Transitional endoplasmic reticulum ATPase

Overview
NameTransitional endoplasmic reticulum ATPase
Smed IDSMED30015057
Length (bp)2587
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transitional endoplasmic reticulum ATPase (SMED30015057) t-SNE clustered cells

Violin plots show distribution of expression levels for Transitional endoplasmic reticulum ATPase (SMED30015057) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transitional endoplasmic reticulum ATPase (SMED30015057) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transitional endoplasmic reticulum ATPase (SMED30015057) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 175.252 bits (443), Expect = 2.382e-45
Identity = 89/241 (36.93%), Postives = 148/241 (61.41%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +   ++ W+DIG  ++++E+L   I+  V++ ++F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +KNGT P        + + ++E +   +  D +T     +DL+AL+ E+
Sbjct:  376 VTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQ--QVFIMAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRLAILKTITKNGTKPPL------DADVNLEAIAGDLRCDCYT----GADLSALVREA 603          

HSP 2 Score: 128.642 bits (322), Expect = 5.158e-30
Identity = 66/181 (36.46%), Postives = 112/181 (61.88%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            L+ +  ++K+ D+GG+D   +++  ++ +++  E ++        GV+L+GPPGCGKT+LA A++ E +   + ++  +I+S   GESE+ +RE F  A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:   58 LEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIP 238          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 174.866 bits (442), Expect = 3.486e-45
Identity = 89/241 (36.93%), Postives = 148/241 (61.41%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +   ++ W+DIG  ++++E+L   I+  V++ ++F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +KNGT P        + + ++E +   +  D +T     +DL+AL+ E+
Sbjct:  384 VTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQ--QVFIMAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRLAILKTITKNGTKPPL------DADVNLEAIAGDLRCDCYT----GADLSALVREA 611          

HSP 2 Score: 115.161 bits (287), Expect = 9.512e-26
Identity = 67/208 (32.21%), Postives = 111/208 (53.37%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCA---------------------------DILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            L+ +  ++K+ D+GG+D   +++  ++ +++  E ++        GV+L+GPPGCGKT+LA A++       +T  C+                           +I+S   GESE+ +RE F  A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:   39 LEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGAECSGMITAHCSFDFSGSNDPPASASQELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIP 246          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 174.866 bits (442), Expect = 3.486e-45
Identity = 89/241 (36.93%), Postives = 148/241 (61.41%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +   ++ W+DIG  ++++E+L   I+  V++ ++F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +KNGT P        + + ++E +   +  D +T     +DL+AL+ E+
Sbjct:  384 VTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQ--QVFIMAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRLAILKTITKNGTKPPL------DADVNLEAIAGDLRCDCYT----GADLSALVREA 611          

HSP 2 Score: 115.161 bits (287), Expect = 9.512e-26
Identity = 67/208 (32.21%), Postives = 111/208 (53.37%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCA---------------------------DILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            L+ +  ++K+ D+GG+D   +++  ++ +++  E ++        GV+L+GPPGCGKT+LA A++       +T  C+                           +I+S   GESE+ +RE F  A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:   39 LEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGAECSGMITAHCSFDFSGSNDPPASASQELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIP 246          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 174.866 bits (442), Expect = 8.201e-45
Identity = 89/241 (36.93%), Postives = 148/241 (61.41%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +   ++ W+DIG  ++++E+L   I+  V++ ++F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +KNGT P        + + ++E +   +  D +T     +DL+AL+ E+
Sbjct:  467 VTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQ--QVFIMAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRLAILKTITKNGTKPPL------DADVNLEAIAGDLRCDCYT----GADLSALVREA 694          

HSP 2 Score: 128.257 bits (321), Expect = 8.374e-30
Identity = 66/181 (36.46%), Postives = 112/181 (61.88%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            L+ +  ++K+ D+GG+D   +++  ++ +++  E ++        GV+L+GPPGCGKT+LA A++ E +   + ++  +I+S   GESE+ +RE F  A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  149 LEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIP 329          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 174.481 bits (441), Expect = 1.183e-44
Identity = 89/241 (36.93%), Postives = 148/241 (61.41%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +   ++ W+DIG  ++++E+L   I+  V++ ++F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +KNGT P        + + ++E +   +  D +T     +DL+AL+ E+
Sbjct:  482 VTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQ--QVFIMAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRLAILKTITKNGTKPPL------DADVNLEAIAGDLRCDCYT----GADLSALVREA 709          

HSP 2 Score: 127.872 bits (320), Expect = 1.112e-29
Identity = 66/181 (36.46%), Postives = 112/181 (61.88%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            L+ +  ++K+ D+GG+D   +++  ++ +++  E ++        GV+L+GPPGCGKT+LA A++ E +   + ++  +I+S   GESE+ +RE F  A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  164 LEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIP 344          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: mac-1 (pep chromosome:WBcel235:II:13311459:13320911:-1 gene:WBGene00003119.1 transcript:Y48C3A.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mac-1)

HSP 1 Score: 174.481 bits (441), Expect = 6.216e-45
Identity = 124/402 (30.85%), Postives = 204/402 (50.75%), Query Frame = 1
Query:  874 ASSKFLMIFESSDP----GSLVKNANWS--IEFPIIDKLNREKYLKHFL-IEVNGDIWNCEEMARLTPGYQIGEIEAL---CTKLKM------------AYKGNPLIDIADEFNRIIA--------------SGEIKLKIK--------------------TDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFY------KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENV-FSQISSDDFTEDWSHSDLAALIAES 1887
            A +  L+I  +S P    G L +   +   I   I D+  REK L+    + + GD+   +++A+LTPGY   +++AL     K+ +             +K   +  I +E +R++A              +G +++  +                      D+ W DIG   EV+++L+ +I+  +K  + F       +  G++L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR  F  AR SQPC++F DEIDAL  KR          +VN  L EMDG++  +  ++ +IGATN  + +D AI R GRL +++ V+ P S + R+ +L  ++KNGT P  G           E++ F +I+       ++ +DLAALI ES
Sbjct:  367 AGAGVLVIGTTSRPDAVDGGLRRAGRFENEISLGIPDETAREKILEKICKVNLAGDV-TLKQIAKLTPGYVGADLQALIREAAKVAIDRVFDTIVVKNEGHKNLTVEQIKEELDRVLAWLQGDDDPSALSELNGGLQISFEDFERALSTIQPAAKREGFATVPDVSWDDIGALVEVRKQLEWSILYPIKRADDFAALGIDCRPQGILLCGPPGCGKTLLAKAVANETGMNFISVKGPELLNMYVGESERAVRTVFQRARDSQPCVIFFDEIDALVPKRSHGESSGGARLVNQLLTEMDGVEGRQ--KVFLIGATNRPDIVDAAILRPGRLDKILFVDFP-SVEDRVDILRKSTKNGTRPMLG-----------EDIDFHEIAQLPELAGFTGADLAALIHES 753          

HSP 2 Score: 93.9745 bits (232), Expect = 2.387e-19
Identity = 64/264 (24.24%), Postives = 116/264 (43.94%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGI---------------------------DSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQ 1893
            +K+  IGG D    ++  +  ++K  + F         G I++GPPGCGKTM A+A++ E     + ++  +++S   GE+E+ +R  F+TA+ + PCIL +D+IDA+  +R+         +V+     +D +                            +     +L+IG T+  + +D  + R+GR    I + IP     R  +L    K              +N + +    QI+    T  +  +DL ALI E+ +
Sbjct:  203 VKFEHIGGADRQFLEVCRLAMHLKRPKTFATLGVDPPRGFIVHGPPGCGKTMFAQAVAGELAIPMLQLAATELVSGVSGETEEKIRRLFDTAKQNSPCILILDDIDAIAPRRETAQREMERRVVSQLCSSLDELVLPPREKPLKDQLTFGDDGSVAIIGDSPTAAGAGVLVIGTTSRPDAVDGGLRRAGRFENEISLGIPDE-TAREKILEKICK--------------VNLAGDVTLKQIAK--LTPGYVGADLQALIREAAK 449          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: cdc-48.2 (Transitional endoplasmic reticulum ATPase homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:P54812])

HSP 1 Score: 159.844 bits (403), Expect = 3.331e-40
Identity = 110/324 (33.95%), Postives = 171/324 (52.78%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD---DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLD-EMNFSVENVFSQISSDDFTEDWSHSDLAALIAESY-----------------QEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQF 2073
            ++T +  WSDIGG   VK +L+ ++   V+  E++ K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVR+ F+ AR++ PC+LF DE+D++   R     D  G+ + ++N  L EMDG+++ KN  + IIGATN  + ID A+ R GRL +LI + +P     RL +  A+ +        P S D ++NF  +N     S  D TE    +   A I ES                  +E+  D  AD    +T  H   A +   R    N   K+  +A+ +   +  R F N F+F
Sbjct:  474 VETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQVLTEMDGMNAKKN--VFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDE-ASRLQIFKASLRK------TPLSADLDLNFLAKNTVG-FSGADLTEICQRACKLA-IRESIEREIRQEKERQDRSARGEELMEDELADPVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTL---QQSRGFGNNFKF 783          

HSP 2 Score: 119.783 bits (299), Expect = 1.673e-27
Identity = 67/192 (34.90%), Postives = 111/192 (57.81%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
            +++ + D+GG  +   ++K +++      + +K+       G++L+GPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF     + P ILFIDEIDA+  KR+  +      IV+  L  MDG+ +     +++I ATN    ID A+ R GR  R I++ IP +   RL +L   +KN
Sbjct:  204 NEVGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLIARAVANETGAFFFLINGPEIMSKMSGESESNLRKAFAECEKNSPAILFIDEIDAIAPKREKAHGEVEKRIVSQLLTLMDGLKTR--AHVVVIAATNRPNSIDGALRRFGRFDREIDIGIPDA-VGRLEILRIHTKN 392          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: cdc-48.2 (Transitional endoplasmic reticulum ATPase homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:P54812])

HSP 1 Score: 159.844 bits (403), Expect = 3.331e-40
Identity = 110/324 (33.95%), Postives = 171/324 (52.78%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD---DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLD-EMNFSVENVFSQISSDDFTEDWSHSDLAALIAESY-----------------QEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQF 2073
            ++T +  WSDIGG   VK +L+ ++   V+  E++ K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVR+ F+ AR++ PC+LF DE+D++   R     D  G+ + ++N  L EMDG+++ KN  + IIGATN  + ID A+ R GRL +LI + +P     RL +  A+ +        P S D ++NF  +N     S  D TE    +   A I ES                  +E+  D  AD    +T  H   A +   R    N   K+  +A+ +   +  R F N F+F
Sbjct:  474 VETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQVLTEMDGMNAKKN--VFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDE-ASRLQIFKASLRK------TPLSADLDLNFLAKNTVG-FSGADLTEICQRACKLA-IRESIEREIRQEKERQDRSARGEELMEDELADPVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTL---QQSRGFGNNFKF 783          

HSP 2 Score: 119.783 bits (299), Expect = 1.673e-27
Identity = 67/192 (34.90%), Postives = 111/192 (57.81%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
            +++ + D+GG  +   ++K +++      + +K+       G++L+GPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF     + P ILFIDEIDA+  KR+  +      IV+  L  MDG+ +     +++I ATN    ID A+ R GR  R I++ IP +   RL +L   +KN
Sbjct:  204 NEVGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLIARAVANETGAFFFLINGPEIMSKMSGESESNLRKAFAECEKNSPAILFIDEIDAIAPKREKAHGEVEKRIVSQLLTLMDGLKTR--AHVVVIAATNRPNSIDGALRRFGRFDREIDIGIPDA-VGRLEILRIHTKN 392          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: prx-6 (PEX6; PeRoXisome assembly factor; Pex6p homolog [Source:UniProtKB/TrEMBL;Acc:G5EFR8])

