G protein regulated inducer of neurite outgrowth

Overview
NameG protein regulated inducer of neurite outgrowth
Smed IDSMED30015061
Length (bp)2408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G protein regulated inducer of neurite outgrowth (SMED30015061) t-SNE clustered cells

Violin plots show distribution of expression levels for G protein regulated inducer of neurite outgrowth (SMED30015061) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G protein regulated inducer of neurite outgrowth (SMED30015061) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G protein regulated inducer of neurite outgrowth (SMED30015061) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015061

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30015061SMESG000062691.1 SmedASXL_011446SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015061SMESG000062691.1 dd_Smed_v4_10294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015061SMESG000062691.1 Contig37974newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015061SMESG000062691.1 Contig37974uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30015061SMESG000062691.1 dd_Smed_v6_10294_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30015061SMESG000062691.1 SMED30015061smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30015061SMESG000062691.1 OX_Smed_1.0.19130ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Zebrafish
Match: si:dkeyp-123h10.2 (si:dkeyp-123h10.2 [Source:ZFIN;Acc:ZDB-GENE-090313-376])

HSP 1 Score: 51.9878 bits (123), Expect = 2.731e-6
Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 3
Query: 1500 KQYLVEMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLE 1691
            K+ + E   +DE+EN A +  +S+        ++ +DE G TWE+YGA  DPE LG AIQ+HL+
Sbjct:  474 KKLMPEKDDQDEEEN-AKQSKKSVH-------DVVWDEQGMTWEVYGASVDPESLGFAIQSHLQ 529          
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Xenopus
Match: mrps7 (mitochondrial ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-974637])

HSP 1 Score: 52.7582 bits (125), Expect = 2.411e-6
Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 3
Query: 1593 KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLER 1694
            K++ +DE G TWE+YGA  DPE LG AIQ HL+R
Sbjct:  632 KDVVWDEQGMTWEVYGASMDPEALGIAIQNHLQR 665          
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Xenopus
Match: nrarp (NOTCH regulated ankyrin repeat protein [Source:Xenbase;Acc:XB-GENE-996958])

HSP 1 Score: 52.373 bits (124), Expect = 3.136e-6
Identity = 25/48 (52.08%), Postives = 33/48 (68.75%), Query Frame = 3
Query: 1551 PEDTESLQLLPLLP-KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLE 1691
            PE   +LQ  P  P +E+ +D+ G TWE+YGA  DPE+LG AIQ HL+
Sbjct:  489 PEVGLALQC-PRSPVREVRWDDEGMTWEVYGASMDPEVLGLAIQKHLD 535          
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Mouse
Match: Gprin2 (G protein regulated inducer of neurite outgrowth 2 [Source:MGI Symbol;Acc:MGI:2444560])

