55%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+++  N +
Sbjct:  484 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRR 545          
BLAST of bicaudal-C protein vs. Ensembl Xenopus
Match: BICC1 (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:733856])

HSP 1 Score: 217.238 bits (552), Expect = 2.113e-58
Identity = 122/308 (39.61%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       I   +   + Q+ +   +T+S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  +  I Q T A I+FPD            NNP+      KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + +E   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L
Sbjct:   87 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPIPDPNSPTIQQISQTYNITVSFKQRSRVY-GATVIVRGSQNNTSAVKEGTAMLLEHLAGSLATAIPVSTQLDIAAQHHLFMMGRNGCN--IKHIMQRTGAQIHFPD-----------PNNPL------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEEIEVEPQCITQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCL 372          

HSP 2 Score: 65.4698 bits (158), Expect = 3.103e-10
Identity = 26/55 (47.27%), Postives = 42/55 (76.36%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAIN 2276
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+
Sbjct:  820 DLPELFSKLGLGKYTDIFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAIS 874          
BLAST of bicaudal-C protein vs. Ensembl Xenopus
Match: BICC1 (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:733856])

HSP 1 Score: 216.853 bits (551), Expect = 2.180e-58
Identity = 122/308 (39.61%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       I   +   + Q+ +   +T+S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  +  I Q T A I+FPD            NNP+      KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + +E   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L
Sbjct:   49 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPIPDPNSPTIQQISQTYNITVSFKQRSRVY-GATVIVRGSQNNTSAVKEGTAMLLEHLAGSLATAIPVSTQLDIAAQHHLFMMGRNGCN--IKHIMQRTGAQIHFPD-----------PNNPL------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEEIEVEPQCITQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCL 334          

HSP 2 Score: 68.9366 bits (167), Expect = 2.673e-11
Identity = 27/62 (43.55%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+++  N +
Sbjct:  795 DLPELFSKLGLGKYTDIFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRR 856          
BLAST of bicaudal-C protein vs. Ensembl Xenopus
Match: BICC1 (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:733856])

HSP 1 Score: 216.853 bits (551), Expect = 3.186e-58
Identity = 122/308 (39.61%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       I   +   + Q+ +   +T+S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  +  I Q T A I+FPD            NNP+      KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + +E   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L
Sbjct:   90 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPIPDPNSPTIQQISQTYNITVSFKQRSRVY-GATVIVRGSQNNTSAVKEGTAMLLEHLAGSLATAIPVSTQLDIAAQHHLFMMGRNGCN--IKHIMQRTGAQIHFPD-----------PNNPL------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEEIEVEPQCITQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCL 375          

HSP 2 Score: 69.3218 bits (168), Expect = 2.551e-11
Identity = 27/62 (43.55%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+++  N +
Sbjct:  821 DLPELFSKLGLGKYTDIFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRR 882          
BLAST of bicaudal-C protein vs. Ensembl Xenopus
Match: anks6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:NCBI gene;Acc:100170596])

HSP 1 Score: 51.9878 bits (123), Expect = 5.061e-6
Identity = 23/63 (36.51%), Postives = 41/63 (65.08%), Query Frame = 3
Query: 2094 AKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            A + S+ +  +L  L L ++   F + EVD   F +LT+ DLKELG+ T G+R++++ AI+++
Sbjct:  571 ANSVSDELSAILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISEL 633          
BLAST of bicaudal-C protein vs. Ensembl Xenopus
Match: anks6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:NCBI gene;Acc:100170596])

HSP 1 Score: 51.6026 bits (122), Expect = 5.431e-6
Identity = 23/63 (36.51%), Postives = 41/63 (65.08%), Query Frame = 3
Query: 2094 AKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            A + S+ +  +L  L L ++   F + EVD   F +LT+ DLKELG+ T G+R++++ AI+++
Sbjct:  619 ANSVSDELSAILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISEL 681          
BLAST of bicaudal-C protein vs. Ensembl Mouse
Match: Bicc1 (BicC family RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1933388])

HSP 1 Score: 212.616 bits (540), Expect = 4.334e-57
Identity = 121/313 (38.66%), Postives = 183/313 (58.47%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M DT CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       +   +   +  + +   V++S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  V  I Q T A I+FPD            +NP       KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + ++   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L  L +
Sbjct:   49 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMY-GATVTVRGSQNNTNAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSN--VKHIMQRTGAQIHFPD-----------PSNPQ------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEDIEVDPQVIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLES 339          

HSP 2 Score: 67.0106 bits (162), Expect = 9.625e-11
Identity = 29/67 (43.28%), Postives = 47/67 (70.15%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAI---NDITSNNKII 2303
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI   + +   NKI+
Sbjct:  797 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISVCDSVQIRNKIL 863          
BLAST of bicaudal-C protein vs. Ensembl Mouse
Match: Bicc1 (BicC family RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1933388])

HSP 1 Score: 213.001 bits (541), Expect = 5.301e-57
Identity = 121/313 (38.66%), Postives = 183/313 (58.47%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M DT CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       +   +   +  + +   V++S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  V  I Q T A I+FPD            +NP       KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + ++   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L  L +
Sbjct:  131 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMY-GATVTVRGSQNNTNAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSN--VKHIMQRTGAQIHFPD-----------PSNPQ------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEDIEVDPQVIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLES 421          

HSP 2 Score: 67.0106 bits (162), Expect = 9.182e-11
Identity = 29/67 (43.28%), Postives = 47/67 (70.15%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAI---NDITSNNKII 2303
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI   + +   NKI+
Sbjct:  879 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISVCDSVQIRNKIL 945          
BLAST of bicaudal-C protein vs. Ensembl Mouse
Match: Bicc1 (BicC family RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1933388])

HSP 1 Score: 213.386 bits (542), Expect = 5.533e-57
Identity = 121/313 (38.66%), Postives = 183/313 (58.47%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M DT CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       +   +   +  + +   V++S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  V  I Q T A I+FPD            +NP       KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + ++   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L  L +
Sbjct:  131 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMY-GATVTVRGSQNNTNAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSN--VKHIMQRTGAQIHFPD-----------PSNPQ------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEDIEVDPQVIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLES 421          

HSP 2 Score: 70.8626 bits (172), Expect = 5.520e-12
Identity = 27/62 (43.55%), Postives = 47/62 (75.81%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI++++ N +
Sbjct:  879 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELSKNRR 940          
BLAST of bicaudal-C protein vs. UniProt/SwissProt
Match: sp|Q5U4T7|BIC1B_XENLA (Protein bicaudal C homolog 1-B OS=Xenopus laevis OX=8355 GN=bicc1-b PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 9.435e-58
Identity = 122/308 (39.61%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       I   +   + Q+ +   +T+S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  +  I Q T A I+FPD            NNP+      KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + +E   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L
Sbjct:  127 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPIPDPNSPTIQQISQTYNITVSFKQRSRVY-GATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGCN--IKHIMQRTGAQIHFPD-----------PNNPL------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEEIEVEPQCITQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCL 412          

HSP 2 Score: 69.3218 bits (168), Expect = 1.407e-10
Identity = 27/62 (43.55%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+++  N +
Sbjct:  873 DLPELFSKLGLGKYTDIFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRR 934          
BLAST of bicaudal-C protein vs. UniProt/SwissProt
Match: sp|Q99MQ1|BICC1_MOUSE (Protein bicaudal C homolog 1 OS=Mus musculus OX=10090 GN=Bicc1 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 3.870e-56
Identity = 121/313 (38.66%), Postives = 183/313 (58.47%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M DT CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       +   +   +  + +   V++S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  V  I Q T A I+FPD            +NP       KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + ++   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L  L +
Sbjct:  131 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMY-GATVTVRGSQNNTNAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSN--VKHIMQRTGAQIHFPD-----------PSNPQ------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEDIEVDPQVIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLES 421          

HSP 2 Score: 70.8626 bits (172), Expect = 3.861e-11
Identity = 27/62 (43.55%), Postives = 47/62 (75.81%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI++++ N +
Sbjct:  879 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELSKNRR 940          
BLAST of bicaudal-C protein vs. UniProt/SwissProt
Match: sp|Q9IA00|BIC1A_XENLA (Protein bicaudal C homolog 1-A OS=Xenopus laevis OX=8355 GN=bicc1-a PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.551e-56
Identity = 120/308 (38.96%), Postives = 182/308 (59.09%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DV +T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       I   +   + Q+ +   +T+S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  +  I Q T A I+FPD            NNP+      KKSTV + GT ++   ARQ L+G LP++LM+D  ++E + +E   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L
Sbjct:  125 KSNRVTLKMDVLHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPIPDPNSPTIQQISQTYNLTVSFKQRSRVY-GATVIVRGSQNNTSAVKEGTAMLLEHLAGSLATAIPVSTQLDIAAQHHLFMMGRNGCN--IKHIMQRTGAQIHFPD-----------PNNPL------KKSTVYLQGTIDSVCLARQYLMGCLPLVLMFD--MKEEIEIEPQCITQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCL 410          