HSP 1 Score: 148.288 bits (373), Expect = 1.364e-36
Identity = 98/327 (29.97%), Postives = 178/327 (54.43%), Query Frame = 1
Query:  805 VLLHFKFNYYPTKISDNFRFESDASSKFLMIFE------SSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALC----TKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEK-LKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSK--RDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASK 1746
            VL   +FN    +I      +    SK  +IF       SS P ++   A ++     +D+ +R+ +L+++L   N  + N   +A+ T G+ + E+E L            +     D+ D+ N   A      KI   +++W D+GG +E K+  L++I  N+  + R  K +G+ILYG PGCGKT++AKA++ E + +F+++   ++L+KY G+SE+N+R+ F  A+ + PC++F DEID+L     R+ D+ G  + IV+  L E+D + +   T++ ++GATN  + +D ++   GR  +L+EV   +  + +  +L A S+
Sbjct:  328 VLAIDQFNALDRRILQYMEQKLSEPSKITVIFSCNTDTMSSMPANVKNLALYTFSAEFMDENDRKTWLQYYL---NEKLAN--HVAKKTSGFTLAELEKLVKNGKKVKIEEKEEKVYEDLIDKRNSNFADAIGAPKIP--NVRWEDVGGLEETKQTVLESIRTNLFGS-RALKRSGIILYGSPGCGKTLIAKAVATEFKIAFLSVKGPELLNKYVGQSEENLRKVFERAKQASPCVIFFDEIDSLAPNRGRNGDSGGVIDRIVSQLLAELDKLHNSPLTKVFVMGATNRPDLLDNSLMTPGRFDKLVEVKPGEDVESKTKILEAVSR 646          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: cdc-48.1 (Transitional endoplasmic reticulum ATPase homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P54811])

HSP 1 Score: 144.821 bits (364), Expect = 2.073e-35
Identity = 107/325 (32.92%), Postives = 167/325 (51.38%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR----NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLD-EMNFSVENVFSQISSDDFTEDWSHSDLAALIAESY-----------------QEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQF 2073
            ++T +  WSDIGG   VK +L+ ++   V+  E++ K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVR+ F+ AR++ PC+LF DE+D++   R     G      + ++N  L EMDG+++ KN  + IIGATN  + ID A+ R GRL +LI + +P     R  +L A+ +        P S D ++ F  +N     S  D TE    +   A I ES                  +E+  D   D    +T  H   A +   R    N   K+  +A+ +   +  R F N F+F
Sbjct:  475 VETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGGAGGDGGGASDRVINQVLTEMDGMNAKKN--VFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDE-ASRHQILKASLRK------TPLSKDLDLTFLAKNTVG-FSGADLTEICQRACKLA-IRESIEKEIRIEKERQDRQARGEELMEDDAVDPVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTL---QQSRGFGNNFKF 785          

HSP 2 Score: 130.568 bits (327), Expect = 7.245e-31
Identity = 90/274 (32.85%), Postives = 143/274 (52.19%), Query Frame = 1
Query:  985 YLKHFLIEV-----NGDIWNCEEMARLTPGYQIGEIEA-----LCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTER---FYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
            +LK + +E       GDI+  +   R T  +++ E E      +     + Y+G+P+    +E +              +DI + D+GG   V+++L  I + V+   R    +K+       G++L+GPPG GKT++A+A++NE    F  ++  +++SK  GESE N+R+AF     +QP ILFIDEIDA+  KR+  N      IV+  L  MDG+    N  L++I ATN    ID A+ R GR  R I++ IP +   RL +L   +KN
Sbjct:  140 FLKPYFLEAYRPLHKGDIFTVQAAMR-TVEFKVVETEPAPACIVSPDTMIHYEGDPIKREEEEES-------------MNDIGYDDLGG---VRKQLAQIKEMVELPLRHPQLFKAIGIKPPRGILLFGPPGTGKTLIARAVANETGSFFFLINGPEVMSKMSGESESNLRKAFEECEKNQPAILFIDEIDAIAPKREKTNGEVERRIVSQLLTLMDGVKGRSN--LVVIAATNRPNSIDGALRRFGRFDREIDIGIPDA-VGRLEILRIHTKN 393          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: smid (gene:FBgn0016983 transcript:FBtr0331849)

HSP 1 Score: 166.007 bits (419), Expect = 8.450e-42
Identity = 115/321 (35.83%), Postives = 171/321 (53.27%), Query Frame = 1
Query: 1123 LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDD----DNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-----YQEMKN-DPNADGSNCVTMLH---VLSAHRAKNREKKINISPKFN-KYAKP 2025
            LID  D    +  S + +  I   D  W DIG  ++++E+LK  ++  VK  E   +      +GV+L GPPGCGKT+LAKA++NE   +F+++   ++++ Y GESE+ VR  F  AR+S PC++F DE D+LC KR D    +N G+R  IVN  L EMDG++  K   + I+ ATN  + ID AI R GRL  ++ V  P+   +R  +L A +KNG  P       D+++   + + +Q      TE ++ +DLA L+ ++      Q + N D N D   CV   H    L   R    E+   I  K   KYA P
Sbjct:  600 LIDFVDAIKVMQPSAKREGFITVPDTTWDDIGALEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSGTR--IVNQLLTEMDGVEERKG--VYILAATNRPDIIDPAILRPGRLDTILYVGFPEQ-SERTEILKATTKNGKRPVLA----DDVDL--DEIAAQ------TEGYTGADLAGLVKQASMFSLRQSLNNGDTNLD-DLCVRSQHFQEALQQLRPSVNEQDRKIYDKLRLKYAAP 902          

HSP 2 Score: 111.309 bits (277), Expect = 1.301e-24
Identity = 66/243 (27.16%), Postives = 126/243 (51.85%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQ-LLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            L+++     + DIGG D   ++L  ++ ++K  E +++     S G++L+GPPGCGKT LA+A+S + +   + +   +++    GESE+ +RE F+ A    PC+LFIDEIDA+   R   +      IV+  +  +D + +++  Q +++I AT   + +D  + R GR    I ++IP   ++R  + +       +PK                + +I+  + T  +  +DL AL++ +
Sbjct:  207 LEVQHPTESFRDIGGMDSTLKELCEMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNRQWASKDMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQCEGLSVDPKLN--------------YDKIA--ELTPGYVGADLMALVSRA 433          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: smid (gene:FBgn0016983 transcript:FBtr0333404)

HSP 1 Score: 166.007 bits (419), Expect = 8.450e-42
Identity = 115/321 (35.83%), Postives = 171/321 (53.27%), Query Frame = 1
Query: 1123 LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDD----DNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-----YQEMKN-DPNADGSNCVTMLH---VLSAHRAKNREKKINISPKFN-KYAKP 2025
            LID  D    +  S + +  I   D  W DIG  ++++E+LK  ++  VK  E   +      +GV+L GPPGCGKT+LAKA++NE   +F+++   ++++ Y GESE+ VR  F  AR+S PC++F DE D+LC KR D    +N G+R  IVN  L EMDG++  K   + I+ ATN  + ID AI R GRL  ++ V  P+   +R  +L A +KNG  P       D+++   + + +Q      TE ++ +DLA L+ ++      Q + N D N D   CV   H    L   R    E+   I  K   KYA P
Sbjct:  600 LIDFVDAIKVMQPSAKREGFITVPDTTWDDIGALEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSGTR--IVNQLLTEMDGVEERKG--VYILAATNRPDIIDPAILRPGRLDTILYVGFPEQ-SERTEILKATTKNGKRPVLA----DDVDL--DEIAAQ------TEGYTGADLAGLVKQASMFSLRQSLNNGDTNLD-DLCVRSQHFQEALQQLRPSVNEQDRKIYDKLRLKYAAP 902          

HSP 2 Score: 111.309 bits (277), Expect = 1.301e-24
Identity = 66/243 (27.16%), Postives = 126/243 (51.85%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQ-LLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            L+++     + DIGG D   ++L  ++ ++K  E +++     S G++L+GPPGCGKT LA+A+S + +   + +   +++    GESE+ +RE F+ A    PC+LFIDEIDA+   R   +      IV+  +  +D + +++  Q +++I AT   + +D  + R GR    I ++IP   ++R  + +       +PK                + +I+  + T  +  +DL AL++ +
Sbjct:  207 LEVQHPTESFRDIGGMDSTLKELCEMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNRQWASKDMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQCEGLSVDPKLN--------------YDKIA--ELTPGYVGADLMALVSRA 433          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: smid (gene:FBgn0016983 transcript:FBtr0331850)

HSP 1 Score: 165.622 bits (418), Expect = 9.540e-42
Identity = 115/321 (35.83%), Postives = 171/321 (53.27%), Query Frame = 1
Query: 1123 LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDD----DNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-----YQEMKN-DPNADGSNCVTMLH---VLSAHRAKNREKKINISPKFN-KYAKP 2025
            LID  D    +  S + +  I   D  W DIG  ++++E+LK  ++  VK  E   +      +GV+L GPPGCGKT+LAKA++NE   +F+++   ++++ Y GESE+ VR  F  AR+S PC++F DE D+LC KR D    +N G+R  IVN  L EMDG++  K   + I+ ATN  + ID AI R GRL  ++ V  P+   +R  +L A +KNG  P       D+++   + + +Q      TE ++ +DLA L+ ++      Q + N D N D   CV   H    L   R    E+   I  K   KYA P
Sbjct:  617 LIDFVDAIKVMQPSAKREGFITVPDTTWDDIGALEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSGTR--IVNQLLTEMDGVEERKG--VYILAATNRPDIIDPAILRPGRLDTILYVGFPEQ-SERTEILKATTKNGKRPVLA----DDVDL--DEIAAQ------TEGYTGADLAGLVKQASMFSLRQSLNNGDTNLD-DLCVRSQHFQEALQQLRPSVNEQDRKIYDKLRLKYAAP 919          

HSP 2 Score: 111.694 bits (278), Expect = 1.007e-24
Identity = 66/243 (27.16%), Postives = 126/243 (51.85%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQ-LLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            L+++     + DIGG D   ++L  ++ ++K  E +++     S G++L+GPPGCGKT LA+A+S + +   + +   +++    GESE+ +RE F+ A    PC+LFIDEIDA+   R   +      IV+  +  +D + +++  Q +++I AT   + +D  + R GR    I ++IP   ++R  + +       +PK                + +I+  + T  +  +DL AL++ +
Sbjct:  224 LEVQHPTESFRDIGGMDSTLKELCEMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNRQWASKDMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQCEGLSVDPKLN--------------YDKIA--ELTPGYVGADLMALVSRA 450          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: smid (gene:FBgn0016983 transcript:FBtr0301611)

HSP 1 Score: 165.622 bits (418), Expect = 1.023e-41
Identity = 115/321 (35.83%), Postives = 171/321 (53.27%), Query Frame = 1
Query: 1123 LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDD----DNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-----YQEMKN-DPNADGSNCVTMLH---VLSAHRAKNREKKINISPKFN-KYAKP 2025
            LID  D    +  S + +  I   D  W DIG  ++++E+LK  ++  VK  E   +      +GV+L GPPGCGKT+LAKA++NE   +F+++   ++++ Y GESE+ VR  F  AR+S PC++F DE D+LC KR D    +N G+R  IVN  L EMDG++  K   + I+ ATN  + ID AI R GRL  ++ V  P+   +R  +L A +KNG  P       D+++   + + +Q      TE ++ +DLA L+ ++      Q + N D N D   CV   H    L   R    E+   I  K   KYA P
Sbjct:  633 LIDFVDAIKVMQPSAKREGFITVPDTTWDDIGALEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSGTR--IVNQLLTEMDGVEERKG--VYILAATNRPDIIDPAILRPGRLDTILYVGFPEQ-SERTEILKATTKNGKRPVLA----DDVDL--DEIAAQ------TEGYTGADLAGLVKQASMFSLRQSLNNGDTNLD-DLCVRSQHFQEALQQLRPSVNEQDRKIYDKLRLKYAAP 935          

HSP 2 Score: 111.309 bits (277), Expect = 1.166e-24
Identity = 66/243 (27.16%), Postives = 126/243 (51.85%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQ-LLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            L+++     + DIGG D   ++L  ++ ++K  E +++     S G++L+GPPGCGKT LA+A+S + +   + +   +++    GESE+ +RE F+ A    PC+LFIDEIDA+   R   +      IV+  +  +D + +++  Q +++I AT   + +D  + R GR    I ++IP   ++R  + +       +PK                + +I+  + T  +  +DL AL++ +
Sbjct:  240 LEVQHPTESFRDIGGMDSTLKELCEMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNRQWASKDMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQCEGLSVDPKLN--------------YDKIA--ELTPGYVGADLMALVSRA 466          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: smid (gene:FBgn0016983 transcript:FBtr0076851)