HSP 1 Score: 50.447 bits (119), Expect = 7.538e-6
Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 3
Query: 1593 KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLE 1691
            +++ +D  G TWE+YGA  DPE+LG AIQ HLE
Sbjct:  377 RDVRWDAEGMTWEVYGASVDPEVLGIAIQKHLE 409          
BLAST of G protein regulated inducer of neurite outgrowth vs. UniProt/SwissProt
Match: sp|Q9PWA3|GRIN2_CHICK (GRIN2-like protein OS=Gallus gallus OX=9031 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 8.327e-6
Identity = 20/33 (60.61%), Postives = 26/33 (78.79%), Query Frame = 3
Query: 1593 KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLE 1691
            +E+ +D+ G TWE+YGA  DPE+LG AIQ HLE
Sbjct:  428 REVRWDDEGMTWEVYGASVDPEVLGLAIQKHLE 460          
BLAST of G protein regulated inducer of neurite outgrowth vs. TrEMBL
Match: A0A0R3W0V8 (GRIN_C domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3329 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.861e-9
Identity = 42/110 (38.18%), Postives = 63/110 (57.27%), Query Frame = 3
Query: 1371 RKVSAIAEEIESHAPTEYERRSSLANTQYDTIDKETLGKQTMEKQYLVEMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLM 1700
            R   A A  I+S APTE  RR S +    + +++    KQ  +KQ             ++ EDT+ +    + P+E+ +D+ GQTWEIYGAD DP  LGQAI++HLE+++
Sbjct:  177 RDSQAEATSIQSKAPTE--RRLSTSAPHLEALEQHHRDKQ--KKQAA-----------ASTEDTKKIISRSVRPREVNYDDQGQTWEIYGADQDPNALGQAIESHLEKMI 271          
BLAST of G protein regulated inducer of neurite outgrowth vs. TrEMBL
Match: R7VD02 (GRIN_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223299 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.023e-9
Identity = 69/210 (32.86%), Postives = 96/210 (45.71%), Query Frame = 3
Query: 1125 SNDNGIICTDMDLKAIINSFKREES----SLSINSNNAGQEKLKLSAN----ISKTPTASSSVIGPGFGKRKLMRKQVSFDDEQGVMMINRKVSAIAEEIESHAPTEY--ERRSSLAN--TQYDTIDKETLGKQ----TMEKQYLVEMTKEDEDENSAPEDTESLQLLPLLP-KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLMI 1703
            S+D+G+IC+ +DLKA+   FK+  S       + S +  Q KL  S N    +S   +A SSV     GK         +D E            + E + S  P+EY  + R  L       D     T+G      T++   L+          S  E T   Q  PL P  EI FD  GQTW++YGA+ DPE+LG+AIQ HL +LM+
Sbjct:  396 SSDSGVICSSVDLKAMKTDFKKRRSPRPSKQDLRSLSVDQTKLLDSQNSMESVSSGYSAQSSV---SAGK---------YDAE------------VDEGLTSDTPSEYSAQMRQPLVPRIVGGDGSQNRTVGDGGQNITLQNATLLY--------GSLDESTPGCQDEPLKPIPEIVFDAQGQTWDVYGAEFDPEVLGEAIQRHLVKLML 573          
BLAST of G protein regulated inducer of neurite outgrowth vs. TrEMBL
Match: A0A0R3SV56 (GRIN_C domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9430 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.017e-8
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 3
Query: 1515 EMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLM 1700
            E+  +    N++  +  S  +  + P+E+ +DE GQTWEIYGAD DP  LGQAI+ HLE++M
Sbjct:  211 ELEIKKNQSNTSSTEAGSFVVKSIRPREVSYDEKGQTWEIYGADQDPNALGQAIENHLEKMM 272          
BLAST of G protein regulated inducer of neurite outgrowth vs. TrEMBL
Match: A0A068Y9L5 (G protein regulated inducer of neurite outgrowth OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.875e-8
Identity = 38/113 (33.63%), Postives = 62/113 (54.87%), Query Frame = 3
Query: 1362 MINRKVSAIAEEIESHAPTEYERRSSLANTQYDTIDKETLGKQTMEKQYLVEMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLM 1700
            ++ R   A  E I+S    ++ERR S +    D +++  + KQ  +    +E TK+   + + P             +E+ +D+ GQTWEIYGAD DP  LGQAI++HLE+++
Sbjct:  251 LLFRDSQAEVESIKS--KEQWERRLSTSALHLDGLEQHHIEKQKKQAAATIEDTKKTFSKGNRP-------------REVNYDDQGQTWEIYGADQDPNALGQAIESHLEKMI 348          
BLAST of G protein regulated inducer of neurite outgrowth vs. TrEMBL
Match: W6V7I8 (G protein-regulated inducer of neurite outgrowth 3 OS=Echinococcus granulosus OX=6210 GN=EGR_02872 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.600e-8
Identity = 38/113 (33.63%), Postives = 61/113 (53.98%), Query Frame = 3
Query: 1362 MINRKVSAIAEEIESHAPTEYERRSSLANTQYDTIDKETLGKQTMEKQYLVEMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLM 1700
            ++ R   A  E I+S  P   ERR S +    D +++  + KQ  +    +E T++   + + P             +E+ +D+ GQTWEIYGAD DP  LGQAI++HLE+++
Sbjct:  174 LLFRDSQAEVESIKSKEP--RERRLSTSALHLDGLEQHHMDKQKKQVAATIEDTRKTFSKGNRP-------------REVNYDDQGQTWEIYGADQDPNALGQAIESHLEKMI 271          
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Cavefish
Match: ENSAMXT00000025937.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:6690721:6698708:-1 gene:ENSAMXG00000025211.2 transcript:ENSAMXT00000025937.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.635e-6
Identity = 22/33 (66.67%), Postives = 25/33 (75.76%), Query Frame = 3
Query: 1593 KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLE 1691
            KE+E+D  G TWE+YGA  DPE LG AIQ HLE
Sbjct:  411 KEVEWDAEGMTWEVYGASLDPEELGLAIQRHLE 443          
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Cavefish
Match: si:dkey-191g9.7 (uncharacterized LOC103041404 [Source:NCBI gene;Acc:103041404])