HSP 2 Score: 69.3218 bits (168), Expect = 1.224e-10
Identity = 27/62 (43.55%), Postives = 47/62 (75.81%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG++TFGARRK++LAI+++  N +
Sbjct:  866 DLPELFSKLGLGKYTDIFQQQEIDLQTFLTLTDQDLKELGISTFGARRKMLLAISELNKNRR 927          
BLAST of bicaudal-C protein vs. UniProt/SwissProt
Match: sp|Q9H694|BICC1_HUMAN (Protein bicaudal C homolog 1 OS=Homo sapiens OX=9606 GN=BICC1 PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 4.247e-55
Identity = 118/313 (37.70%), Postives = 183/313 (58.47%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTP-FNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P       +   +   +  + +   +++S+K   ++  G T+ V+G         +   ++L H  G     +PV   ++I  +HH F++ + G N  +  I Q T A I+FPD            +NP       KKSTV + GT E+   ARQ L+G LP++LM+D  ++E + ++   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L  L +
Sbjct:  129 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPVPDPNSPSIQHISQTYNISVSFKQRSRMY-GATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSN--IKHIMQRTGAQIHFPD-----------PSNPQ------KKSTVYLQGTIESVCLARQYLMGCLPLVLMFD--MKEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLES 419          

HSP 2 Score: 70.0922 bits (170), Expect = 6.599e-11
Identity = 27/62 (43.55%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+++  N +
Sbjct:  877 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRR 938          
BLAST of bicaudal-C protein vs. UniProt/SwissProt
Match: sp|Q24009|BICC_DROME (Protein bicaudal C OS=Drosophila melanogaster OX=7227 GN=BicC PE=1 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 1.056e-44
Identity = 116/333 (34.83%), Postives = 182/333 (54.65%), Query Frame = 3
Query:  231 NQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIE---QQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSW 1220
            ++  RV MK+DVSYTDHS++IG+GG +IK IM DT  HIHFPDSNR+N  EKSNQVS+ G   GVE AR  +R   PL+ SF++P    N  +   +   + M + +  ++V  S +P    L  + + VKG  + + Q   A  L++N        Q+ V + +EI P+HH  +  +G  N  +  I + T+  I FPD +             M +  L KKS V I G  ++ + ARQQL+G LPV L++D         E+ +L   N +Y V I+++ K +Q T +++++  E+ ++ ++E +  + +L T +       VKP IP +
Sbjct:  168 SRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIFSTRP---KLHTSLVLVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIV--KGKNNVNLLSIMERTQTKIIFPDLS------------DMNVKPL-KKSQVTISGRIDDVYLARQQLLGNLPVALIFDFPDNHNDASEIMSL---NTKYGVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEILRLATPF-------VKPEIPDY 472          

HSP 2 Score: 64.6994 bits (156), Expect = 3.265e-9
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 3
Query: 2058 FDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSN 2291
             D    N + + AK+  +++  +LTSL L  +   F+ NE+D   F +LTEE+L ELG+  FGAR+KL+ AI+ + +N
Sbjct:  793 LDATPVNRRMQLAKH--KDIQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLAN 868          
BLAST of bicaudal-C protein vs. TrEMBL
Match: E2F3W5 (Bicaudal-C protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1407.51 bits (3642), Expect = 0.000e+0
Identity = 685/687 (99.71%), Postives = 686/687 (99.85%), Query Frame = 3
Query:  243 RVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 2303
            RVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSS+YVLLNENETLLTDFKSLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDF TFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII
Sbjct:    1 RVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSDYVLLNENETLLTDFKSLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFTTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 687          
BLAST of bicaudal-C protein vs. TrEMBL
Match: A0A0X3PU56 (Protein bicaudal C homolog 1 OS=Schistocephalus solidus OX=70667 GN=BICC1 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 3.387e-65
Identity = 139/355 (39.15%), Postives = 205/355 (57.75%), Query Frame = 3
Query:  219 ITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYK-----PIG----------KLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSS--------------------AHAVLAANNPMGISGLFK----KSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTK-SVIIRTTEQNVNALFEVKNILNKL 1163
            +  + + +RVTMKIDVS+T+HSH+IGKGGQ++KA+M +T+CHIHFPDSNRTN  EKSNQVSISG    V+ AR++IR +LPL+Y+F I      +   +   ++ Q++   +V ISY+     P+           +L SG  + V+G+   A   ++A   +LN+HFG+   Q PV +T+EI+PKH  F++N      L + +F+ T A + FPDN  SS                    A   L   NP+ +  +      K+ V I GT EN + ARQ ++  LP++LM +IT EE   LE  + + +   YDVA+S + K +Q  K S++I+T+E NV +LF V N L  L
Sbjct:   35 VPEVGKVERVTMKIDVSHTEHSHLIGKGGQNVKAMMVETKCHIHFPDSNRTNVFEKSNQVSISGSPADVDRARKRIRQMLPLVYNFQIEHPSQTIALYRASPVLQQIEAKWQVEISYRHQYLYPVSDVVPICSSMPQLSSGIVVSVRGLNAFAASVMEATRFLLNYHFGKLAYQTPVWLTLEIEPKHQVFIINHVAPRKLSDVLFETTGAKVRFPDNVNSSLFSRLLRGSTSDSSRRGLCGARLCLPKFNPIMLGEMQSRPGFKTMVTITGTVENVYLARQCIMNLLPIVLMSEITNEEFSFLERLDCSSLASTYDVALSFRTKQRQILKQSLVIKTSEANVGSLFHVLNHLKML 389          
BLAST of bicaudal-C protein vs. TrEMBL
Match: A0A1S3IB48 (protein bicaudal C homolog 1 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106162680 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.027e-59
Identity = 134/344 (38.95%), Postives = 200/344 (58.14%), Query Frame = 3
Query:  141 IKSDLTAINPSFQ-KSEPDMXXXXXXKITNM--NQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLE---VTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            I+S     NP  +   EPD       +I  +   +++RVT+K+DVS+TDHSHVIGKGG +IK +M  T CHIHFPDSNR +T EKSNQVSI+G   GVE AR  IR +LPL +SF++P T   V++         +Q +++   VT+++K   ++   TT+ V+G V  A+    A   ++ H  G +   +P+   +EI P+HH F++ +GG N  V  I Q T A+I+FPD    +                 +K TV I G  E+ F ARQQLI  LP++LM+D+  +  V +    + ++ E+ DV ISIK K KQ +KSVI+++ E+N   ++E + +L
Sbjct:   78 IRSRSPKPNPHIKVAGEPDDVRNAKDRIMCVLDTKSNRVTLKMDVSHTDHSHVIGKGGNNIKRVMQQTGCHIHFPDSNRGSTTEKSNQVSIAGQPTGVESARAHIRELLPLAFSFELPIT--GVLQPVPDTSSPPIQNIMQQHNVTVTFKQRPRMYV-TTVIVRGTVSNAKAVTMATKAVMEHLAGNSGTNIPISTQLEIAPQHHLFMIGRGGMN--VKHIMQRTGASIHFPDPNNVTPQ---------------RKGTVYITGGIESVFLARQQLIQCLPLVLMFDMKAD--VEVGQAKIAYLMEQLDVFISIKPKPKQPSKSVIVKSIERNALNMYEARRVL 399          

HSP 2 Score: 73.9442 bits (180), Expect = 1.253e-9
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 2055 KFDFLNFNSKTERAKNSSE------NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            K D  N    +   +NSS       ++ ++ + L L ++ D F + E+DF TF +LT++DLKELG+ TFGARRK++LAI D+
Sbjct:  789 KLDLGNHVDSSAHLRNSSSSWPPKTDLAELFSRLGLGKYTDLFQQQEIDFATFLTLTDQDLKELGITTFGARRKMLLAIADL 870          