HSP 1 Score: 165.622 bits (418), Expect = 1.072e-41
Identity = 115/321 (35.83%), Postives = 171/321 (53.27%), Query Frame = 1
Query: 1123 LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDD----DNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-----YQEMKN-DPNADGSNCVTMLH---VLSAHRAKNREKKINISPKFN-KYAKP 2025
            LID  D    +  S + +  I   D  W DIG  ++++E+LK  ++  VK  E   +      +GV+L GPPGCGKT+LAKA++NE   +F+++   ++++ Y GESE+ VR  F  AR+S PC++F DE D+LC KR D    +N G+R  IVN  L EMDG++  K   + I+ ATN  + ID AI R GRL  ++ V  P+   +R  +L A +KNG  P       D+++   + + +Q      TE ++ +DLA L+ ++      Q + N D N D   CV   H    L   R    E+   I  K   KYA P
Sbjct:  634 LIDFVDAIKVMQPSAKREGFITVPDTTWDDIGALEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSGTR--IVNQLLTEMDGVEERKG--VYILAATNRPDIIDPAILRPGRLDTILYVGFPEQ-SERTEILKATTKNGKRPVLA----DDVDL--DEIAAQ------TEGYTGADLAGLVKQASMFSLRQSLNNGDTNLD-DLCVRSQHFQEALQQLRPSVNEQDRKIYDKLRLKYAAP 936          

HSP 2 Score: 111.309 bits (277), Expect = 1.157e-24
Identity = 66/243 (27.16%), Postives = 126/243 (51.85%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQ-LLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            L+++     + DIGG D   ++L  ++ ++K  E +++     S G++L+GPPGCGKT LA+A+S + +   + +   +++    GESE+ +RE F+ A    PC+LFIDEIDA+   R   +      IV+  +  +D + +++  Q +++I AT   + +D  + R GR    I ++IP   ++R  + +       +PK                + +I+  + T  +  +DL AL++ +
Sbjct:  241 LEVQHPTESFRDIGGMDSTLKELCEMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNRQWASKDMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQCEGLSVDPKLN--------------YDKIA--ELTPGYVGADLMALVSRA 467          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: nvl (nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-2871])

HSP 1 Score: 173.711 bits (439), Expect = 1.840e-44
Identity = 116/389 (29.82%), Postives = 197/389 (50.64%), Query Frame = 1
Query:  880 SKFLMIFESSDPGSL---VKNA---NWSIEFPIIDKLNREKYLKHFLIEVN-GDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLI----------------------------------------DIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            ++ L+I  ++ P SL   ++ A   +  I   I D+  R K LK    ++   D ++   +ARLTPGY   ++ ALC +  M      L+                                        D +    R+  S + +      D+ W+D+G   +V+E+L   IM  +++ E+F         G++L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F   R+S PC++F DEIDALC +R +   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID A+ R GRL + + V +P +  + + +L   +K GT P+       + + S+E    +I+ D   E ++ +DL+AL+ E+
Sbjct:  364 AQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEGARMKILKTLCRKIRLPDDFDFRHLARLTPGYVGADLMALCREAAMNAVNRILLEPTTEDQTTPTLALARLLDLLKSSVSLSEDQLAALCVLMSDFSSSLVRVQPSAKREGFATVPDVTWADVGALQDVREELHMAIMAPIQNPEQFKALGLSAPAGLLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCPRRSEHESGASVRVVNQLLTEMDGMENRR--QVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPPAADRHV-ILNTITKGGTKPQL------DSDVSLE----EIAHDARCETFTGADLSALVREA 739          

HSP 2 Score: 133.265 bits (334), Expect = 1.814e-31
Identity = 69/174 (39.66%), Postives = 106/174 (60.92%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSH-KNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            +K+ D GG DE  E++  ++ +++  E + +       G +L+GPPGCGKT+LA+A++ E     + +S  +++S   GESE+ +RE F  A SS PCILFIDEIDA+  KR+  +      IV   L  MD ++S  +  Q+L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  224 VKFEDFGGSDETLEEVCKLLIHMRHPEVYQRLGVVPPRGFLLHGPPGCGKTLLAQAVAGETALPLLKISAPELVSGVSGESEQKLRELFEQAISSAPCILFIDEIDAITPKRETASKDMERRIVAQLLTCMDDLNSMLEPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIP 397          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 157.918 bits (398), Expect = 2.622e-39
Identity = 103/274 (37.59%), Postives = 155/274 (56.57%), Query Frame = 1
Query: 1015 GDIWNCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDD----------------------IKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKR---DDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
             D  + E++A  T G+   ++ ALC++  L+   K   LID+ DE   I A     L +  DD                      I W DIGG D+VK +L+ ++   V+  ++F K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVRE F+ AR + PC+LF DE+D++   R     D  G+ + ++N  L EMDG+ S KN  + IIGATN  + ID AI R GRL +LI + +P   + R+++L A
Sbjct:  391 ADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE--TIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDE-KSRIAILKA 659          

HSP 2 Score: 124.02 bits (310), Expect = 1.613e-28
Identity = 79/241 (32.78%), Postives = 132/241 (54.77%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTER---FYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +++ + DIGG   V+++L  I + V+   R    +K+       G++LYGPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF  A  + P I+FIDE+DA+  KR+  +      IV+  L  MDG+   +   ++++ ATN    ID A+ R GR  R +++ IP +   RL +L   +KN             M  + +    Q++++  T     +DLAAL +E+
Sbjct:  199 NEVGYDDIGG---VRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL--KQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDA-TGRLEILQIHTKN-------------MKLADDVDLEQVANE--THGHVGADLAALCSEA 418          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 157.532 bits (397), Expect = 3.161e-39
Identity = 103/274 (37.59%), Postives = 155/274 (56.57%), Query Frame = 1
Query: 1015 GDIWNCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDD----------------------IKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKR---DDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
             D  + E++A  T G+   ++ ALC++  L+   K   LID+ DE   I A     L +  DD                      I W DIGG D+VK +L+ ++   V+  ++F K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVRE F+ AR + PC+LF DE+D++   R     D  G+ + ++N  L EMDG+ S KN  + IIGATN  + ID AI R GRL +LI + +P   + R+++L A
Sbjct:  391 ADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE--TIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDE-KSRIAILKA 659          

HSP 2 Score: 123.635 bits (309), Expect = 1.920e-28
Identity = 79/241 (32.78%), Postives = 132/241 (54.77%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTER---FYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +++ + DIGG   V+++L  I + V+   R    +K+       G++LYGPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF  A  + P I+FIDE+DA+  KR+  +      IV+  L  MDG+   +   ++++ ATN    ID A+ R GR  R +++ IP +   RL +L   +KN             M  + +    Q++++  T     +DLAAL +E+
Sbjct:  199 NEVGYDDIGG---VRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL--KQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDA-TGRLEILQIHTKN-------------MKLADDVDLEQVANE--THGHVGADLAALCSEA 418          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: zgc:136908 (zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22])

HSP 1 Score: 150.984 bits (380), Expect = 3.739e-37
Identity = 108/306 (35.29%), Postives = 164/306 (53.59%), Query Frame = 1
Query: 1027 NCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWS----------------------DIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDAL---CSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTE 1845
            + E+++  T G+   ++ ALC++  L+   K   LID+ D  + I A     L +  DD KW+                      DIGG DEVK +L+ ++   V+  ++F K     S GV+ YGPPGCGKT+LAKA++NE + +FV++   ++L+ + GESE NVR+ F+ AR + PCILF DE+D++         D  G+ + ++N  L EMDG+ + KN  + IIGATN  + ID AI R GRL +LI + +P  P  R ++L A      N +  P + D     +  +    S  D TE
Sbjct:  397 DLEQISAETHGHVGADLAALCSEAALQAIRKKMTLIDLED--DSIDADLLNSLAVTMDDFKWALSQSNPSALRETVVEVPHVNWEDIGGLDEVKRELQELVQYPVEYPDKFLKFGMTPSRGVLFYGPPGCGKTLLAKAIANECQANFVSIKGPELLTMWFGESEANVRDVFDKARQAAPCILFFDELDSIAKARGGGAGDAGGAADRVINQILTEMDGMTNKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDMP-SRTAILRA------NLRKSPVAKDVDLMYLSKITEGFSGADLTE 691          

HSP 2 Score: 129.413 bits (324), Expect = 3.386e-30
Identity = 81/238 (34.03%), Postives = 129/238 (54.20%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +DI + DIGG  +   ++K +++        +K+       G++LYGPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF  A  + P I+FIDE+DA+  KR+  +      IV+  L  MDG+   +   ++++ ATN    +D A+ R GR  R I++ IP S   RL +L   +KN             M  S +    QIS++  T     +DLAAL +E+
Sbjct:  201 NDIGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLVARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL--KQRAHVVVMAATNRPNSVDAALRRFGRFDREIDIGIPDS-TGRLEILQIHTKN-------------MKLSEDVDLEQISAE--THGHVGADLAALCSEA 420          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5083])

HSP 1 Score: 134.035 bits (336), Expect = 4.181e-33
Identity = 74/193 (38.34%), Postives = 111/193 (57.51%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR---NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASK 1746
            D+ +SDIGG D  K++++  ++        YK        GV++YGPPGCGKTMLAKA+++    +F+ +  ++ + KY GE  + VR+ F  A+ + P I+FIDEIDA+ +KR D   G+      I+   L +MDG D + N +  +I ATN  + +D A+ R GRL R IE  +P   Q+RL      SK
Sbjct:  161 DVLYSDIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVK--VIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSK 351          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:Xenbase;Acc:XB-GENE-5996067])

HSP 1 Score: 177.948 bits (450), Expect = 1.436e-45
Identity = 94/237 (39.66%), Postives = 146/237 (61.60%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            D+ W+DIG  +E++E+L   I+  VK+ E+F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A +S PC++F DEIDALC +R     G+   +VN  L EMDG++S +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +K+GT P        E +  +E     I+ D+  + ++ +DL+AL+ E+
Sbjct:  573 DVTWADIGALEEIREELTMAILAPVKNPEQFKALGLMAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRASNSSPCVIFFDEIDALCPRRSGYESGASVRVVNQLLTEMDGLESRR--QVFIMAATNRPDIIDPAILRPGRLDKTLYVGLP-PPADRLAILKTITKDGTRPPL------EADVDLE----AIAGDECCDCFTGADLSALVREA 796          

HSP 2 Score: 122.094 bits (305), Expect = 1.016e-27
Identity = 65/180 (36.11%), Postives = 108/180 (60.00%), Query Frame = 1
Query: 1180 KIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            +++   +++ +IGG+++  +++  +M +++  E +         G +L+GPPGCGKT+LA+A+     +    ++  +++S   GESE+ +RE F  A SS PCILFIDEIDA+  KR+  +      IV   L  MD ++S   T Q+L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  250 ELQRSSVRFENIGGNEDTLKEVCKMMIHMRHPEVYQHLGVVPPRGFLLHGPPGCGKTLLAQAIIGGQMYLMKGVAATEMVSGVSGESEQKLRELFEQAVSSAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLAVTAQVLVIGATNRPDSLDPALRRAGRFDREICLGIP 429          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:Xenbase;Acc:XB-GENE-5996067])

HSP 1 Score: 177.563 bits (449), Expect = 1.594e-45
Identity = 94/237 (39.66%), Postives = 146/237 (61.60%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            D+ W+DIG  +E++E+L   I+  VK+ E+F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A +S PC++F DEIDALC +R     G+   +VN  L EMDG++S +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +K+GT P        E +  +E     I+ D+  + ++ +DL+AL+ E+
Sbjct:  528 DVTWADIGALEEIREELTMAILAPVKNPEQFKALGLMAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRASNSSPCVIFFDEIDALCPRRSGYESGASVRVVNQLLTEMDGLESRR--QVFIMAATNRPDIIDPAILRPGRLDKTLYVGLP-PPADRLAILKTITKDGTRPPL------EADVDLE----AIAGDECCDCFTGADLSALVREA 751          