HSP 1 Score: 51.6026 bits (122), Expect = 2.873e-6
Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = 3
Query: 1593 KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLE 1691
            KE+++D  G TWE+YGA  DPE LG AIQ HLE
Sbjct:  401 KEVKWDAEGMTWEVYGASVDPEELGLAIQKHLE 433          
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Medaka
Match: si:dkey-191g9.7 (G protein regulated inducer of neurite outgrowth 2 [Source:NCBI gene;Acc:105357946])

HSP 1 Score: 50.0618 bits (118), Expect = 5.480e-6
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query: 1593 KEIEFDEYGQTWEIYGADPDPEILGQAIQTHLE 1691
            K++++D  G TWE+YGA  DPE LG AIQ HLE
Sbjct:  264 KDVKWDAEGMTWEVYGASVDPEELGLAIQRHLE 296          
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Medaka
Match: ENSORLT00000028169.1 (G protein-regulated inducer of neurite outgrowth 3-like [Source:NCBI gene;Acc:105354446])

HSP 1 Score: 49.6766 bits (117), Expect = 9.698e-6
Identity = 23/48 (47.92%), Postives = 31/48 (64.58%), Query Frame = 3
Query: 1596 EIEFDEYGQTWEIYGADPDPEILGQAIQTHL-------ERLMICRQSL 1718
            ++ +DE G TWE+YGA  DPE LG AIQ+HL       ER +I + S+
Sbjct:  325 DVVWDEQGMTWEVYGASVDPESLGFAIQSHLQCKIKEQERKLIVQTSI 372          
BLAST of G protein regulated inducer of neurite outgrowth vs. Planmine SMEST
Match: SMESG000062691.1 (SMESG000062691.1)