HSP 3 Score: 63.5438 bits (153), Expect = 1.914e-6
Identity = 46/147 (31.29%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  225 NMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLIL 665
            N   N  ++ +++++   H  +IG+GG ++K IM  T   IHFPD N   T ++   V I+G    V +ARQ++   LPL+  FD+         +  +  +A L   L+V IS KP  K  S  ++ VK I + A    +A  ++L
Sbjct:  261 NSGTNIPISTQLEIAPQHHLFMIGRGGMNVKHIMQRTGASIHFPDPNNV-TPQRKGTVYITGGIESVFLARQQLIQCLPLVLMFDM-----KADVEVGQAKIAYLMEQLDVFISIKPKPKQPS-KSVIVKSIERNALNMYEARRVLL 400          
BLAST of bicaudal-C protein vs. TrEMBL
Match: A0A1S3IC98 (protein bicaudal C homolog 1-B isoform X1 OS=Lingula unguis OX=7574 GN=LOC106162680 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.495e-59
Identity = 126/310 (40.65%), Postives = 188/310 (60.65%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLE---VTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+TDHSHVIGKGG +IK +M  T CHIHFPDSNR +T EKSNQVSI+G   GVE AR  IR +LPL +SF++P T   V++         +Q +++   VT+++K   ++   TT+ V+G V  A+    A   ++ H  G +   +P+   +EI P+HH F++ +GG N  V  I Q T A+I+FPD    +                 +K TV I G  E+ F ARQQLI  LP++LM+D+  +  V +    + ++ E+ DV ISIK K KQ +KSVI+++ E+N   ++E + +L
Sbjct:  128 KSNRVTLKMDVSHTDHSHVIGKGGNNIKRVMQQTGCHIHFPDSNRGSTTEKSNQVSIAGQPTGVESARAHIRELLPLAFSFELPIT--GVLQPVPDTSSPPIQNIMQQHNVTVTFKQRPRMYV-TTVIVRGTVSNAKAVTMATKAVMEHLAGNSGTNIPISTQLEIAPQHHLFMIGRGGMN--VKHIMQRTGASIHFPDPNNVTPQ---------------RKGTVYITGGIESVFLARQQLIQCLPLVLMFDMKAD--VEVGQAKIAYLMEQLDVFISIKPKPKQPSKSVIVKSIERNALNMYEARRVL 415          

HSP 2 Score: 73.559 bits (179), Expect = 1.719e-9
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 2055 KFDFLNFNSKTERAKNSSE------NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            K D  N    +   +NSS       ++ ++ + L L ++ D F + E+DF TF +LT++DLKELG+ TFGARRK++LAI D+
Sbjct:  805 KLDLGNHVDSSAHLRNSSSSWPPKTDLAELFSRLGLGKYTDLFQQQEIDFATFLTLTDQDLKELGITTFGARRKMLLAIADL 886          

HSP 3 Score: 63.1586 bits (152), Expect = 2.877e-6
Identity = 46/147 (31.29%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  225 NMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLIL 665
            N   N  ++ +++++   H  +IG+GG ++K IM  T   IHFPD N   T ++   V I+G    V +ARQ++   LPL+  FD+         +  +  +A L   L+V IS KP  K  S  ++ VK I + A    +A  ++L
Sbjct:  277 NSGTNIPISTQLEIAPQHHLFMIGRGGMNVKHIMQRTGASIHFPDPNNV-TPQRKGTVYITGGIESVFLARQQLIQCLPLVLMFDM-----KADVEVGQAKIAYLMEQLDVFISIKPKPKQPS-KSVIVKSIERNALNMYEARRVLL 416          
BLAST of bicaudal-C protein vs. TrEMBL
Match: A0A2R2MMB1 (protein bicaudal C homolog 1-B isoform X2 OS=Lingula unguis OX=7574 GN=LOC106162680 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.676e-59
Identity = 126/310 (40.65%), Postives = 188/310 (60.65%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLE---VTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+TDHSHVIGKGG +IK +M  T CHIHFPDSNR +T EKSNQVSI+G   GVE AR  IR +LPL +SF++P T   V++         +Q +++   VT+++K   ++   TT+ V+G V  A+    A   ++ H  G +   +P+   +EI P+HH F++ +GG N  V  I Q T A+I+FPD    +                 +K TV I G  E+ F ARQQLI  LP++LM+D+  +  V +    + ++ E+ DV ISIK K KQ +KSVI+++ E+N   ++E + +L
Sbjct:  128 KSNRVTLKMDVSHTDHSHVIGKGGNNIKRVMQQTGCHIHFPDSNRGSTTEKSNQVSIAGQPTGVESARAHIRELLPLAFSFELPIT--GVLQPVPDTSSPPIQNIMQQHNVTVTFKQRPRMYV-TTVIVRGTVSNAKAVTMATKAVMEHLAGNSGTNIPISTQLEIAPQHHLFMIGRGGMN--VKHIMQRTGASIHFPDPNNVTPQ---------------RKGTVYITGGIESVFLARQQLIQCLPLVLMFDMKAD--VEVGQAKIAYLMEQLDVFISIKPKPKQPSKSVIVKSIERNALNMYEARRVL 415          

HSP 2 Score: 73.559 bits (179), Expect = 1.733e-9
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 2055 KFDFLNFNSKTERAKNSSE------NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            K D  N    +   +NSS       ++ ++ + L L ++ D F + E+DF TF +LT++DLKELG+ TFGARRK++LAI D+
Sbjct:  804 KLDLGNHVDSSAHLRNSSSSWPPKTDLAELFSRLGLGKYTDLFQQQEIDFATFLTLTDQDLKELGITTFGARRKMLLAIADL 885          

HSP 3 Score: 63.1586 bits (152), Expect = 2.828e-6
Identity = 48/147 (32.65%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  225 NMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLIL 665
            N   N  ++ +++++   H  +IG+GG ++K IM  T   IHFPD N   T ++   V I+G    V +ARQ++   LPL+  FD+      V + +   LM Q    L+V IS KP  K  S  ++ VK I + A    +A  ++L
Sbjct:  277 NSGTNIPISTQLEIAPQHHLFMIGRGGMNVKHIMQRTGASIHFPDPNNV-TPQRKGTVYITGGIESVFLARQQLIQCLPLVLMFDMKAD-VEVGQAKIAYLMEQ----LDVFISIKPKPKQPS-KSVIVKSIERNALNMYEARRVLL 416          
BLAST of bicaudal-C protein vs. Ensembl Cavefish
Match: bicc1b (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:103032919])

HSP 1 Score: 206.068 bits (523), Expect = 7.830e-55
Identity = 119/317 (37.54%), Postives = 181/317 (57.10%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPP 1184
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M DT CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P     +        +  + +   +++++K   +L  G T  V+G         +   ++L H  G     + V   ++I P+HH  ++ + G N  +  I Q T A ++FPD            N P       KKSTV I G+ ++   ARQ L+G LP++LM+D  I+E V ++   +  + E+ DV IS+K K KQ +KSVI+++ E+N   ++E +  L  L +   PP
Sbjct:  130 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPGGVEAARARIRELLPLVLMFELPVI-VQLNPDPSSPAIQHISQTYNISVAFKQRSRLY-GATGVVRGSQNNVAAVKRGTAVLLEHLAGSLASAITVSTQLDIAPQHHLSMMGRNGSN--IKHIMQRTGAQVHFPD-----------PNCPQ------KKSTVYIQGSIDSVCLARQYLMGCLPLVLMFD--IKEDVAVDPQCVTSLMEQLDVFISVKPKPKQPSKSVIVKSVERNALNMYEARRYLLGLDSSGVPP 423          

HSP 2 Score: 71.633 bits (174), Expect = 2.448e-12
Identity = 28/62 (45.16%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+D+  N +
Sbjct:  843 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISDLNKNRR 904          
BLAST of bicaudal-C protein vs. Ensembl Cavefish
Match: bicc1b (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:103032919])

HSP 1 Score: 203.371 bits (516), Expect = 8.315e-54
Identity = 116/307 (37.79%), Postives = 177/307 (57.65%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M DT CHIHFPDSNR N  EKSNQVSI+G   GVE AR +IR +LPL+  F++P     +        +  + +   +++++K   +L  G T  V+G         +   ++L H  G     + V   ++I P+HH  ++ + G N  +  I Q T A ++FPD            N P       KKSTV I G+ ++   ARQ L+G LP++LM+D  I+E V ++   +  + E+ DV IS+K K KQ +KSVI+++ E+N   ++E +  L
Sbjct:  130 KSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPGGVEAARARIRELLPLVLMFELPVI-VQLNPDPSSPAIQHISQTYNISVAFKQRSRLY-GATGVVRGSQNNVAAVKRGTAVLLEHLAGSLASAITVSTQLDIAPQHHLSMMGRNGSN--IKHIMQRTGAQVHFPD-----------PNCPQ------KKSTVYIQGSIDSVCLARQYLMGCLPLVLMFD--IKEDVAVDPQCVTSLMEQLDVFISVKPKPKQPSKSVIVKSVERNALNMYEARRYL 413          