HSP 2 Score: 87.0409 bits (214), Expect = 8.119e-17
Identity = 48/115 (41.74%), Postives = 69/115 (60.00%), Query Frame = 1
Query: 1360 EHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            E +   + ++  +++S   GESE+ +RE F  A SS PCILFIDEIDA+  KR+  +      IV   L  MD ++S   T Q+L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  270 ELDLPMLKVAATEMVSGVSGESEQKLRELFEQAVSSAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLAVTAQVLVIGATNRPDSLDPALRRAGRFDREICLGIP 384          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:Xenbase;Acc:XB-GENE-5996067])

HSP 1 Score: 177.563 bits (449), Expect = 1.609e-45
Identity = 94/237 (39.66%), Postives = 146/237 (61.60%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            D+ W+DIG  +E++E+L   I+  VK+ E+F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A +S PC++F DEIDALC +R     G+   +VN  L EMDG++S +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +K+GT P        E +  +E     I+ D+  + ++ +DL+AL+ E+
Sbjct:  563 DVTWADIGALEEIREELTMAILAPVKNPEQFKALGLMAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRASNSSPCVIFFDEIDALCPRRSGYESGASVRVVNQLLTEMDGLESRR--QVFIMAATNRPDIIDPAILRPGRLDKTLYVGLP-PPADRLAILKTITKDGTRPPL------EADVDLE----AIAGDECCDCFTGADLSALVREA 786          

HSP 2 Score: 127.487 bits (319), Expect = 1.575e-29
Identity = 66/180 (36.67%), Postives = 111/180 (61.67%), Query Frame = 1
Query: 1180 KIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            +++   +++ +IGG+++  +++  +M +++  E +         G +L+GPPGCGKT+LA+A++ E +   + ++  +++S   GESE+ +RE F  A SS PCILFIDEIDA+  KR+  +      IV   L  MD ++S   T Q+L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  240 ELQRSSVRFENIGGNEDTLKEVCKMMIHMRHPEVYQHLGVVPPRGFLLHGPPGCGKTLLAQAIAGELDLPMLKVAATEMVSGVSGESEQKLRELFEQAVSSAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLAVTAQVLVIGATNRPDSLDPALRRAGRFDREICLGIP 419          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:Xenbase;Acc:XB-GENE-5996067])

HSP 1 Score: 177.563 bits (449), Expect = 1.807e-45
Identity = 94/237 (39.66%), Postives = 146/237 (61.60%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            D+ W+DIG  +E++E+L   I+  VK+ E+F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A +S PC++F DEIDALC +R     G+   +VN  L EMDG++S +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +K+GT P        E +  +E     I+ D+  + ++ +DL+AL+ E+
Sbjct:  573 DVTWADIGALEEIREELTMAILAPVKNPEQFKALGLMAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRASNSSPCVIFFDEIDALCPRRSGYESGASVRVVNQLLTEMDGLESRR--QVFIMAATNRPDIIDPAILRPGRLDKTLYVGLP-PPADRLAILKTITKDGTRPPL------EADVDLE----AIAGDECCDCFTGADLSALVREA 796          

HSP 2 Score: 127.872 bits (320), Expect = 1.410e-29
Identity = 66/180 (36.67%), Postives = 111/180 (61.67%), Query Frame = 1
Query: 1180 KIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            +++   +++ +IGG+++  +++  +M +++  E +         G +L+GPPGCGKT+LA+A++ E +   + ++  +++S   GESE+ +RE F  A SS PCILFIDEIDA+  KR+  +      IV   L  MD ++S   T Q+L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  250 ELQRSSVRFENIGGNEDTLKEVCKMMIHMRHPEVYQHLGVVPPRGFLLHGPPGCGKTLLAQAIAGELDLPMLKVAATEMVSGVSGESEQKLRELFEQAVSSAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLAVTAQVLVIGATNRPDSLDPALRRAGRFDREICLGIP 429          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:Xenbase;Acc:XB-GENE-5996067])

HSP 1 Score: 164.851 bits (416), Expect = 4.259e-42
Identity = 99/286 (34.62%), Postives = 147/286 (51.40%), Query Frame = 1
Query: 1039 MARLTPGYQIGEIEALCTKLKMAYKGNPLIDI-----------------------------------ADEFNRIIASGEIKLK----IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNP 1761
            +A LTPGY   ++ ALC +  M      LI +                                    D+F   + S +   K        D+ W+DIG  +E++E+L   I+  VK+ E+F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A +S PC++F DEIDALC +R     G+   +VN  L EMDG++S +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +K    P
Sbjct:  278 LAHLTPGYVGADLMALCREAAMCAVNRVLIQLKEQQATPEAALHRLLALLQEHTPLPEEELQSLCIEMDDFLGALPSVQPSAKREGFATVPDVTWADIGALEEIREELTMAILAPVKNPEQFKALGLMAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRASNSSPCVIFFDEIDALCPRRSGYESGASVRVVNQLLTEMDGLESRR--QVFIMAATNRPDIIDPAILRPGRLDKTLYVGLP-PPADRLAILKTITKVRKGP 560          

HSP 2 Score: 128.642 bits (322), Expect = 3.208e-30
Identity = 66/180 (36.67%), Postives = 111/180 (61.67%), Query Frame = 1
Query: 1180 KIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            +++   +++ +IGG+++  +++  +M +++  E +         G +L+GPPGCGKT+LA+A++ E +   + ++  +++S   GESE+ +RE F  A SS PCILFIDEIDA+  KR+  +      IV   L  MD ++S   T Q+L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:   72 ELQRSSVRFENIGGNEDTLKEVCKMMIHMRHPEVYQHLGVVPPRGFLLHGPPGCGKTLLAQAIAGELDLPMLKVAATEMVSGVSGESEQKLRELFEQAVSSAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLAVTAQVLVIGATNRPDSLDPALRRAGRFDREICLGIP 251          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Nvl (nuclear VCP-like [Source:MGI Symbol;Acc:MGI:1914709])

HSP 1 Score: 173.326 bits (438), Expect = 3.947e-44
Identity = 123/439 (28.02%), Postives = 215/439 (48.97%), Query Frame = 1
Query:  874 ASSKFLMIFESSDPGSL---VKNA---NWSIEFPIIDKLNREKYLKHFLIEVN-GDIWNCEEMARLTPGYQIGEIEALCTKLKMA-------------------------------YKGNPLIDIADEFNR--------------------------IIASGEIKLKIKTD------DIKWSDIGGHDEVKEKL-KNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-----YQEMKNDPNADGSNCVTMLH 1947
            A+++ L+I  ++ P SL   ++ A   +  +   I D+  RE+ L+    ++   + +N   +A LTPG+   ++ ALC +  M                                    P  +  DE  R                          I+A  E++   K +      ++ W+DIG  ++++++L   I+  V++ ++F         G++L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  R+++L   +KNGT P      LDE + ++E + + +  + +T     +DL AL+ E+      QE+    N  G+  + + H
Sbjct:  399 ATARVLVIGATNRPDSLDPALRRAGRFDREVCLGIPDEAARERILQTLCRKLRLPETFNFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKQQAQQKKKPEIEGLPSEGDQEERLGAEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALAEVQPSAKREGFVTVPNVTWADIGALEDIRDELIMAILAPVRNPDQFRTLGLGTPAGILLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLETRQ--QVFILAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRVAILKTITKNGTKP-----PLDE-DVNLETIANDLRCNCYT----GADLTALVREASLCALRQEITAQKNGVGAGELKVSH 824          

HSP 2 Score: 126.716 bits (317), Expect = 2.432e-29
Identity = 64/180 (35.56%), Postives = 112/180 (62.22%), Query Frame = 1
Query: 1180 KIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            +++  ++K+ D+GG+D   +++  ++ +++  E +         GV+L+GPPGCGKT+LA A++ E +   + ++  +I+S   GESE+ +RE F+ A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R + + IP
Sbjct:  255 ELQISNVKFEDVGGNDATLKEVCKMLIHMRHPEVYQHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFDQAVSNAPCIVFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREVCLGIP 434          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Vcp (valosin containing protein [Source:MGI Symbol;Acc:MGI:99919])

HSP 1 Score: 154.836 bits (390), Expect = 3.096e-38
Identity = 100/274 (36.50%), Postives = 156/274 (56.93%), Query Frame = 1
Query: 1015 GDIWNCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWS----------------------DIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKR---DDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
             D  + E++A  T G+   ++ ALC++  L+   K   LID+ DE   I A     L +  DD +W+                      DIGG ++VK +L+ ++   V+  ++F K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVRE F+ AR + PC+LF DE+D++   R     D  G+ + ++N  L EMDG+ + KN  + IIGATN  + ID AI R GRL +LI + +P   + R+++L A
Sbjct:  391 ADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE--TIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDE-KSRVAILKA 659          

HSP 2 Score: 122.865 bits (307), Expect = 3.315e-28
Identity = 75/238 (31.51%), Postives = 129/238 (54.20%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +++ + DIGG  +   ++K +++        +K+       G++LYGPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF  A  + P I+FIDE+DA+  KR+  +      IV+  L  MDG+   +   ++++ ATN    ID A+ R GR  R +++ IP +   RL +L   +KN             M  + +    Q++++  T     +DLAAL +E+
Sbjct:  199 NEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL--KQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDA-TGRLEILQIHTKN-------------MKLADDVDLEQVANE--THGHVGADLAALCSEA 418          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Spata5 (spermatogenesis associated 5 [Source:MGI Symbol;Acc:MGI:1927170])

HSP 1 Score: 149.828 bits (377), Expect = 1.207e-36
Identity = 97/287 (33.80%), Postives = 150/287 (52.26%), Query Frame = 1
Query:  946 IEFPIIDKLNREKYLKHFLIEVNGDIWNCE--EMARLTPGYQIGEIEALCTK-----LKMAYKGNP--------------LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR--NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQR 1719
            IE  I +  +R   L+  L  V   +   E   +A    GY   +++ALC +     L+   +  P              L D     N I  S   ++ I   ++ WSDIGG + +K KLK  ++  +K  + F +       GV+LYGPPGC KTM+AKAL+NE   +F+ +   ++++KY GESE+ VRE F  AR+  P I+F DE+DAL  +R   +      + ++   L EMDGI+  KN  + ++ ATN  ++IDKA+ R GR+ R+I V +P +  +R
Sbjct:  519 IEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHGYVGADLKALCNEAGLHALRRVLRKQPNLPDSKVAGMVKITLNDFLQGMNDIRPSAMREVAIDVPNVSWSDIGGLENIKLKLKQAVEWPLKHPKSFNRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVREIFRKARAVAPSIIFFDELDALAVERGSSSGAGNVADRVLAQLLTEMDGIEQLKN--VTVLAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRR 803          

HSP 2 Score: 124.405 bits (311), Expect = 1.349e-28
Identity = 67/185 (36.22%), Postives = 107/185 (57.84%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKN-TQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVL 1731
            + +  IGG +   + ++ I++        +KS       G++LYGPPG GKTM+A+A++NE       ++  +I+SK+ GE+E  +R+ F  A    P I+FIDE+DALC KR+         +V + L  MDGI S  +  ++L++GATN  + +D A+ R GR  + IE+ IP + Q RL +L
Sbjct:  350 VTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLLTLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNA-QDRLDIL 533          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Spata5 (spermatogenesis associated 5 [Source:MGI Symbol;Acc:MGI:1927170])

HSP 1 Score: 149.828 bits (377), Expect = 1.288e-36
Identity = 97/287 (33.80%), Postives = 150/287 (52.26%), Query Frame = 1
Query:  946 IEFPIIDKLNREKYLKHFLIEVNGDIWNCE--EMARLTPGYQIGEIEALCTK-----LKMAYKGNP--------------LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR--NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQR 1719
            IE  I +  +R   L+  L  V   +   E   +A    GY   +++ALC +     L+   +  P              L D     N I  S   ++ I   ++ WSDIGG + +K KLK  ++  +K  + F +       GV+LYGPPGC KTM+AKAL+NE   +F+ +   ++++KY GESE+ VRE F  AR+  P I+F DE+DAL  +R   +      + ++   L EMDGI+  KN  + ++ ATN  ++IDKA+ R GR+ R+I V +P +  +R
Sbjct:  519 IEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHGYVGADLKALCNEAGLHALRRVLRKQPNLPDSKVAGMVKITLNDFLQGMNDIRPSAMREVAIDVPNVSWSDIGGLENIKLKLKQAVEWPLKHPKSFNRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVREIFRKARAVAPSIIFFDELDALAVERGSSSGAGNVADRVLAQLLTEMDGIEQLKN--VTVLAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRR 803          