HSP 1 Score: 1159.05 bits (2997), Expect = 0.000e+0
Identity = 594/598 (99.33%), Postives = 594/598 (99.33%), Query Frame = 3
Query:  180 MSVLGYDNSNKSLNNIYVDIPLTNNRLRQRRSLDYGKSGFILAGPNRQKSFTTXXXXXXXXXXXXXXCNFNSSAPIPKPQISIRRQSSERCLIKRHSVDSNKSNISDPGYSLINTKNCAGSNFLIPSQQRSPKESNSPRSYYSSVASVAGRQASYASISLLSRQNSINSSNLMGKQQSNDNLENRKWFSSSSVILTRVKSMKDKFRRVVVQSVQPDDWPPPSILFSERYRYPXXXXXXXXXXXXKFSQNMHKETAHLIKSKSVDQSSFPSSINNSNRKSTRNPNPAGSGRQFKRGKLQRSMTAYSSTNDPLEHITSNDNGIICTDMDLKAIINSFKREESSLSINSNNAGQEKLKLSANISKTPTASSSVIGPGFGKRKLMRKQVSFDDEQGVMMINRKVSAIAEEIESHAPTEYERRSSLANTQYDTIDKETLGKQTMEKQYLVEMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLMICRQSLTISNGNANISKPKVPDDFGLTKTEIPKRILKPLRVDLESSENHLRLIARRLCGKWSCFSDSRQQSNSSKFTGIGQKITVSVDKES 1973
            MSVLGYDNSNKSLNNIYVDIPLTNNRLRQRRSLDYGKSGFILAGPNRQKSF TSHHYSIPSSPSHNSCNFNSSAPI KPQISIRRQSSERCLIKRHSVDSNKSNISDPGYSLINTKNCAGSNFLIPSQQRSPKESNSPRSYYSSVASVAGRQASYASISLLSRQNSINSSNLMGKQQSNDNLENRKWFSSSSVILTRVKSMKDKFRRVVVQSVQPDDWPPPSILFSERYRYPSSSSCQSANVSSKFSQNMHKETAHLIKSKSVDQSSFPSSINNSNRKSTRNPNPAGSGRQFKRGKLQRSMTAYSSTNDPLEHITSNDNGIICTDMDLKAIINSFKREESSLSINSNNAGQEKLKLSANISKTPTASSSVIGPGFGKRKLMRKQVSFDDEQGVMMINRKVSAIAEEIESHAPTEYERRSSLANTQYDT DKETLGKQTMEKQYLVEMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLMICRQSLTISNGNANISKPKVPDDFGLTKTEIP RILKPLRVDLESSENHLRLIARRLCGKWSCFSDSRQQSNSSKFTGIGQKITVSVDKES
Sbjct:    1 MSVLGYDNSNKSLNNIYVDIPLTNNRLRQRRSLDYGKSGFILAGPNRQKSFNTSHHYSIPSSPSHNSCNFNSSAPISKPQISIRRQSSERCLIKRHSVDSNKSNISDPGYSLINTKNCAGSNFLIPSQQRSPKESNSPRSYYSSVASVAGRQASYASISLLSRQNSINSSNLMGKQQSNDNLENRKWFSSSSVILTRVKSMKDKFRRVVVQSVQPDDWPPPSILFSERYRYPSSSSCQSANVSSKFSQNMHKETAHLIKSKSVDQSSFPSSINNSNRKSTRNPNPAGSGRQFKRGKLQRSMTAYSSTNDPLEHITSNDNGIICTDMDLKAIINSFKREESSLSINSNNAGQEKLKLSANISKTPTASSSVIGPGFGKRKLMRKQVSFDDEQGVMMINRKVSAIAEEIESHAPTEYERRSSLANTQYDTTDKETLGKQTMEKQYLVEMTKEDEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQTHLERLMICRQSLTISNGNANISKPKVPDDFGLTKTEIPNRILKPLRVDLESSENHLRLIARRLCGKWSCFSDSRQQSNSSKFTGIGQKITVSVDKES 598          
The following BLAST results are available for this feature:
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-123h10.22.731e-642.19si:dkeyp-123h10.2 [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrps72.411e-661.76mitochondrial ribosomal protein S7 [Source:Xenbase... [more]
nrarp3.136e-652.08NOTCH regulated ankyrin repeat protein [Source:Xen... [more]
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gprin27.538e-657.58G protein regulated inducer of neurite outgrowth 2... [more]
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9PWA3|GRIN2_CHICK8.327e-660.61GRIN2-like protein OS=Gallus gallus OX=9031 PE=1 S... [more]
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W0V81.861e-938.18GRIN_C domain-containing protein OS=Taenia asiatic... [more]
R7VD025.023e-932.86GRIN_C domain-containing protein OS=Capitella tele... [more]
A0A0R3SV562.017e-845.16GRIN_C domain-containing protein OS=Hymenolepis di... [more]
A0A068Y9L52.875e-833.63G protein regulated inducer of neurite outgrowth O... [more]
W6V7I83.600e-833.63G protein-regulated inducer of neurite outgrowth 3... [more]
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000025937.21.635e-666.67pep primary_assembly:Astyanax_mexicanus-2.0:4:6690... [more]