HSP 2 Score: 72.0182 bits (175), Expect = 2.402e-12
Identity = 28/62 (45.16%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+D+  N +
Sbjct:  876 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISDLNKNRR 937          
BLAST of bicaudal-C protein vs. Ensembl Cavefish
Match: bicc1a (BicC family RNA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-101223-3])

HSP 1 Score: 181.415 bits (459), Expect = 8.153e-47
Identity = 123/332 (37.05%), Postives = 179/332 (53.92%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQD--RLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQ--YKPPIQAGVKPPIPS 1217
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M DT CHIHFPDSNR N  EKSNQ                   +LPL   F+       ++EQ D    ++  + +   VTI+ KP   L  G T  V+G    A    +   L+L+H  G     V V   ++I P+HH  LL + G N  +  I Q T A I+FPD +  S                  +STV I G+ +   +ARQQL+G LP++LM+D  ++E V +E   +N + E+ DV ISIK K KQ +KSVI+++ E+N   ++EV+ +L  + +     P I   + PP+ S
Sbjct:   92 KSNRVTLKMDVSHTEHSHVIGKGGNNIKRVMEDTGCHIHFPDSNRNNQGEKSNQ------------------ELLPLALVFEC----GGLLEQLDCNSPIVQHISQSCNVTIACKPPSHLY-GNTGVVRGNQSNATAVKRGTALLLDHLAGSMAGSVLVSTQLDIAPQHHLALLGRNGAN--LKHITQRTGARIHFPDPSTHSHSHTSTR-----------RSTVYIQGSIDAVCDARQQLMGCLPLVLMFD--VKEEVEIETHCINTLMEQLDVFISIKPKPKQPSKSVIVKSVERNAENMYEVRRLLLAVESSCGASPSIPLSLSPPVSS 385          

HSP 2 Score: 65.4698 bits (158), Expect = 1.968e-10
Identity = 28/64 (43.75%), Postives = 46/64 (71.88%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 2303
            ++ ++ ++L L ++ D F + E+D  TF +LT+ DLKELG+ TFGARRK++LAI+   S  K++
Sbjct:  758 DLPELFSTLGLGKYIDVFQQQEIDLQTFVTLTDPDLKELGITTFGARRKMLLAISLNKSRWKLL 821          
BLAST of bicaudal-C protein vs. Ensembl Cavefish
Match: bicc2 (protein bicaudal C homolog 1-like [Source:NCBI gene;Acc:103039934])

HSP 1 Score: 174.866 bits (442), Expect = 8.944e-45
Identity = 116/319 (36.36%), Postives = 175/319 (54.86%), Query Frame = 3
Query:  240 DRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNR-TNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPF-NVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVP-----VMMTIEID--PKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            ++VT+K+DV++T+HSHVIGKGG +IK +M DT CHIHFPDSNR + T EKSNQVSI+G   GVE AR+ IR + PL+ +FD+P T    V+      L+  + +   V+++++   KL   T + V+G+        KA  +++    G+    V      VM++ ++D   + H FLL Q G N L   +   T   I  PD T            P     L       I GTA+    ARQQL+  LPV LM+++  EEG + +   L  + +   V IS+K K+K   KSV+++  E+N+ +L+E + +L  L +
Sbjct:  160 NKVTLKMDVTHTEHSHVIGKGGGNIKKVMEDTSCHIHFPDSNRHSATGEKSNQVSIAGPVEGVESARKHIRDLQPLVLTFDLPLTLVGGVVTDAGSPLIQHVAQAFGVSVTFRTQPKLYCSTCV-VRGLQGNCAAVKKATCVLMELLLGREAAAVAGVTGGVMVSTQLDVTSQQHLFLLGQNGANFL--SVMHQTHTQIVLPDLT-----------APQHTPSLL------IQGTADGVCLARQQLMDCLPVCLMFEMK-EEGES-DPRKLAQMMQNLGVFISVKPKVKLTAKSVVVKGLERNIESLYEARRLLLGLES 456          

HSP 2 Score: 62.003 bits (149), Expect = 2.569e-9
Identity = 25/45 (55.56%), Postives = 38/45 (84.44%), Query Frame = 3
Query: 2148 RFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            ++   F + E+D+ TF +L+EEDLKE+GV+TFGARRK++LAI+D+
Sbjct:  735 KYNTLFQEQEIDYQTFFTLSEEDLKEVGVSTFGARRKMLLAISDL 779          

HSP 3 Score: 61.6178 bits (148), Expect = 2.996e-9
Identity = 65/240 (27.08%), Postives = 112/240 (46.67%), Query Frame = 3
Query:  246 VTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMM--TIEIDPKHHS----FLLNQGGQNSLVNEIFQ---LTR-ATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFE 935
            V+ ++DV+   H  ++G+ G +  ++M  T   I  PD       + +  + I G + GV +ARQ++   LP+   F++         + D   +AQ+ + L V IS KP  KL +  ++ VKG+ +      +A  L+L    G    +V +M   + EI     +     L+N G    L N + Q   LT  AT+  PD+  S+A      + P G++GL  +  + + G AE+  E
Sbjct:  322 VSTQLDVTSQQHLFLLGQNGANFLSVMHQTHTQIVLPD---LTAPQHTPSLLIQGTADGVCLARQQLMDCLPVCLMFEM-----KEEGESDPRKLAQMMQNLGVFISVKPKVKL-TAKSVVVKGLERNIESLYEARRLLL----GLESSEVSIMAKKSCEISTASKTPLDPLLVNNGMTGYLFNMLMQQLNLTETATVPTPDSVPSTAPVKPRPSPPPGLAGLADEGRMGLRG-AESKLE 547          
BLAST of bicaudal-C protein vs. Ensembl Cavefish
Match: bicc2 (protein bicaudal C homolog 1-like [Source:NCBI gene;Acc:103039934])

HSP 1 Score: 175.252 bits (443), Expect = 1.005e-44
Identity = 116/319 (36.36%), Postives = 175/319 (54.86%), Query Frame = 3
Query:  240 DRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNR-TNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPF-NVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVP-----VMMTIEID--PKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            ++VT+K+DV++T+HSHVIGKGG +IK +M DT CHIHFPDSNR + T EKSNQVSI+G   GVE AR+ IR + PL+ +FD+P T    V+      L+  + +   V+++++   KL   T + V+G+        KA  +++    G+    V      VM++ ++D   + H FLL Q G N L   +   T   I  PD T            P     L       I GTA+    ARQQL+  LPV LM+++  EEG + +   L  + +   V IS+K K+K   KSV+++  E+N+ +L+E + +L  L +
Sbjct:  166 NKVTLKMDVTHTEHSHVIGKGGGNIKKVMEDTSCHIHFPDSNRHSATGEKSNQVSIAGPVEGVESARKHIRDLQPLVLTFDLPLTLVGGVVTDAGSPLIQHVAQAFGVSVTFRTQPKLYCSTCV-VRGLQGNCAAVKKATCVLMELLLGREAAAVAGVTGGVMVSTQLDVTSQQHLFLLGQNGANFL--SVMHQTHTQIVLPDLT-----------APQHTPSLL------IQGTADGVCLARQQLMDCLPVCLMFEMK-EEGES-DPRKLAQMMQNLGVFISVKPKVKLTAKSVVVKGLERNIESLYEARRLLLGLES 462          

HSP 2 Score: 62.3882 bits (150), Expect = 2.051e-9
Identity = 25/45 (55.56%), Postives = 38/45 (84.44%), Query Frame = 3
Query: 2148 RFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            ++   F + E+D+ TF +L+EEDLKE+GV+TFGARRK++LAI+D+
Sbjct:  819 KYNTLFQEQEIDYQTFFTLSEEDLKEVGVSTFGARRKMLLAISDL 863          

HSP 3 Score: 61.6178 bits (148), Expect = 3.694e-9
Identity = 65/240 (27.08%), Postives = 112/240 (46.67%), Query Frame = 3
Query:  246 VTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMM--TIEIDPKHHS----FLLNQGGQNSLVNEIFQ---LTR-ATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFE 935
            V+ ++DV+   H  ++G+ G +  ++M  T   I  PD       + +  + I G + GV +ARQ++   LP+   F++         + D   +AQ+ + L V IS KP  KL +  ++ VKG+ +      +A  L+L    G    +V +M   + EI     +     L+N G    L N + Q   LT  AT+  PD+  S+A      + P G++GL  +  + + G AE+  E
Sbjct:  328 VSTQLDVTSQQHLFLLGQNGANFLSVMHQTHTQIVLPD---LTAPQHTPSLLIQGTADGVCLARQQLMDCLPVCLMFEM-----KEEGESDPRKLAQMMQNLGVFISVKPKVKL-TAKSVVVKGLERNIESLYEARRLLL----GLESSEVSIMAKKSCEISTASKTPLDPLLVNNGMTGYLFNMLMQQLNLTETATVPTPDSVPSTAPVKPRPSPPPGLAGLADEGRMGLRG-AESKLE 553          
BLAST of bicaudal-C protein vs. Ensembl Sea Lamprey
Match: BICC1 (BicC family RNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:19351])