HSP 2 Score: 124.405 bits (311), Expect = 1.272e-28
Identity = 67/185 (36.22%), Postives = 107/185 (57.84%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKN-TQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVL 1731
            + +  IGG +   + ++ I++        +KS       G++LYGPPG GKTM+A+A++NE       ++  +I+SK+ GE+E  +R+ F  A    P I+FIDE+DALC KR+         +V + L  MDGI S  +  ++L++GATN  + +D A+ R GR  + IE+ IP + Q RL +L
Sbjct:  350 VTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLLTLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNA-QDRLDIL 533          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Spata5 (spermatogenesis associated 5 [Source:MGI Symbol;Acc:MGI:1927170])

HSP 1 Score: 149.828 bits (377), Expect = 1.441e-36
Identity = 97/287 (33.80%), Postives = 150/287 (52.26%), Query Frame = 1
Query:  946 IEFPIIDKLNREKYLKHFLIEVNGDIWNCE--EMARLTPGYQIGEIEALCTK-----LKMAYKGNP--------------LIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR--NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQR 1719
            IE  I +  +R   L+  L  V   +   E   +A    GY   +++ALC +     L+   +  P              L D     N I  S   ++ I   ++ WSDIGG + +K KLK  ++  +K  + F +       GV+LYGPPGC KTM+AKAL+NE   +F+ +   ++++KY GESE+ VRE F  AR+  P I+F DE+DAL  +R   +      + ++   L EMDGI+  KN  + ++ ATN  ++IDKA+ R GR+ R+I V +P +  +R
Sbjct:  518 IEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHGYVGADLKALCNEAGLHALRRVLRKQPNLPDSKVAGMVKITLNDFLQGMNDIRPSAMREVAIDVPNVSWSDIGGLENIKLKLKQAVEWPLKHPKSFNRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVREIFRKARAVAPSIIFFDELDALAVERGSSSGAGNVADRVLAQLLTEMDGIEQLKN--VTVLAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRR 802          

HSP 2 Score: 124.405 bits (311), Expect = 1.398e-28
Identity = 67/185 (36.22%), Postives = 107/185 (57.84%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKN-TQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVL 1731
            + +  IGG +   + ++ I++        +KS       G++LYGPPG GKTM+A+A++NE       ++  +I+SK+ GE+E  +R+ F  A    P I+FIDE+DALC KR+         +V + L  MDGI S  +  ++L++GATN  + +D A+ R GR  + IE+ IP + Q RL +L
Sbjct:  349 VTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLLTLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNA-QDRLDIL 532          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|Q9NAG4|MAC1_CAEEL (Protein mac-1 OS=Caenorhabditis elegans OX=6239 GN=mac-1 PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 7.907e-44
Identity = 124/402 (30.85%), Postives = 204/402 (50.75%), Query Frame = 1
Query:  874 ASSKFLMIFESSDP----GSLVKNANWS--IEFPIIDKLNREKYLKHFL-IEVNGDIWNCEEMARLTPGYQIGEIEAL---CTKLKM------------AYKGNPLIDIADEFNRIIA--------------SGEIKLKIK--------------------TDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFY------KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENV-FSQISSDDFTEDWSHSDLAALIAES 1887
            A +  L+I  +S P    G L +   +   I   I D+  REK L+    + + GD+   +++A+LTPGY   +++AL     K+ +             +K   +  I +E +R++A              +G +++  +                      D+ W DIG   EV+++L+ +I+  +K  + F       +  G++L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR  F  AR SQPC++F DEIDAL  KR          +VN  L EMDG++  +  ++ +IGATN  + +D AI R GRL +++ V+ P S + R+ +L  ++KNGT P  G           E++ F +I+       ++ +DLAALI ES
Sbjct:  367 AGAGVLVIGTTSRPDAVDGGLRRAGRFENEISLGIPDETAREKILEKICKVNLAGDV-TLKQIAKLTPGYVGADLQALIREAAKVAIDRVFDTIVVKNEGHKNLTVEQIKEELDRVLAWLQGDDDPSALSELNGGLQISFEDFERALSTIQPAAKREGFATVPDVSWDDIGALVEVRKQLEWSILYPIKRADDFAALGIDCRPQGILLCGPPGCGKTLLAKAVANETGMNFISVKGPELLNMYVGESERAVRTVFQRARDSQPCVIFFDEIDALVPKRSHGESSGGARLVNQLLTEMDGVEGRQ--KVFLIGATNRPDIVDAAILRPGRLDKILFVDFP-SVEDRVDILRKSTKNGTRPMLG-----------EDIDFHEIAQLPELAGFTGADLAALIHES 753          

HSP 2 Score: 93.9745 bits (232), Expect = 3.036e-18
Identity = 64/264 (24.24%), Postives = 116/264 (43.94%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGI---------------------------DSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQ 1893
            +K+  IGG D    ++  +  ++K  + F         G I++GPPGCGKTM A+A++ E     + ++  +++S   GE+E+ +R  F+TA+ + PCIL +D+IDA+  +R+         +V+     +D +                            +     +L+IG T+  + +D  + R+GR    I + IP     R  +L    K              +N + +    QI+    T  +  +DL ALI E+ +
Sbjct:  203 VKFEHIGGADRQFLEVCRLAMHLKRPKTFATLGVDPPRGFIVHGPPGCGKTMFAQAVAGELAIPMLQLAATELVSGVSGETEEKIRRLFDTAKQNSPCILILDDIDAIAPRRETAQREMERRVVSQLCSSLDELVLPPREKPLKDQLTFGDDGSVAIIGDSPTAAGAGVLVIGTTSRPDAVDGGLRRAGRFENEISLGIPDE-TAREKILEKICK--------------VNLAGDVTLKQIAK--LTPGYVGADLQALIREAAK 449          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|O15381|NVL_HUMAN (Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 9.252e-44
Identity = 89/241 (36.93%), Postives = 148/241 (61.41%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +   ++ W+DIG  ++++E+L   I+  V++ ++F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  RL++L   +KNGT P        + + ++E +   +  D +T     +DL+AL+ E+
Sbjct:  573 VTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQ--QVFIMAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRLAILKTITKNGTKPPL------DADVNLEAIAGDLRCDCYT----GADLSALVREA 800          

HSP 2 Score: 128.257 bits (321), Expect = 6.058e-29
Identity = 66/181 (36.46%), Postives = 112/181 (61.88%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            L+ +  ++K+ D+GG+D   +++  ++ +++  E ++        GV+L+GPPGCGKT+LA A++ E +   + ++  +I+S   GESE+ +RE F  A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R I + IP
Sbjct:  255 LEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIP 435          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|Q9DBY8|NVL_MOUSE (Nuclear valosin-containing protein-like OS=Mus musculus OX=10090 GN=Nvl PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.761e-43
Identity = 123/439 (28.02%), Postives = 215/439 (48.97%), Query Frame = 1
Query:  874 ASSKFLMIFESSDPGSL---VKNA---NWSIEFPIIDKLNREKYLKHFLIEVN-GDIWNCEEMARLTPGYQIGEIEALCTKLKMA-------------------------------YKGNPLIDIADEFNR--------------------------IIASGEIKLKIKTD------DIKWSDIGGHDEVKEKL-KNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-----YQEMKNDPNADGSNCVTMLH 1947
            A+++ L+I  ++ P SL   ++ A   +  +   I D+  RE+ L+    ++   + +N   +A LTPG+   ++ ALC +  M                                    P  +  DE  R                          I+A  E++   K +      ++ W+DIG  ++++++L   I+  V++ ++F         G++L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  A++S PC++F DE+DALC +R D   G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID AI R GRL + + V +P  P  R+++L   +KNGT P      LDE + ++E + + +  + +T     +DL AL+ E+      QE+    N  G+  + + H
Sbjct:  399 ATARVLVIGATNRPDSLDPALRRAGRFDREVCLGIPDEAARERILQTLCRKLRLPETFNFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKQQAQQKKKPEIEGLPSEGDQEERLGAEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALAEVQPSAKREGFVTVPNVTWADIGALEDIRDELIMAILAPVRNPDQFRTLGLGTPAGILLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLETRQ--QVFILAATNRPDIIDPAILRPGRLDKTLFVGLP-PPADRVAILKTITKNGTKP-----PLDE-DVNLETIANDLRCNCYT----GADLTALVREASLCALRQEITAQKNGVGAGELKVSH 824          

HSP 2 Score: 126.716 bits (317), Expect = 1.701e-28
Identity = 64/180 (35.56%), Postives = 112/180 (62.22%), Query Frame = 1
Query: 1180 KIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            +++  ++K+ D+GG+D   +++  ++ +++  E +         GV+L+GPPGCGKT+LA A++ E +   + ++  +I+S   GESE+ +RE F+ A S+ PCI+FIDEIDA+  KR+  +      IV   L  MD +++   T ++L+IGATN  + +D A+ R+GR  R + + IP
Sbjct:  255 ELQISNVKFEDVGGNDATLKEVCKMLIHMRHPEVYQHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFDQAVSNAPCIVFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREVCLGIP 434          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|Q8SSJ5|CDC48_ENCCU (Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) OX=284813 GN=CDC48 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.449e-39
Identity = 81/196 (41.33%), Postives = 131/196 (66.84%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKR--DDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASK 1746
            I++ ++KWSDIGG ++VK++L+  +   V+  E+F K     + GV+ YGPPGCGKT+LAKA++ E + +F+++   ++LS + GESE N+R+ F  AR + PC+LF DEID++   R  +D + G+ + ++N  L EMDGI+  KN  + +IGATN  +++D A+ R GRL +L+ + +P     R+S+L A  K
Sbjct:  473 IQSPNVKWSDIGGLEQVKQELRETVQYPVEYPEKFIKFGMTPAKGVLFYGPPGCGKTLLAKAVATECKANFISIKGPELLSMWVGESESNIRDLFARARGAAPCVLFFDEIDSIAKARSGNDGSSGATDRMLNQLLSEMDGINQKKN--VFVIGATNRPDQLDSALMRPGRLDQLVYIPLPDL-DSRVSILQATLK 665          

HSP 2 Score: 126.331 bits (316), Expect = 2.105e-28
Identity = 69/190 (36.32%), Postives = 106/190 (55.79%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFYK------SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
            + + D+GG      K++ +++      + Y         G++LYGPPG GKT++A+A++NE       ++  +I+SK  GESE N+R+AF  A  + P I+FIDEIDAL  KR+         IV+  L  MDG+ +  N  ++++GATN    ID A+ R GR  R IE+ +P     RL +L   +KN
Sbjct:  205 VGYDDVGGCRAQMAKIRELVELPLRHSQLYSKIGVKPPKGILLYGPPGTGKTLIARAIANETGAFLFLINGPEIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDALAPKREKSQGEVERRIVSQLLTLMDGMKARSN--VIVLGATNRPNSIDPALRRYGRFDREIEIGVPDE-TGRLEILRIHTKN 391          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|P54812|TERA2_CAEEL (Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 4.237e-39
Identity = 110/324 (33.95%), Postives = 171/324 (52.78%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD---DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLD-EMNFSVENVFSQISSDDFTEDWSHSDLAALIAESY-----------------QEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQF 2073
            ++T +  WSDIGG   VK +L+ ++   V+  E++ K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVR+ F+ AR++ PC+LF DE+D++   R     D  G+ + ++N  L EMDG+++ KN  + IIGATN  + ID A+ R GRL +LI + +P     RL +  A+ +        P S D ++NF  +N     S  D TE    +   A I ES                  +E+  D  AD    +T  H   A +   R    N   K+  +A+ +   +  R F N F+F
Sbjct:  474 VETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQVLTEMDGMNAKKN--VFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDE-ASRLQIFKASLRK------TPLSADLDLNFLAKNTVG-FSGADLTEICQRACKLA-IRESIEREIRQEKERQDRSARGEELMEDELADPVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTL---QQSRGFGNNFKF 783          