si:dkey-191g9.72.873e-663.64uncharacterized LOC103041404 [Source:NCBI gene;Acc... [more]
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-191g9.75.480e-660.61G protein regulated inducer of neurite outgrowth 2... [more]
ENSORLT00000028169.19.698e-647.92G protein-regulated inducer of neurite outgrowth 3... [more]
back to top
BLAST of G protein regulated inducer of neurite outgrowth vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000062691.10.000e+099.33SMESG000062691.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015061 ID=SMED30015061|Name=G protein regulated inducer of neurite outgrowth|organism=Schmidtea mediterranea sexual|type=transcript|length=2408bp
TCTTCCGATCTCTATCCCATCAGCTTTATAAAATTTCTTTCAGAAATGGA
TGTATTTAGATTCAAGGTAAAAATCGTACACTAGTCATATGATGAGCAGG
CAACAATACTTGTGCTTCAAAGCGATGCCCACTTTTTAAAATTTGAGAAA
TCAATTACAGAATACTGGAAGCACTCTGAATGTCTGTTTTGGGATATGAT
AACTCTAATAAATCGTTGAACAACATTTATGTAGATATACCGTTGACAAA
TAACCGTCTTCGACAGAGGCGAAGTTTAGATTATGGAAAGAGTGGGTTCA
TTTTGGCCGGTCCAAATCGACAGAAATCATTTACTACTAGCCATCATTAT
TCAATTCCTAGTAGTCCATCTCATAACAGTTGTAATTTTAATTCTTCAGC
ACCTATTCCGAAACCTCAAATATCTATTCGTCGACAAAGCAGTGAACGAT
GTTTGATCAAACGGCATTCGGTTGATTCCAATAAATCAAATATTTCTGAT
CCAGGTTATTCGCTGATAAATACGAAAAATTGCGCAGGCAGTAATTTTTT
AATTCCTTCCCAACAGAGATCACCCAAAGAGTCGAATTCTCCTCGTTCAT
ACTATTCCTCTGTAGCATCAGTAGCTGGTAGACAAGCATCATACGCGTCT
ATTAGTTTACTGAGTAGACAGAATTCCATTAATTCATCGAATCTCATGGG
AAAACAGCAGTCAAATGACAATCTAGAAAACAGAAAATGGTTTAGCTCTT
CGTCTGTGATTTTAACTCGCGTAAAATCAATGAAAGACAAATTTCGTCGA
GTCGTAGTTCAATCAGTTCAACCTGACGACTGGCCACCTCCAAGCATTCT
GTTCTCGGAAAGATACCGATACCCTAGCTCTTCTAGTTGTCAGTCTGCAA
ATGTTTCATCAAAGTTCTCTCAGAATATGCACAAAGAAACTGCTCATTTA
ATAAAAAGTAAATCAGTAGACCAATCGTCTTTTCCGAGTTCCATAAACAA
CAGTAATCGAAAGTCAACGAGAAATCCTAATCCGGCTGGTTCTGGAAGAC
AATTTAAGCGCGGAAAATTGCAGCGATCAATGACGGCATATAGCTCTACA
AATGATCCCTTGGAACATATCACTAGCAATGATAATGGCATTATTTGTAC
TGACATGGATTTGAAGGCTATTATCAACAGCTTCAAACGAGAAGAATCAA
GCTTATCAATAAATTCCAACAATGCAGGACAAGAAAAACTAAAACTTTCG
GCTAACATTTCAAAAACCCCTACTGCCTCTTCATCGGTGATAGGGCCGGG
ATTTGGTAAACGAAAACTAATGAGAAAACAAGTCTCATTTGATGATGAAC
AAGGAGTCATGATGATAAATAGAAAAGTGAGTGCTATTGCTGAAGAGATC
GAATCTCACGCTCCAACTGAATACGAAAGACGTTCAAGCTTAGCAAATAC
TCAATATGATACAATCGATAAAGAAACTTTAGGAAAACAAACAATGGAAA
AACAATATCTTGTAGAAATGACTAAAGAAGATGAAGATGAAAATTCAGCT
CCAGAAGACACAGAAAGTCTTCAGTTGTTGCCTCTGTTACCGAAAGAAAT
TGAATTCGACGAATACGGTCAGACGTGGGAAATATACGGCGCTGATCCAG
ATCCGGAAATATTAGGTCAAGCTATTCAAACGCATTTAGAACGATTGATG
ATTTGCCGACAAAGCCTAACGATTTCCAATGGAAACGCCAACATTTCCAA
ACCGAAAGTTCCAGATGATTTTGGCCTGACGAAAACCGAAATTCCTAAGC
GAATATTGAAACCATTGAGAGTCGATTTGGAATCTTCAGAGAATCATTTG
CGATTAATAGCTCGTCGGTTGTGTGGAAAATGGTCTTGTTTCTCCGATAG
CCGACAGCAATCAAATTCTTCTAAATTTACAGGGATTGGTCAGAAAATAA
CCGTTTCCGTGGACAAGGAGTCTTAAATTGGATTTTTGATGAAATCCCTG
CAGCTCACTTTCGATAGGCTTGTGAAAAACAAAAATTTACTTTCATTCCT
GAATATAATAATGTTCAAAACTATCTTTGTCAGTCATGTACTTGTGGTGA
TATAAATGAAAGTAGTTTGGTAACGGTTTATATGCTTTCAAGTATATATT
ATAGATGATTCCAAATCTTTTACCGAGTCCAATCTCTACGCCATCCGAAG
ATGTCTAACAACACCGTATTGGGCACAAGTTGCTTGCGCGCCATGTATAA
ACGTTAAAGTTTTGTTCACGATCAAGGACTCCCGTACATCGTAAACAAGA
ATTACTGACTCGAGCAACAAAAAAATTAGCAGAGACCGTATGAGCCAAGT
TCTTTGGTAACTTGTTTAATTTATTCTGGATTTCAAACCAAAAAGTTTTG
TTATTTTA
back to top