HSP 1 Score: 194.126 bits (492), Expect = 1.647e-51
Identity = 112/308 (36.36%), Postives = 172/308 (55.84%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPF-NVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNIL 1154
            +++RVT+K+DVS+T+HSHVIGKGG +I+ +M +T CHIHFPDSNR +  EKSNQVSI+G+  GVE AR  IR +LPL   F++P T F   + +     +A + +   + +++K   +L  GT    +G       T + V +++ H  G      PV   +++ P+HH F++ + G N  V  I   T A I FP+              P G         ++I G  E    AR  L+G LP++LM+D  ++E   +   N+  + E  DV ISIK K KQ +KSVI+++ E+N   ++E + +L
Sbjct:   55 KSNRVTLKMDVSHTEHSHVIGKGGANIQRVMANTGCHIHFPDSNRGSQAEKSNQVSIAGLPGGVEEARAFIRELLPLALMFEVPMTGFLQPVSEASSPAIAHIAQRHGLNVAFKQRARLY-GTVCVARG--SNVSTTKEGVAMLIEHLTGSPGATFPVSSQLDVAPQHHQFMMGRNGLN--VKRIVHRTGAQIQFPE--------------PGG-----PHKAIHIHGNMEAVCLARTCLLGCLPLVLMFD--MKEDAEISSHNMAQLMEHLDVFISIKPKPKQPSKSVIVKSMERNAGNVYEARRLL 336          

HSP 2 Score: 71.2478 bits (173), Expect = 6.497e-13
Identity = 28/62 (45.16%), Postives = 47/62 (75.81%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF SLT++DLKELG++TFGARRK++LAI+D+  + +
Sbjct:  836 DLPELFSKLGLGKYTDIFQQQEIDLQTFLSLTDQDLKELGISTFGARRKMLLAISDLNKSRR 897          
BLAST of bicaudal-C protein vs. Ensembl Sea Lamprey
Match: hdlbpb (high density lipoprotein binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6822])

HSP 1 Score: 48.521 bits (114), Expect = 6.258e-6
Identity = 58/197 (29.44%), Postives = 83/197 (42.13%), Query Frame = 3
Query:  279 HSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAI---LPLIYSFD--IPFTPFN-VIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTI---------FVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEI--DPKHHSFLLNQGGQNSLVNEIFQLTRATINFP 818
            H ++IGKGG +IK I  +T   I  P  N       S  + I+G     E AR+K+ AI   L  I   D  IP    N +I  + RL+ A ++    V I +   G      TI           K ++Q A +  K VN                  TIE+   P++H FL+ +GG N  + ++   T A I FP
Sbjct:  594 HKNIIGKGGANIKKIREETNTKIDLPTENSN-----SEMIVITGKKAHCEAAREKVLAIQKELANIKEADVTIPAKLHNSLIGAKGRLVRAIMEECGGVHIHFPSEGSGSDKVTIRGPQPEVDRACKQLMQLAEE--KQVN----------------SFTIEVRAKPEYHRFLIGRGGAN--IRKVRDKTGARIVFP 765          
BLAST of bicaudal-C protein vs. Ensembl Nematostella
Match: EDO31986 (Bicaudal C-like protein 2; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWC4])

HSP 1 Score: 103.219 bits (256), Expect = 4.944e-25
Identity = 69/213 (32.39%), Postives = 114/213 (53.52%), Query Frame = 3
Query:  453 ILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTK 1091
            +LPLI +F++P T  + ++    ++  ++ +   V IS+K   +  S T I V+G  Q      +A+  ++ H  G     VPV M I+I P+HH F++ + G N  +  I Q T A++NFPD                  +G  +K  V + G+ E+   AR QL+  LP++LM+D+  E+G +++   LN + ERYDV +S+K K KQ +K
Sbjct:    2 MLPLILTFELPLTGRSPMDNNTNVIQ-RIGQTYNVAISFKQRPRCASQTAI-VRGSQQHVPAIKEAIKRLVEHFTGSIASAVPVSMQIDIAPQHHLFIIGKNGAN--IKHITQQTGASVNFPDP-----------------NGTQRKGVVFLSGSVESVICARAQLLDCLPLVLMFDLREEDG-DIDAMQLNKVMERYDVFVSVKPKPKQPSK 192          

HSP 2 Score: 53.9138 bits (128), Expect = 4.063e-8
Identity = 40/124 (32.26%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  246 VTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLE---VTISYKPIGKLLSGTTIF 608
            V+M+ID++   H  +IGK G +IK I   T   ++FPD N T   ++   V +SG    V  AR ++   LPL+  FD+        E+   +   QL +++E   V +S KP  K  S   +F
Sbjct:   83 VSMQIDIAPQHHLFIIGKNGANIKHITQQTGASVNFPDPNGT---QRKGVVFLSGSVESVICARAQLLDCLPLVLMFDLR-------EEDGDIDAMQLNKVMERYDVFVSVKPKPKQPSKVHLF 196          
BLAST of bicaudal-C protein vs. Ensembl Nematostella
Match: EDO31985 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWC3])

HSP 1 Score: 57.3806 bits (137), Expect = 1.039e-10
Identity = 25/47 (53.19%), Postives = 37/47 (78.72%), Query Frame = 3
Query: 2136 LDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAIN 2276
            L L+++   F + E+D  TF +LTE+DLKE+GV+TFG RRKL++AI+
Sbjct:    8 LGLAKYFGKFQEQEIDLQTFMTLTEDDLKEIGVSTFGPRRKLLMAIS 54          
BLAST of bicaudal-C protein vs. Ensembl Nematostella
Match: EDO37476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ6])

HSP 1 Score: 54.299 bits (129), Expect = 2.479e-7
Identity = 52/189 (27.51%), Postives = 89/189 (47.09%), Query Frame = 3
Query:  279 HSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAI---LPLIYSFD--IPFTPFN-VIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKG---IVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFP 818
            H +VIG+GG +IK I  +T   I  P          S+ + I+G    VE AR+KI AI   L  +   +  IP    N +I  + RL+ + ++    V+I + P G   +   + ++G    V++A++ +  + L      G         + I   P+HH FL+ +GG +  + ++ + T A I FP
Sbjct:  492 HKNVIGRGGTTIKKIREETDTKIELPAEG-----SDSDVIIITGHKAQVEAAREKILAIQNELANVTQLEVHIPSKFHNSIIGAKGRLIRSVMEDCGGVSIKFPPEGS--NSDKVLIRGPKDDVEKAKKQL--LELTNEKELGS------YTVEIRAKPEHHRFLIGRGGAS--IRKVRENTGARIVFP 663          
BLAST of bicaudal-C protein vs. Ensembl Medaka
Match: bicc1a (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:101165583])

HSP 1 Score: 218.009 bits (554), Expect = 9.317e-59
Identity = 130/314 (41.40%), Postives = 183/314 (58.28%), Query Frame = 3
Query:  234 QNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQD--RLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRT 1169
            +++RVT+K+DVS+T+HSHVIGKGG +IK +M +T CHIHFPDSNR N  EKSNQVSI+G   GVE AR KIR +LPL+ SF++P      I Q D     +  + +   +T+S+KP  +L   T + V+G         +   L+L H  G     + V   ++I P+HH F+  + G N  +  I Q T A I+FPD            N P       KKSTV I GT E+   ARQ L+G LP++LM+D  I+E V +E   +  + E+ DV ISIK K KQ +KSVI+++ E+N   ++E +  L  L +
Sbjct:  130 KSNRVTLKMDVSHTEHSHVIGKGGNNIKRVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPGGVEAARVKIRELLPLVLSFELP-----AIMQADPSSPTVQHISQTYNLTVSFKPPTRLYRATGV-VRGSQNNTNAVKRGTALLLEHLAGSLASTISVTTHLDIAPQHHLFMKGRNGSN--IKHITQRTGAQIHFPD-----------PNAPQ------KKSTVYIQGTIESVCLARQYLMGCLPLVLMFD--IKEDVEVEPQCITALMEQLDVFISIKPKPKQPSKSVIVKSVERNAVNMYEARKFLLGLES 416          