HSP 2 Score: 119.783 bits (299), Expect = 2.128e-26
Identity = 67/192 (34.90%), Postives = 111/192 (57.81%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
            +++ + D+GG  +   ++K +++      + +K+       G++L+GPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF     + P ILFIDEIDA+  KR+  +      IV+  L  MDG+ +     +++I ATN    ID A+ R GR  R I++ IP +   RL +L   +KN
Sbjct:  204 NEVGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLIARAVANETGAFFFLINGPEIMSKMSGESESNLRKAFAECEKNSPAILFIDEIDAIAPKREKAHGEVEKRIVSQLLTLMDGLKTR--AHVVVIAATNRPNSIDGALRRFGRFDREIDIGIPDA-VGRLEILRIHTKN 392          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: G7YMX6 (Ribosome biogenesis ATPase OS=Clonorchis sinensis OX=79923 GN=CLF_113622 PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.677e-54
Identity = 104/250 (41.60%), Postives = 162/250 (64.80%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKN----IMDNVKDTERF-YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD-DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKF--GPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKND 1908
            +   D+ W+D+GG D  K +L N    ++D+ K  +    +S GV+L GPPGCGKT++AKALSN+   +F+++   ++L+K+QGESE+ VRE F  AR+ QPC++F DEIDA+C KRD D++ GSR S+VN  L+E+DG+D H++ ++ ++GATN  + ID A+ R GRLG  + +N P++P +RL+VL A ++  T P+   G  SLDE+           + D  TE+ S +DL  ++  + Q  + D
Sbjct:  204 VTIPDVNWTDVGGLDSTKTQLYNRFMLLVDDWKRAQALGRRSGGVLLEGPPGCGKTLVAKALSNQAGLNFLSVKGPEVLNKFQGESERRVREIFERARACQPCLIFFDEIDAICPKRDSDESTGSRVSLVNQLLVELDGVDKHRSARVFVVGATNRKDMIDPAVLRPGRLGLHLVINPPQTPNERLAVLSACTRGATVPRIEGGITSLDEL-----------AKDRRTENMSGADLDNVLELAKQNAQLD 442          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A3R7EUW7 (Nuclear valosin-containing protein-like OS=Clonorchis sinensis OX=79923 GN=NVL PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 4.231e-53
Identity = 104/250 (41.60%), Postives = 162/250 (64.80%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKN----IMDNVKDTERF-YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD-DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKF--GPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKND 1908
            +   D+ W+D+GG D  K +L N    ++D+ K  +    +S GV+L GPPGCGKT++AKALSN+   +F+++   ++L+K+QGESE+ VRE F  AR+ QPC++F DEIDA+C KRD D++ GSR S+VN  L+E+DG+D H++ ++ ++GATN  + ID A+ R GRLG  + +N P++P +RL+VL A ++  T P+   G  SLDE+           + D  TE+ S +DL  ++  + Q  + D
Sbjct:  366 VTIPDVNWTDVGGLDSTKTQLYNRFMLLVDDWKRAQALGRRSGGVLLEGPPGCGKTLVAKALSNQAGLNFLSVKGPEVLNKFQGESERRVREIFERARACQPCLIFFDEIDAICPKRDSDESTGSRVSLVNQLLVELDGVDKHRSARVFVVGATNRKDMIDPAVLRPGRLGLHLVINPPQTPNERLAVLSACTRGATVPRIEGGITSLDEL-----------AKDRRTENMSGADLDNVLELAKQNAQLD 604          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A0X3NKD8 (Nuclear valosin-containing protein-like OS=Schistocephalus solidus OX=70667 GN=NVL PE=3 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 4.580e-53
Identity = 118/316 (37.34%), Postives = 179/316 (56.65%), Query Frame = 1
Query: 1036 EMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIAD----------EFNRIIASGEIKLK--------------IKTDDIKWSDIGGHDEVKEKLKN-IMDNVKDTERFY----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD-DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQ 1893
            E+A  TPGY+ G++  L  +L++A     L+  AD            N ++    +++               +   ++ WSD+GG +E K  L N  M  V D ER      +S GV+L GPPGCGKT++AKALSN    +F+++   +IL+KYQGESE+ VRE F  AR+ QPC++F DEIDA+C +RD D++ GSR S+VN  L+E+DGID H+  ++ ++GATN  + ID+A+ R GRLG  + ++ P S   R SVL A ++  T P      L E   +  N   +++ D  T + + +DL  L+  + Q
Sbjct:   70 EIAHRTPGYEAGDLVRLILQLRIA-----LLSAADNGMDTDVSEGTLNSLVTRDVLEVALSQVVPAAKNTSEFVTIPEVTWSDVGGLEETKTHLYNRFMLLVDDWERAQTLRRRSGGVLLEGPPGCGKTLIAKALSNTAGLNFLSVKGPEILNKYQGESERRVREIFERARACQPCLVFFDEIDAICPRRDGDESSGSRVSVVNQLLVELDGIDKHRQARVFVVGATNRKDMIDEAVLRPGRLGLHLFISPPASASDRASVLSACTRGATAP------LIEGGLTALN---RLAEDPRTNNMTGADLENLLDLAKQ 371          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A4S2LK41 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008207 PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 5.040e-53
Identity = 104/250 (41.60%), Postives = 162/250 (64.80%), Query Frame = 1
Query: 1183 IKTDDIKWSDIGGHDEVKEKLKN----IMDNVKDTERF-YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD-DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKF--GPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKND 1908
            +   D+ W+D+GG D  K +L N    ++D+ K  +    +S GV+L GPPGCGKT++AKALSN+   +F+++   ++L+K+QGESE+ VRE F  AR+ QPC++F DEIDA+C KRD D++ GSR S+VN  L+E+DG+D H++ ++ ++GATN  + ID A+ R GRLG  + +N P++P +RL+VL A ++  T P+   G  SLDE+           + D  TE+ S +DL  ++  + Q  + D
Sbjct:  366 VTIPDVNWTDVGGLDSTKTQLYNRFMLLVDDWKRAQALGRRSGGVLLEGPPGCGKTLVAKALSNQAGLNFLSVKGPEVLNKFQGESERRVREIFERARACQPCLIFFDEIDAICPKRDSDESTGSRVSLVNQLLVELDGVDKHRSARVFVVGATNRKDMIDPAVLRPGRLGLHLVINPPQTPNERLAVLNACTRGATVPRIEGGITSLDEL-----------AKDPRTENMSGADLDNVLELAKQNAQLD 604          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A5K3FF74 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 8.185e-53
Identity = 116/314 (36.94%), Postives = 181/314 (57.64%), Query Frame = 1
Query: 1036 EMARLTPGYQIGEIEALCTKLKM-----AYKGNPLIDIADEFNRI----------IASGEIKLKIKTD-------DIKWSDIGGHDEVKEKLKN-IMDNVKDTERFY----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD-DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQ 1893
            E+A  TPGY+ G++  L   ++M     A + +P  D A E N+           IA  ++   +K         D+ W+D+GG +E K  L N  M  V D ER      +S+G++L GPPGCGKT++AKALSN    +F+++   +IL+K+QGESE+ +RE F   R+ QPC++F DEIDA+C +RD D++ GSR S+VN  L+E+DG+D H+  ++ ++GATN  + ID+A+ R GRLG  + +  P S + R  VL A ++  T P+        +   +E V  +++ D  T+  S +DL  L+  + Q
Sbjct:  112 EIAHRTPGYEAGDLIRLVLAIRMELMAEAEEASP--DTATEPNQSANVVTRDLVDIALSQVIPAVKNTSEFVTIPDVTWADVGGLEETKTHLYNRFMLLVDDWERAQALRRRSSGILLEGPPGCGKTLIAKALSNTAGLNFLSVKGPEILNKFQGESERRIREIFERGRACQPCLIFFDEIDAICPRRDGDESSGSRVSVVNQLLVELDGVDKHRQARVFVVGATNRKDMIDEAVLRPGRLGLHLVIPPPASARDRADVLSACTRKATTPR--------IEGGLE-VLQRVAEDPRTDGMSGADLENLLDTAKQ 414          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: nvl (nuclear VCP like [Source:NCBI gene;Acc:103033742])

HSP 1 Score: 174.096 bits (440), Expect = 2.158e-44
Identity = 95/262 (36.26%), Postives = 153/262 (58.40%), Query Frame = 1
Query: 1132 IADEFNRIIASGEIKLK----IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            + D+F   +AS +   K        D+ W DIG   +++E+L   I+  V+  E+F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F   R+S PC++F DEIDALC +R     G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID A+ R GRL + + V +P  P  R ++L+  +K G  P+       E + S+E     I+SD+  + ++ +DL+AL+ E+
Sbjct:  611 LMDDFKASLASVQPSAKREGFATVPDVTWDDIGALQDIREELTMAILAPVRSPEQFKALGLSAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCPRRSGHESGASVRVVNQLLTEMDGLETRR--QVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLP-PPADRHAILLTITKGGMKPRL------ESDVSLE----AIASDERCDCFTGADLSALVREA 859          

HSP 2 Score: 133.265 bits (334), Expect = 1.751e-31
Identity = 81/242 (33.47%), Postives = 131/242 (54.13%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHK-NTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKN 1905
            +K+ D+GG++E   +L  ++ +++  E + +       G +L+GPPGCGKT+LA+A++ E E   + +S  +++S   GESE+ +RE F+ A S+ PCILFIDEIDA+  KR+  +      IV   L  MD ++S     Q+L+IGATN  + +D A+ R+GR  R I + IP     RL +L    +             ++   V+  F Q++    T  +  +DL AL  E+     N
Sbjct:  273 VKFEDVGGNEETLTELCKLLIHMRHPEVYQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGEMELPMLKVSAPELVSGVSGESEQKLRELFDQAVSNAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLSVPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDE-GTRLRILQTLCR-------------KLRLPVDFDFRQLAR--LTPGYVGADLMALCREAAMSAVN 498          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: nvl (nuclear VCP like [Source:NCBI gene;Acc:103033742])

HSP 1 Score: 174.096 bits (440), Expect = 2.158e-44
Identity = 95/262 (36.26%), Postives = 153/262 (58.40%), Query Frame = 1
Query: 1132 IADEFNRIIASGEIKLK----IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERF-----YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            + D+F   +AS +   K        D+ W DIG   +++E+L   I+  V+  E+F         GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F   R+S PC++F DEIDALC +R     G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID A+ R GRL + + V +P  P  R ++L+  +K G  P+       E + S+E     I+SD+  + ++ +DL+AL+ E+
Sbjct:  611 LMDDFKASLASVQPSAKREGFATVPDVTWDDIGALQDIREELTMAILAPVRSPEQFKALGLSAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCPRRSGHESGASVRVVNQLLTEMDGLETRR--QVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLP-PPADRHAILLTITKGGMKPRL------ESDVSLE----AIASDERCDCFTGADLSALVREA 859          

HSP 2 Score: 133.265 bits (334), Expect = 1.751e-31
Identity = 81/242 (33.47%), Postives = 131/242 (54.13%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHK-NTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKN 1905
            +K+ D+GG++E   +L  ++ +++  E + +       G +L+GPPGCGKT+LA+A++ E E   + +S  +++S   GESE+ +RE F+ A S+ PCILFIDEIDA+  KR+  +      IV   L  MD ++S     Q+L+IGATN  + +D A+ R+GR  R I + IP     RL +L    +             ++   V+  F Q++    T  +  +DL AL  E+     N
Sbjct:  273 VKFEDVGGNEETLTELCKLLIHMRHPEVYQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGEMELPMLKVSAPELVSGVSGESEQKLRELFDQAVSNAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLSVPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDE-GTRLRILQTLCR-------------KLRLPVDFDFRQLAR--LTPGYVGADLMALCREAAMSAVN 498          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: zgc:136908 (zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22])