protein sequence of SMED30015061-orf-1

>SMED30015061-orf-1 ID=SMED30015061-orf-1|Name=SMED30015061-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=599bp
MSVLGYDNSNKSLNNIYVDIPLTNNRLRQRRSLDYGKSGFILAGPNRQKS
FTTSHHYSIPSSPSHNSCNFNSSAPIPKPQISIRRQSSERCLIKRHSVDS
NKSNISDPGYSLINTKNCAGSNFLIPSQQRSPKESNSPRSYYSSVASVAG
RQASYASISLLSRQNSINSSNLMGKQQSNDNLENRKWFSSSSVILTRVKS
MKDKFRRVVVQSVQPDDWPPPSILFSERYRYPSSSSCQSANVSSKFSQNM
HKETAHLIKSKSVDQSSFPSSINNSNRKSTRNPNPAGSGRQFKRGKLQRS
MTAYSSTNDPLEHITSNDNGIICTDMDLKAIINSFKREESSLSINSNNAG
QEKLKLSANISKTPTASSSVIGPGFGKRKLMRKQVSFDDEQGVMMINRKV
SAIAEEIESHAPTEYERRSSLANTQYDTIDKETLGKQTMEKQYLVEMTKE
DEDENSAPEDTESLQLLPLLPKEIEFDEYGQTWEIYGADPDPEILGQAIQ
THLERLMICRQSLTISNGNANISKPKVPDDFGLTKTEIPKRILKPLRVDL
ESSENHLRLIARRLCGKWSCFSDSRQQSNSSKFTGIGQKITVSVDKES*
back to top
Aliases
The feature 'G protein regulated inducer of neurite outgrowth' has the following synonyms
Synonym
Smed_21613
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026646GPRIN2-like/GPRIN3
IPR032745GRIN_C
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0030426growth cone
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0031175neuron projection development
Vocabulary: molecular function
TermDefinition
GO:0051219phosphoprotein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032745G protein-regulated inducer of neurite outgrowth, C-terminalPFAMPF15235GRIN_Ccoord: 437..514
e-value: 1.1E-11
score: 45.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 260..287
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 258..306
NoneNo IPR availablePANTHERPTHR15718:SF3coord: 472..516
IPR026646G protein-regulated inducer of neurite outgrowthPANTHERPTHR15718UNCHARACTERIZEDcoord: 472..516