HSP 2 Score: 69.707 bits (169), Expect = 1.132e-11
Identity = 27/62 (43.55%), Postives = 46/62 (74.19%), Query Frame = 3
Query: 2112 NVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++ ++ + L L ++ D F + E+D  TF +LT++DLKELG+ TFGARRK++LAI+++  N +
Sbjct:  867 DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRR 928          
BLAST of bicaudal-C protein vs. Ensembl Medaka
Match: bicc2 (protein bicaudal C homolog 1 [Source:NCBI gene;Acc:101172590])

HSP 1 Score: 162.54 bits (410), Expect = 1.130e-40
Identity = 142/479 (29.65%), Postives = 234/479 (48.85%), Query Frame = 3
Query:  243 RVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTI-EKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPF-NVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIF------VKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVK--PPIPS------WMNKVFSNL------------TNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMH-IDNGIAF----GKQMNM--AKISSLLSASRIHN-----SHLLINPQTNSNK 1559
            +VT+K+DV+YT+HSHVIGKGG +IK +M  T CHIHFPDSNR N+  EKSNQVSI+G   GVE AR++IR + PL  +FD+P +     +      L+ Q+ +   V+++++ +       T F      V G+        +A  ++++   G  +    V   +++  + H FLL Q G + L   I Q T+  I  PD        + A  +P          ++ I G+ +    ARQQL+  LPV LM+D+  +   +  M  L  + +   V IS+K K+KQ +KSV+++  E+N++ ++E +  L  L +     I  GV   P +P       W+N +   L            T + S    G   + P P   P  +E C  S  + + N  L    + L  +++S  +   + +M    NGI+     G++ ++    ++ +LS  R H+     S+ L+NP+T   +
Sbjct:  159 KVTLKMDVAYTEHSHVIGKGGGNIKKVMDATSCHIHFPDSNRHNSAGEKSNQVSIAGPIDGVEDARRRIRDLQPLSLTFDLPVSLVPQALPDAGSPLIQQVVQAFGVSVNFRALPLQPQTQTSFYGNCCTVWGLQGNTAALKEATCILMDLLLGSEVPGGAVSSQLDVTTQQHLFLLGQNGTHFL--SIMQQTQTQIILPD--------LSAPQSP---------PSLLIQGSPDGVCLARQQLMDCLPVCLMFDMREDGAADPCM--LAKMMQNLGVFISVKPKVKQTSKSVVVKGLERNISNIYEARRALLGLDSSEHAKIN-GVSHDPVLPGGGVTNYWLNMLLQQLRLSEQGSLPVSSTEIGS---GGKPRLSPPPGLAPSPEE-C-RSGLRGTDNRPL---EKILENEYQSGQSEDEDPEMSDAANGISRVGLNGRRRSLQTPDVNKVLSQGRRHSTGQAISYRLLNPETKGGR 607          

HSP 2 Score: 67.781 bits (164), Expect = 4.296e-11
Identity = 27/64 (42.19%), Postives = 50/64 (78.12%), Query Frame = 3
Query: 2106 SENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++++ ++L  L L ++ D F + E+D+ TF +L+++DLKE+GV+TFGARRK++LAI+D+  + +
Sbjct:  796 TDDLHELLNQLGLIKYIDVFEQQEIDYQTFLTLSDDDLKEVGVSTFGARRKMLLAISDLNKSKR 859          
BLAST of bicaudal-C protein vs. Ensembl Medaka
Match: bicc2 (protein bicaudal C homolog 1 [Source:NCBI gene;Acc:101172590])

HSP 1 Score: 162.54 bits (410), Expect = 1.130e-40
Identity = 142/479 (29.65%), Postives = 234/479 (48.85%), Query Frame = 3
Query:  243 RVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTI-EKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPF-NVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIF------VKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVK--PPIPS------WMNKVFSNL------------TNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMH-IDNGIAF----GKQMNM--AKISSLLSASRIHN-----SHLLINPQTNSNK 1559
            +VT+K+DV+YT+HSHVIGKGG +IK +M  T CHIHFPDSNR N+  EKSNQVSI+G   GVE AR++IR + PL  +FD+P +     +      L+ Q+ +   V+++++ +       T F      V G+        +A  ++++   G  +    V   +++  + H FLL Q G + L   I Q T+  I  PD        + A  +P          ++ I G+ +    ARQQL+  LPV LM+D+  +   +  M  L  + +   V IS+K K+KQ +KSV+++  E+N++ ++E +  L  L +     I  GV   P +P       W+N +   L            T + S    G   + P P   P  +E C  S  + + N  L    + L  +++S  +   + +M    NGI+     G++ ++    ++ +LS  R H+     S+ L+NP+T   +
Sbjct:  159 KVTLKMDVAYTEHSHVIGKGGGNIKKVMDATSCHIHFPDSNRHNSAGEKSNQVSIAGPIDGVEDARRRIRDLQPLSLTFDLPVSLVPQALPDAGSPLIQQVVQAFGVSVNFRALPLQPQTQTSFYGNCCTVWGLQGNTAALKEATCILMDLLLGSEVPGGAVSSQLDVTTQQHLFLLGQNGTHFL--SIMQQTQTQIILPD--------LSAPQSP---------PSLLIQGSPDGVCLARQQLMDCLPVCLMFDMREDGAADPCM--LAKMMQNLGVFISVKPKVKQTSKSVVVKGLERNISNIYEARRALLGLDSSEHAKIN-GVSHDPVLPGGGVTNYWLNMLLQQLRLSEQGSLPVSSTEIGS---GGKPRLSPPPGLAPSPEE-C-RSGLRGTDNRPL---EKILENEYQSGQSEDEDPEMSDAANGISRVGLNGRRRSLQTPDVNKVLSQGRRHSTGQAISYRLLNPETKGGR 607          

HSP 2 Score: 67.781 bits (164), Expect = 4.296e-11
Identity = 27/64 (42.19%), Postives = 50/64 (78.12%), Query Frame = 3
Query: 2106 SENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++++ ++L  L L ++ D F + E+D+ TF +L+++DLKE+GV+TFGARRK++LAI+D+  + +
Sbjct:  796 TDDLHELLNQLGLIKYIDVFEQQEIDYQTFLTLSDDDLKEVGVSTFGARRKMLLAISDLNKSKR 859          
BLAST of bicaudal-C protein vs. Ensembl Medaka
Match: bicc2 (protein bicaudal C homolog 1 [Source:NCBI gene;Acc:101172590])

HSP 1 Score: 162.54 bits (410), Expect = 1.130e-40
Identity = 142/479 (29.65%), Postives = 234/479 (48.85%), Query Frame = 3
Query:  243 RVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTI-EKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPF-NVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIF------VKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVK--PPIPS------WMNKVFSNL------------TNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMH-IDNGIAF----GKQMNM--AKISSLLSASRIHN-----SHLLINPQTNSNK 1559
            +VT+K+DV+YT+HSHVIGKGG +IK +M  T CHIHFPDSNR N+  EKSNQVSI+G   GVE AR++IR + PL  +FD+P +     +      L+ Q+ +   V+++++ +       T F      V G+        +A  ++++   G  +    V   +++  + H FLL Q G + L   I Q T+  I  PD        + A  +P          ++ I G+ +    ARQQL+  LPV LM+D+  +   +  M  L  + +   V IS+K K+KQ +KSV+++  E+N++ ++E +  L  L +     I  GV   P +P       W+N +   L            T + S    G   + P P   P  +E C  S  + + N  L    + L  +++S  +   + +M    NGI+     G++ ++    ++ +LS  R H+     S+ L+NP+T   +
Sbjct:  159 KVTLKMDVAYTEHSHVIGKGGGNIKKVMDATSCHIHFPDSNRHNSAGEKSNQVSIAGPIDGVEDARRRIRDLQPLSLTFDLPVSLVPQALPDAGSPLIQQVVQAFGVSVNFRALPLQPQTQTSFYGNCCTVWGLQGNTAALKEATCILMDLLLGSEVPGGAVSSQLDVTTQQHLFLLGQNGTHFL--SIMQQTQTQIILPD--------LSAPQSP---------PSLLIQGSPDGVCLARQQLMDCLPVCLMFDMREDGAADPCM--LAKMMQNLGVFISVKPKVKQTSKSVVVKGLERNISNIYEARRALLGLDSSEHAKIN-GVSHDPVLPGGGVTNYWLNMLLQQLRLSEQGSLPVSSTEIGS---GGKPRLSPPPGLAPSPEE-C-RSGLRGTDNRPL---EKILENEYQSGQSEDEDPEMSDAANGISRVGLNGRRRSLQTPDVNKVLSQGRRHSTGQAISYRLLNPETKGGR 607          