HSP 1 Score: 155.221 bits (391), Expect = 1.041e-38
Identity = 102/274 (37.23%), Postives = 152/274 (55.47%), Query Frame = 1
Query: 1015 GDIWNCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWS----------------------DIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNS---IVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
             D  + E +A  T G+   ++ ALC++  L+   K   LID+ DE   I A     L +  DD +W+                      DIGG DEVK +L+ ++   V+  ++F K     S GV+ YGPPGCGKT+LAKA++NE + +FV++   ++L+ + GESE NVR+ F+ AR + PCILF DE+D++   R      +  +   ++N  L EMDG+ + KN  + IIGATN  + ID AI R GRL +LI + +P  P  R ++L A
Sbjct:  334 ADDVDLERIATDTHGHVGADLAALCSEAALQAIRKKMTLIDLEDE--TIDADLLNSLAVTMDDFRWALSQSNPSALRETVVEVPQVNWEDIGGLDEVKRELQELVQYPVEYPDKFLKFGMTPSRGVLFYGPPGCGKTLLAKAIANECQANFVSIKGPELLTMWFGESEANVRDVFDKARQAAPCILFFDELDSIAKSRGGGAGDAGGAADRVINQILTEMDGMTNKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDMP-SRTAILRA 602          

HSP 2 Score: 121.709 bits (304), Expect = 5.443e-28
Identity = 71/197 (36.04%), Postives = 111/197 (56.35%), Query Frame = 1
Query: 1297 GVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            G++LYGPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF  A  + P I+FIDE+DA+  KR+  +      IV+  L  MDG+   +   ++++ ATN    +D A+ R GR  R I++ IP S   RL +L   +KN             M  + +    +I++D  T     +DLAAL +E+
Sbjct:  183 GILLYGPPGTGKTLVARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL--KQRVHVVVMAATNRPNSVDPALRRFGRFDREIDIGIPDS-TGRLEILQIHTKN-------------MKLADDVDLERIATD--THGHVGADLAALCSEA 361          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:NCBI gene;Acc:103032828])

HSP 1 Score: 133.265 bits (334), Expect = 6.185e-33
Identity = 71/185 (38.38%), Postives = 109/185 (58.92%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR---NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRL 1722
            D+ ++DIGG D  K++++  ++        YK        GV++YGPPGCGKTMLAKA+++    +F+ +  ++ + KY GE  + VR+ F  A+ + P I+FIDEIDA+ +KR D   G+      I+   L +MDG D + N +  +I ATN  + +D A+ R GRL R IE  +P   Q+RL
Sbjct:  163 DVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVK--VIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL 345          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:103035644])

HSP 1 Score: 129.028 bits (323), Expect = 1.001e-31
Identity = 68/178 (38.20%), Postives = 106/178 (59.55%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLKNIMDN-VKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLM---EMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            D+ +SD+GG  E  EKL+ +++  +   ERF         GV+L+GPPG GKT+ A+A++N  +  F+ +  ++++ KY GE  + VRE F  AR+ + C++F DEIDA+   R DD  G  N +  T L    ++DG D   N ++L+  ATN  + +D A+ R GRL R IE ++P
Sbjct:  131 DVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLM--ATNRPDTLDPALMRPGRLDRKIEFSLP 306          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: nvl (nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-2871])

HSP 1 Score: 168.318 bits (425), Expect = 1.211e-44
Identity = 87/237 (36.71%), Postives = 142/237 (59.92%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLK-NIMDNVKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            D+ W DIG  + ++E+L   I+  ++  E F         G++L GPPGCGKTMLAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  AR+S PC++F DEIDA+C +R D   G+   +VN  L EMDG+++ K  Q+ I+ ATN  + +D+A+ R GRL + + V +P    +R ++L   ++ GT P        +++ +V      I+ D  ++ +S +DL AL  E+
Sbjct:  254 DVTWDDIGALEAIREELSLAILAPIRHPEMFQVLGLTSPAGILLAGPPGCGKTMLAKAIANESGLNFISVKGPELLNMYVGESERAVRQVFQRARNSAPCVIFFDEIDAICPRRSDHESGASVRVVNQLLTEMDGLEARK--QVFIMAATNRPDILDRAVLRPGRLDKTLYVGLPVM-AERAAILRTLTRGGTKPPLE----KDVDLNV------IAGDGRSDGFSGADLQALTREA 477          

HSP 2 Score: 83.9593 bits (206), Expect = 4.511e-17
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 1
Query: 1360 EHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            E +   + ++  +++S   GESE+ +RE F  A  S PC+LF+DEIDA+  KR+  +      +V   L  MDG+  H    +L IGATN  + +D A+ R+GR  R I + IP
Sbjct:    1 ELDVPLIQVAGPEVVSGVSGESEQKLRELFQVASESAPCVLFLDEIDAITPKREMASKDMERRLVAQLLTCMDGL--HGGGAVLCIGATNRPDALDPALRRAGRFDREICLGIP 112          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 149.828 bits (377), Expect = 4.460e-40
Identity = 97/270 (35.93%), Postives = 152/270 (56.30%), Query Frame = 1
Query: 1027 NCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWS----------------------DIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKR---DDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
            + E++   T G+   ++ ALC++  L+   K   +ID+ DE   I A     L +  DD +W+                      DIGG + VK +L+ ++   V+  E+F K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVR+ F+ AR + PC+LF DE+D++   R     D  G+ + ++N  L EMDG+ + KN  + IIGATN  + ID AI R GRL +LI + +P   + R ++L A
Sbjct:   52 DLEQVGNETHGHVGADLAALCSEAALQAIRKKMDVIDLEDE--TIDAEIMNSLAVTMDDFRWALGQSNPSALRETVVEVPNVTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMGTKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDE-KSRSAILKA 316          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 148.673 bits (374), Expect = 1.176e-38
Identity = 96/282 (34.04%), Postives = 159/282 (56.38%), Query Frame = 1
Query:  985 YLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADE----------------FNRIIA----SGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNS---IVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
            + K+  + V+ D+   E++A  T G+   ++ ALC++  L+   K   +ID+ DE                F   +A    S   ++ ++  ++ W DIGG + VK +L+ ++   V+  E+F K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVR+ F+ AR + P +LF+DE+D++   R         +   ++N  L EMDG+  +KN  + IIGATN  + ID AI R GRL +LI + +P   + R ++L A
Sbjct:   24 HTKNMKLSVDVDL---EQIANQTHGHVGADLAALCSEAALQAIRKKMDVIDLDDETIDAEIMNSLAVTMDDFRWALAQSNPSALREMVVEVPNVTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQASPTVLFLDELDSIAKARGGGVGDGGGAADRVINQILTEMDGMGVNKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDE-KSRTAILKA 299          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006168.1 (pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-1 gene:ENSPMAG00000005566.1 transcript:ENSPMAT00000006168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 1.443e-33
Identity = 71/185 (38.38%), Postives = 107/185 (57.84%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR---NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRL 1722
            D+ + DIGG D  K++++  ++        YK        GV++YGPPGCGKTMLAKA+++    +F+ +  ++ + KY GE  + VR+ F  A+ + P I+FIDEIDA+ +KR D   G+      I+   L +MDG D   N +  +I ATN  + +D A+ R GRL R IE  +P   Q+RL
Sbjct:  116 DVTYVDIGGMDIQKQEVREAVELPLTHFDLYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVK--VIMATNRADTLDPALLRPGRLDRKIEFPMPDRRQKRL 298          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 130.183 bits (326), Expect = 2.860e-32
Identity = 81/232 (34.91%), Postives = 135/232 (58.19%), Query Frame = 1
Query: 1198 IKWSDIGGHDEVKEKLKNI--MDNVKD---TERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDA-LCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAAL 1875
            ++W DI G +  K+ L+ I  + +++    T     + G++L+GPPG GKTMLAKA+++E   +F  +S A + SKY GE EK VR  F+ AR  QP I+FIDE+D+ LC +R+ ++  SR  +   FL+E DG+ S    ++L++GATN  +++D+A+ R  R  + I V++P+  +   ++ ++ S    NP         ++ +     ++I     TE +S SDL AL
Sbjct:  202 VQWDDIAGQELAKQALQEIVILPSLRPELFTGLRAPAKGLLLFGPPGNGKTMLAKAVASESSATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSVLCERREGEHEASRR-LKTEFLVEFDGVQSSGEDRVLVMGATNRPQELDEAVLR--RFSKRIYVSLPEE-EVPTAIAVSLSWKHANP---------LSHADRAHLARI-----TEGYSGSDLTAL 415          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: RIX7 (Putative ATPase of the AAA family; required for export of pre-ribosomal large subunits from the nucleus; distributed between the nucleolus, nucleoplasm, and nuclear periphery depending on growth conditions [Source:SGD;Acc:S000003957])

HSP 1 Score: 159.458 bits (402), Expect = 9.796e-41
Identity = 84/237 (35.44%), Postives = 144/237 (60.76%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            D+ W+++G    V+ +L   I+  +K  E + K       GV+L+GPPGCGKT+LAKA++NE   +F+++   ++L+KY GESE+++R+ F  AR+S PC++F DE+DAL  +RD     S + +VNT L E+DG++  +   + +IGATN  + ID A+ R GRL + + + +P + +++L ++   +K+   P            S +  F +I  ++   ++S +DLAAL+ ES
Sbjct:  529 DVTWANVGALQRVRLELNMAIVQPIKRPELYEKVGISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLLTELDGLNDRRG--IFVIGATNRPDMIDPAMLRPGRLDKSLFIELPNT-EEKLDIIKTLTKSHGTP-----------LSSDVDFEEIIRNEKCNNFSGADLAALVRES 751          

HSP 2 Score: 122.479 bits (306), Expect = 5.263e-29
Identity = 73/191 (38.22%), Postives = 108/191 (56.54%), Query Frame = 1
Query: 1213 IGGHDEVKEKLKNIMD-NVKDTERFYKSN-----GVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNS----IVNTFLMEMDGIDSHKNT--QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
            +GG D+V  +L  ++   +   E F  +      GV+L+GPPGCGKT +A AL+ E +  F+++S   ++S   GESEK +R+ F+ ARS  PC++F DEIDA+  KRD    G++      IV   L  MD +   K     ++IIGATN  + +D A+ R+GR  R I +N+P     RL +L   S N
Sbjct:  207 LGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDG---GAQREMERRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNVPNE-VSRLHILKKMSDN 393          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: CDC48 (AAA ATPase; subunit of polyUb-selective segregase complex involved in ERAD, INM-associated degradation (INMAD), mitotic spindle disassembly, macroautophagy, PMN, ribosome-associated degradation, ribophagy, homotypic ER membrane fusion, SCF complex disassembly, cell wall integrity during heat stress, and telomerase regulation; mobilizes membrane-anchored transcription factors by regulated Ub/proteasome-dependent processing (RUP); human ortholog VCP complements a cdc48 mutant [Source:SGD;Acc:S000002284])

HSP 1 Score: 152.91 bits (385), Expect = 1.441e-38
Identity = 95/272 (34.93%), Postives = 156/272 (57.35%), Query Frame = 1
Query: 1015 GDIWNCEEMARLTPGYQIGEIEALCTKLKMAY--KGNPLIDI-ADEFN-RIIASGEIKLK------------------IKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRD---DDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
             D  + E +A  T GY   +I +LC++  M    +   LID+  DE +  ++ S  + +                   +++ ++ W D+GG DE+KE+LK  ++  V   +++ K     S GV+ YGPPG GKT+LAKA++ E   +F+++   ++LS + GESE N+R+ F+ AR++ P ++F+DE+D++   R     D  G+ + +VN  L EMDG+++ KN  + +IGATN  ++ID AI R GRL +LI V +P     RLS+L A
Sbjct:  401 ADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKN--VFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDE-NARLSILNA 669          