HSP 2 Score: 67.781 bits (164), Expect = 4.296e-11
Identity = 27/64 (42.19%), Postives = 50/64 (78.12%), Query Frame = 3
Query: 2106 SENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNK 2297
            ++++ ++L  L L ++ D F + E+D+ TF +L+++DLKE+GV+TFGARRK++LAI+D+  + +
Sbjct:  796 TDDLHELLNQLGLIKYIDVFEQQEIDYQTFLTLSDDDLKEVGVSTFGARRKMLLAISDLNKSKR 859          
BLAST of bicaudal-C protein vs. Ensembl Medaka
Match: ANKS6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:NCBI gene;Acc:101166507])

HSP 1 Score: 50.8322 bits (120), Expect = 6.995e-6
Identity = 21/53 (39.62%), Postives = 35/53 (66.04%), Query Frame = 3
Query: 2124 VLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDI 2282
            +L  L L ++   F + EVD   F +LT+ DLKELG+ T G R++++ AI+++
Sbjct:  818 ILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGPRQQILAAISEL 870          
BLAST of bicaudal-C protein vs. Planmine SMEST
Match: SMESG000018259.1 (SMESG000018259.1)

HSP 1 Score: 1480.69 bits (3832), Expect = 0.000e+0
Identity = 731/745 (98.12%), Postives = 731/745 (98.12%), Query Frame = 3
Query:   69 MNETILNMYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMXXXXXXKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 2303
            MNETILNMYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNY              SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII
Sbjct:    1 MNETILNMYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNY--------------SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 731          
BLAST of bicaudal-C protein vs. Planmine SMEST
Match: SMESG000018259.1 (SMESG000018259.1)

HSP 1 Score: 1468.37 bits (3800), Expect = 0.000e+0
Identity = 724/738 (98.10%), Postives = 724/738 (98.10%), Query Frame = 3
Query:   90 MYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMXXXXXXKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 2303
            MYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNY              SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII
Sbjct:    1 MYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNY--------------SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 724          
BLAST of bicaudal-C protein vs. Planmine SMEST
Match: SMESG000018259.1 (SMESG000018259.1)

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 684/745 (91.81%), Postives = 686/745 (92.08%), Query Frame = 3
Query:   69 MNETILNMYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMXXXXXXKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 2303
            MNETILNMYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFE++                              SNL               PAPTFPPMKQEKCDDSEKQKSSNY              SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII
Sbjct:    1 MNETILNMYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFELE------------------------------SNLR------------FHPAPTFPPMKQEKCDDSEKQKSSNY--------------SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 689          
BLAST of bicaudal-C protein vs. Planmine SMEST
Match: SMESG000018259.1 (SMESG000018259.1)

HSP 1 Score: 1342.02 bits (3472), Expect = 0.000e+0
Identity = 677/738 (91.73%), Postives = 679/738 (92.01%), Query Frame = 3
Query:   90 MYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMXXXXXXKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKPSGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 2303
            MYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFE++                              SNL               PAPTFPPMKQEKCDDSEKQKSSNY              SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII
Sbjct:    1 MYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTKITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNRTNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQDRLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILNHHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFPDNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPVILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQNVNALFELE------------------------------SNLR------------FHPAPTFPPMKQEKCDDSEKQKSSNY--------------SLTAIQGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIANCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNSIDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAGGNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQKMSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFIKNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII 682          
The following BLAST results are available for this feature:
BLAST of bicaudal-C protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
BICC18.844e-5637.70BicC family RNA binding protein 1 [Source:HGNC Sym... [more]
ANKS61.284e-636.21ankyrin repeat and sterile alpha motif domain cont... [more]
ANKS62.655e-636.21ankyrin repeat and sterile alpha motif domain cont... [more]
ANKS65.391e-636.21ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bcc-13.051e-1825.27BiCaudal C (Drosophila) homolog [Source:UniProtKB... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BicC7.649e-4634.83gene:FBgn0000182 transcript:FBtr0080805[more]
BicC1.054e-4534.83gene:FBgn0000182 transcript:FBtr0080804[more]
BicC1.054e-4534.83gene:FBgn0000182 transcript:FBtr0080803[more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bicc1a1.317e-5539.48BicC family RNA binding protein 1a [Source:ZFIN;Ac... [more]
bicc1a4.403e-5439.48BicC family RNA binding protein 1a [Source:ZFIN;Ac... [more]
bicc21.906e-4736.48bicaudal C homolog 2 [Source:ZFIN;Acc:ZDB-GENE-110... [more]
bicc1b2.696e-1243.55BicC family RNA binding protein 1b [Source:ZFIN;Ac... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BICC12.113e-5839.61BicC family RNA binding protein 1 [Source:NCBI gen... [more]
BICC12.180e-5839.61BicC family RNA binding protein 1 [Source:NCBI gen... [more]
BICC13.186e-5839.61BicC family RNA binding protein 1 [Source:NCBI gen... [more]
anks65.061e-636.51ankyrin repeat and sterile alpha motif domain cont... [more]
anks65.431e-636.51ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Bicc14.334e-5738.66BicC family RNA binding protein 1 [Source:MGI Symb... [more]
Bicc15.301e-5738.66BicC family RNA binding protein 1 [Source:MGI Symb... [more]
Bicc15.533e-5738.66BicC family RNA binding protein 1 [Source:MGI Symb... [more]
back to top
BLAST of bicaudal-C protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U4T7|BIC1B_XENLA9.435e-5839.61Protein bicaudal C homolog 1-B OS=Xenopus laevis O... [more]
sp|Q99MQ1|BICC1_MOUSE3.870e-5638.66Protein bicaudal C homolog 1 OS=Mus musculus OX=10... [more]
sp|Q9IA00|BIC1A_XENLA6.551e-5638.96Protein bicaudal C homolog 1-A OS=Xenopus laevis O... [more]
sp|Q9H694|BICC1_HUMAN4.247e-5537.70Protein bicaudal C homolog 1 OS=Homo sapiens OX=96... [more]
sp|Q24009|BICC_DROME1.056e-4434.83Protein bicaudal C OS=Drosophila melanogaster OX=7... [more]
back to top
BLAST of bicaudal-C protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2F3W50.000e+099.71Bicaudal-C protein (Fragment) OS=Schmidtea mediter... [more]
A0A0X3PU563.387e-6539.15Protein bicaudal C homolog 1 OS=Schistocephalus so... [more]
A0A1S3IB481.027e-5938.95protein bicaudal C homolog 1 isoform X3 OS=Lingula... [more]
A0A1S3IC981.495e-5940.65protein bicaudal C homolog 1-B isoform X1 OS=Lingu... [more]
A0A2R2MMB11.676e-5940.65protein bicaudal C homolog 1-B isoform X2 OS=Lingu... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bicc1b7.830e-5537.54BicC family RNA binding protein 1 [Source:NCBI gen... [more]
bicc1b8.315e-5437.79BicC family RNA binding protein 1 [Source:NCBI gen... [more]
bicc1a8.153e-4737.05BicC family RNA binding protein 1a [Source:ZFIN;Ac... [more]
bicc28.944e-4536.36protein bicaudal C homolog 1-like [Source:NCBI gen... [more]
bicc21.005e-4436.36protein bicaudal C homolog 1-like [Source:NCBI gen... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
BICC11.647e-5136.36BicC family RNA binding protein 1 [Source:HGNC Sym... [more]
hdlbpb6.258e-629.44high density lipoprotein binding protein b [Source... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of bicaudal-C protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO319864.944e-2532.39Bicaudal C-like protein 2; Predicted protein [Sou... [more]
EDO319851.039e-1053.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374762.479e-727.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of bicaudal-C protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bicc1a9.317e-5941.40BicC family RNA binding protein 1 [Source:NCBI gen... [more]
bicc21.130e-4029.65protein bicaudal C homolog 1 [Source:NCBI gene;Acc... [more]
bicc21.130e-4029.65protein bicaudal C homolog 1 [Source:NCBI gene;Acc... [more]
bicc21.130e-4029.65protein bicaudal C homolog 1 [Source:NCBI gene;Acc... [more]
ANKS66.995e-639.62ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of bicaudal-C protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000018259.10.000e+098.12SMESG000018259.1[more]
SMESG000018259.10.000e+098.10SMESG000018259.1[more]
SMESG000018259.10.000e+091.81SMESG000018259.1[more]
SMESG000018259.10.000e+091.73SMESG000018259.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30015067
GenBankADK78219.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015067 ID=SMED30015067|Name=bicaudal-C protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2627bp
GTTTACAAGCCCGCTCTTCAGACAATTAATTTATTAATTAATGTTTAATT
GATTTAAAATTTAATTAAATGAATGAAACCATCTTGAATATGTATCGTGT
CAATGGCTTGTGCCCAATGAGTCTGAACGGAGGCGGCAACATCAAATCGG
ACTTGACAGCTATCAATCCCAGCTTTCAGAAATCCGAACCTGACATGACA
ACAACAACAACTACGAAAATTACTAACATGAATCAGAATGATCGAGTGAC
GATGAAAATAGATGTCTCTTACACAGATCACAGCCACGTTATCGGAAAAG
GTGGACAAAGTATCAAAGCCATAATGACAGATACCCAATGCCATATTCAT
TTCCCAGATTCGAATCGTACAAACACAATTGAAAAAAGTAATCAAGTCTC
TATTTCTGGAATGTCTTATGGTGTTGAGATAGCGAGACAAAAAATACGAG
CAATATTACCTTTAATATATTCTTTTGACATACCTTTTACTCCATTTAAC
GTTATTGAACAGCAAGATCGCTTACTAATGGCTCAGCTGCAACGGCTTCT
GGAAGTAACAATATCATACAAACCGATAGGGAAATTATTAAGCGGTACAA
CTATATTTGTTAAAGGAATTGTGCAAAGAGCCAGGCAAACCATCAAAGCT
GTAAACTTAATACTAAATCATCATTTTGGACAGAATATTGATCAAGTACC
TGTAATGATGACTATTGAAATTGATCCGAAACATCACTCATTTTTATTAA
ATCAAGGCGGACAGAATAGCTTAGTAAACGAAATTTTTCAGTTAACAAGA
GCTACAATAAATTTCCCCGACAATACTTTTTCTTCAGCTCATGCTGTCTT
AGCCGCGAACAACCCAATGGGAATATCAGGTTTATTCAAAAAATCCACTG
TAAATATTCTTGGAACTGCTGAAAACACATTCGAAGCCAGGCAGCAATTA
ATTGGTCGGTTACCAGTGATATTGATGTATGATATTACCATTGAGGAAGG
GGTTAATCTGGAGATGTTTAATTTAAATTTTATAAATGAAAGATACGACG
TAGCAATTAGTATCAAGTTAAAGTTGAAACAATGCACCAAGTCAGTTATT
ATAAGAACTACTGAACAAAATGTAAATGCTTTATTTGAAGTAAAAAATAT
TTTAAATAAATTGCGAACTCAATATAAACCTCCGATTCAAGCTGGAGTCA
AACCTCCGATTCCGTCATGGATGAATAAAGTATTTAGCAATTTAACAAAT
TTATCCAGTGAAAAACCTAGCGGGGTCAGTTTTGTAGACCCGGCTCCAAC
TTTTCCGCCGATGAAACAAGAAAAATGCGACGATTCTGAAAAACAGAAAT
CATCAAATTATGTACTTCTAAATGAAAATGAAACACTTTTGACAGATTTT
AAGTCTTTAACTGCGATTCAAGGCAATATTCAAATGCACATTGACAATGG
AATTGCTTTTGGAAAACAAATGAATATGGCTAAAATTTCGTCCTTGTTGT
CCGCTTCAAGAATTCATAACAGTCATTTACTCATAAATCCACAAACTAAT
AGTAATAAAGAAATCGCAAACTGTCCTATTCCATGCAATGGGGAGTCGAC
CTCAGTTTTACCGACTGAATATGTTCAGATACGTCAAAATAATTCTGCTG
AACCCATTTCAAACAATAACACAAATAACTTAGAGAAAGAAATTGATCTC
AATGTCTTTTCGAATTCAATTGACTTTAATCCGACCAATGTCAATCTAAA
TATATCAGACTGGAGAGCTCCTGGAGCTGAATATTCCGCAAAACAGAGAG
AACTGAAAAGGTTTATGTGCAATTCGCCTACTAGTTCGTTGTCAGATGGA
TGCAAACAAAACGCAGGAGGAAATTTCATGCAAATTCATGATTCGAGTGA
AATAAATGAAAATGTGAAATACGTTAAAAATGGATATGATAACGCGGAAA
AAGTCACTAAAATTATTAATGAGGAAAATGTCTACAAACAATCAGCCTAC
GAAAATATACTTCAAAAGATGTCGTTGGATATAGACGGAAATATGGCGAA
TAATAAATTTGACTTTCTTAATTTCAACAGCAAAACTGAACGGGCAAAAA
ACAGCTCTGAAAATGTTGTGAAGGTGCTAACAAGTCTTGATTTGAGCAGA
TTTGCCGATTGTTTCATCAAAAACGAAGTAGACTTTAACACATTTTGTAG
TCTGACTGAAGAAGACCTAAAGGAACTTGGAGTTAACACTTTTGGGGCAC
GAAGGAAGCTAGTATTGGCCATAAATGATATTACTTCCAACAATAAAATA
ATATGATAATTTTGTGTACATTTTTTCCCATTTTATGAACTTGGAGACTT
TAGATAAAATGGTTAATTTTATTTTTATTGTATTAATTGTTGGTTATTTT
GTAAATGAAAGAAAATTGGATATTACTTAAATGTATTTTATATTTGAACG
TATAGTTTTATATATGGATCAGTTTAATTATTAGTTGTATATCAGTATGA
ACGTATATAAATTTTAATATGATATTTGGTTGTTAGAATGGATTAACGTA
GCAATATATCTATTCTTATTGGTTTTTATTATAATATTTTGATGTATATA
TAATAATGAAATAATGTTTAATGTTAT
back to top

protein sequence of SMED30015067-orf-1

>SMED30015067-orf-1 ID=SMED30015067-orf-1|Name=SMED30015067-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=746bp
MNETILNMYRVNGLCPMSLNGGGNIKSDLTAINPSFQKSEPDMTTTTTTK
ITNMNQNDRVTMKIDVSYTDHSHVIGKGGQSIKAIMTDTQCHIHFPDSNR
TNTIEKSNQVSISGMSYGVEIARQKIRAILPLIYSFDIPFTPFNVIEQQD
RLLMAQLQRLLEVTISYKPIGKLLSGTTIFVKGIVQRARQTIKAVNLILN
HHFGQNIDQVPVMMTIEIDPKHHSFLLNQGGQNSLVNEIFQLTRATINFP
DNTFSSAHAVLAANNPMGISGLFKKSTVNILGTAENTFEARQQLIGRLPV
ILMYDITIEEGVNLEMFNLNFINERYDVAISIKLKLKQCTKSVIIRTTEQ
NVNALFEVKNILNKLRTQYKPPIQAGVKPPIPSWMNKVFSNLTNLSSEKP
SGVSFVDPAPTFPPMKQEKCDDSEKQKSSNYVLLNENETLLTDFKSLTAI
QGNIQMHIDNGIAFGKQMNMAKISSLLSASRIHNSHLLINPQTNSNKEIA
NCPIPCNGESTSVLPTEYVQIRQNNSAEPISNNNTNNLEKEIDLNVFSNS
IDFNPTNVNLNISDWRAPGAEYSAKQRELKRFMCNSPTSSLSDGCKQNAG
GNFMQIHDSSEINENVKYVKNGYDNAEKVTKIINEENVYKQSAYENILQK
MSLDIDGNMANNKFDFLNFNSKTERAKNSSENVVKVLTSLDLSRFADCFI
KNEVDFNTFCSLTEEDLKELGVNTFGARRKLVLAINDITSNNKII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0003116parenchymal cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR004087KH_dom
IPR001660SAM
IPR004088KH_dom_type_1
IPR013761SAM/pointed_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 58..131
e-value: 5.1E-15
score: 65.9
coord: 210..299
e-value: 0.82
score: 16.3
IPR001660Sterile alpha motif domainSMARTSM00454SAM_4coord: 675..741
e-value: 2.4E-8
score: 43.7
IPR001660Sterile alpha motif domainPFAMPF00536SAM_1coord: 678..737
e-value: 7.0E-10
score: 39.2
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 678..741
score: 13.298
NoneNo IPR availableGENE3DG3DSA:3.30.310.270coord: 38..181
e-value: 1.1E-20
score: 75.7
coord: 189..371
e-value: 4.2E-12
score: 47.7
NoneNo IPR availablePANTHERPTHR10627SCP160coord: 580..743
NoneNo IPR availablePANTHERPTHR10627SCP160coord: 58..618
NoneNo IPR availablePANTHERPTHR10627:SF39PROTEIN BICAUDAL C HOMOLOG 1coord: 58..618
NoneNo IPR availablePANTHERPTHR10627:SF39PROTEIN BICAUDAL C HOMOLOG 1coord: 580..743
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 59..126
score: 13.858
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 61..127
e-value: 9.60209E-15
score: 67.1517
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 668..743
e-value: 1.1E-15
score: 59.4
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 679..738
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 63..127
e-value: 8.7E-14
score: 51.1
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 211..298
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 55..130