HSP 2 Score: 127.102 bits (318), Expect = 1.736e-30
Identity = 68/192 (35.42%), Postives = 113/192 (58.85%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
            +++ + DIGG  +   +++ +++      + +K+       GV++YGPPG GKT++A+A++NE    F  ++  +++SK  GESE N+R+AF  A  + P I+FIDEID++  KRD  N      +V+  L  MDG+ +  N  +++I ATN    ID A+ R GR  R +++ IP +   RL VL   +KN
Sbjct:  209 NEVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSN--VVVIAATNRPNSIDPALRRFGRFDREVDIGIPDA-TGRLEVLRIHTKN 397          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: AFG2 (ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a hexameric complex; is essential for pre-60S maturation and release of several preribosome maturation factors; releases Rlp24p from purified pre-60S particles in vitro; target of the ribosomal biosynthesis inhibitor diazaborine; may be involved in degradation of aberrant mRNAs [Source:SGD;Acc:S000004389])

HSP 1 Score: 147.902 bits (372), Expect = 4.615e-37
Identity = 91/257 (35.41%), Postives = 140/257 (54.47%), Query Frame = 1
Query: 1039 MARLTPGYQIGEIEALC--TKLKMAYKG-------------NPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASK 1746
            +A  T GY   ++ ALC  + +K   +G               L D+      I  S   ++ ++   + WSDIGG +E+K K+K ++   ++ +E F +       GV+LYGPPGC KT+ AKAL+ E   +F+ +   +I +KY GESE+ +RE F  ARS+ P I+F DEIDAL   RD  +  + N ++ + L E+DG++  K   ++I+ ATN  ++ID A+ R GRL R I V  P     RL +L   +K
Sbjct:  445 IASKTHGYVGADLTALCRESVMKTIQRGLGTDANIDKFSLKVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDEIDALSPDRDGSSTSAANHVLTSLLNEIDGVEELKG--VVIVAATNRPDEIDAALLRPGRLDRHIYVG-PPDVNARLEILKKCTK 698          

HSP 2 Score: 120.168 bits (300), Expect = 2.701e-28
Identity = 63/177 (35.59%), Postives = 103/177 (58.19%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNS-IVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            + + ++ +GG D+  E LK+ ++        + S       G++L+GPPG GKTML + ++N      +T++   I+SKY GE+E  +R+ FN AR  QP I+FIDEID++   R +D+ G   S +V T L  MDG+ +    ++++I ATN    +D A+ R GR  + +E+ IP
Sbjct:  240 EPLSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEIDSIAPNRANDDSGEVESRVVATLLTLMDGMGAAG--KVVVIAATNRPNSVDPALRRPGRFDQEVEIGIP 414          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: PEX6 (AAA-peroxin; heterodimerizes with AAA-peroxin Pex1p and participates in the recycling of peroxisomal signal receptor Pex5p from the peroxisomal membrane to the cystosol; mutations in human PEX6 can lead to severe peroxisomal disorders and early death [Source:SGD;Acc:S000005273])

HSP 1 Score: 140.198 bits (352), Expect = 1.862e-34
Identity = 75/210 (35.71%), Postives = 129/210 (61.43%), Query Frame = 1
Query: 1138 DEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFY----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDD--DNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASK 1746
            +EF+  I + +I       ++ W DIGG D VK ++ + +D  +K  E F     K +G++ YGPPG GKT++AKA++     +F ++   ++L+ Y GESE NVR  F  AR ++PC++F DEID++  KR +  D+ G  + IV+  L E+DG+ +  +  + +IGATN  + +D+A+ R GR  +L+ + IP +  ++L++L A ++
Sbjct:  715 NEFSVSIGAPQIP------NVTWDDIGGIDFVKGEILDTIDMPLKHPELFTSGMKKRSGILFYGPPGTGKTLMAKAIATNFSLNFFSVKGPELLNMYIGESEANVRRVFQKAREAKPCVIFFDEIDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSTDAD-GVFVIGATNRPDLLDEALLRPGRFDKLLYLGIPDTDTKQLNILEALTR 917          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: PEX1 (AAA-peroxin; heterodimerizes with AAA-peroxin Pex6p and participates in the recycling of peroxisomal signal receptor Pex5p from the peroxisomal membrane to the cystosol; induced by oleic acid and upregulated during anaerobiosis; mutations in human PEX1 can lead to severe peroxisomal disorders and early death [Source:SGD;Acc:S000001680])

HSP 1 Score: 133.265 bits (334), Expect = 3.213e-32
Identity = 89/285 (31.23%), Postives = 153/285 (53.68%), Query Frame = 1
Query:  940 WSIEFPIIDKLNREKYLKHF-----LIEVNGDIWNCEEMARLTPGYQIGEIEALCTK----LKMAYKGNPLID---IADEFNRIIASGEIKLKI-KTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
            WS+  P  DK  R K L++F     ++++N D+    +++  T G+   ++E    K    L++    + ++     +   +    S    +K+ K  +IKW DIG     K+ L   ++     E  + +      +G++LYG PGCGKT+LA A++ +   +F+++   +IL+K+ G SE+N+RE F  A+S +PCILF DE D++  KR  D+ G  + +VN  L +MDG +      + I+ AT+  + ID A+ R GRL + +  NIP +  +RL +L A
Sbjct:  598 WSLRAP--DKHARAKLLEYFFSKNQIMKLNRDL-QFSDLSLETEGFSPLDLEIFTEKIFYDLQLERDCDNVVTRELFSKSLSAFTPSALRGVKLTKETNIKWGDIGALANAKDVLLETLEWPTKYEPIFVNCPLRLRSGILLYGYPGCGKTLLASAVAQQCGLNFISVKGPEILNKFIGASEQNIRELFERAQSVKPCILFFDEFDSIAPKRGHDSTGVTDRVVNQLLTQMDGAEGLDG--VYILAATSRPDLIDSALLRPGRLDKSVICNIP-TESERLDILQA 876          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO36218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ61])

HSP 1 Score: 153.295 bits (386), Expect = 2.474e-38
Identity = 110/310 (35.48%), Postives = 165/310 (53.23%), Query Frame = 1
Query: 1015 GDIWNCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDD----------------------IKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKR---DDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTE 1845
            GD  + E++A  T GY   ++ +LC++  L+   +   LID+ DE   I A     L +  DD                      + W DIGG + VK +L+ ++   V+  ++F K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVR+ F+ ARS+ PC+LF DE+D++   R     D  G+ + ++N  L EMDG++  KN  + IIGATN  + ID AI R GRL +LI + +P     R S+L A      N +  P + D     V  V    S  D TE
Sbjct:  386 GDDVDLEQIAAETHGYVGSDVASLCSEAALQQIREKMDLIDLEDE--TIDAEVLDSLAVSMDDFRYAMGVSNPSALRETVVEVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARSAAPCVLFFDELDSIAKSRGGNVGDGGGAADRVINQVLTEMDGMNVKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDD-GSRSSILKA------NLRKSPIAKDVDLDYVAKVTHGFSGADLTE 684          

HSP 2 Score: 124.79 bits (312), Expect = 2.768e-29
Identity = 75/238 (31.51%), Postives = 131/238 (55.04%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +++ + DIGG  +   ++K +++      + +K+       G++L+GPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF  A  + P I+FIDEIDA+  KRD  +      IV+  L  MDG+   + + ++++ ATN    +D A+ R GR  R +++ IP +   RL +L   +KN             M    +    QI+++  T  +  SD+A+L +E+
Sbjct:  194 NEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLMARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGL--KQRSHVIVMAATNRPNSVDVALRRFGRFDREVDIGIPDA-TGRLEILRIHTKN-------------MKLGDDVDLEQIAAE--THGYVGSDVASLCSEA 413          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO35705 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKV3])

HSP 1 Score: 151.369 bits (381), Expect = 3.134e-38
Identity = 99/302 (32.78%), Postives = 157/302 (51.99%), Query Frame = 1
Query: 1018 DIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLK----IKTDDIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCS-KRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENV-FSQISSDDFTEDWSHSDLAALIAES 1887
            D WN  E  R  P     ++ +LC  +             D+F   +A  +   K        D+ W+++G   +V+E+L   I+  V+  E F         G++L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F  AR+S PC++F DE+D+LC  +      GS   +VN  L EMDG+ + K+  + I+GATN  + ID A+ R GRL +++ V +P S   R  +L   +K G  P           F + +V    ++ D     +S +DLAAL+ E+
Sbjct:  236 DSWNVMEWLRQQPPLTSEQLSSLCITM-------------DDFVGALAVTQPSAKREGFATVPDVTWANVGALKDVREELTMAILAPVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGINFISVKGPELLNMYVGESERAVRQVFQRARNSAPCVIFFDELDSLCPRRSGSSESGSSVRVVNQLLTEMDGLQARKH--VFIMGATNRPDIIDPAVMRPGRLDKVLYVGLP-SAHDRQDILRTLTKEGRKP-----------FLLPDVHLGLLAEDTRCNGFSGADLAALVREA 510          

HSP 2 Score: 130.568 bits (327), Expect = 1.828e-31
Identity = 73/199 (36.68%), Postives = 113/199 (56.78%), Query Frame = 1
Query: 1291 SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            + G +L+GPPGCGKT+LA A++ E E  F+ ++  +I+S   GESE+ VRE F +A +  PCILF+DEIDA+  KR++ +      IV+  L  MD ++++ +  +L+IGATN  + +D A+ R+GR  R I + IP     R S+L    K             ++  S +  FS +S    T  +  +DL AL  E+
Sbjct:   15 TTGFLLHGPPGCGKTLLAHAIAGELEMPFLKLAATEIVSGVSGESEEKVRELFTSAVAQAPCILFLDEIDAITPKRENASKDMERRIVSQLLSCMDDLNNNPDAHVLVIGATNRPDSLDPALRRAGRFDREISMGIPDE-SARASILRVMCK-------------QLKLSAD--FSFLSLSRQTPGYVGADLMALTREA 197          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO48602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ14])

HSP 1 Score: 145.591 bits (366), Expect = 3.249e-36
Identity = 75/196 (38.27%), Postives = 120/196 (61.22%), Query Frame = 1
Query: 1186 KTDDIKWSDIGGHDEVKEK-LKNIMDNVKDTERF---YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSK--RDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGT 1755
            K  DI W D+GG D VKE+ L  I   +   E F    + +GV+LYGPPG GKT++AKA++ E   +F+++   ++++ Y G+SE+NVRE F+ A+++ PC++F DE+D+L     R  D+ G  + +V   L E+DG+  H    + +IGATN  + +D A+ R GR  +L+ + + K    +LSVL A ++  T
Sbjct:  394 KIPDISWKDVGGLDSVKEEILDTIQLPLLHPELFAAGLRRSGVLLYGPPGTGKTLMAKAVATECSLNFLSVKGPELINMYVGQSEQNVREVFSRAQAASPCVIFFDELDSLAPNRGRSGDSGGVMDRVVAQLLAELDGL--HSTCDVFVIGATNRPDLLDPALLRPGRFDKLLYLGVSKDHHAQLSVLKALTRKFT 587          

HSP 2 Score: 49.2914 bits (116), Expect = 6.622e-6
Identity = 32/106 (30.19%), Postives = 51/106 (48.11%), Query Frame = 1
Query: 1213 IGGHDEVKEKLKNIMDNVKDTERFYKS---NG-----VILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDAL 1506
            + GH   +EKL+ I+       R Y S   NG     V+L G PG GK  +  A+S++   +   +SC D++      +E  ++  F  A   +PCIL +  I A+
Sbjct:  120 VPGHKTSQEKLEKII-------RPYLSKRVNGPPFVQVLLTGLPGTGKRAICMAVSSQLNLAVQEISCFDLIGDSVAATETRIKNLFVRANDCRPCILLLRHIHAI 218          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO39006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBC8])

HSP 1 Score: 143.28 bits (360), Expect = 8.023e-36
Identity = 85/262 (32.44%), Postives = 148/262 (56.49%), Query Frame = 1
Query: 1129 DIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRN-SIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQR--LSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            D+   F  +  S   ++ ++   + WSD+GG++ +K KLK  ++  +K  E F +       G+++YGPPGC KT++A+AL+ E   +F+ +   ++ SK+ GESEK VRE F  AR++ P I+F DE+DA+  +R+       N  ++   L E+DG+++ K+  ++ I ATN  + IDKA+ R GR+ RLI V +P    +R  L + +A +         PC   E +  +E++  +      TE +S +++AA+  E+
Sbjct:  282 DMRAAFRCVRPSAMREVALEVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPRGILMYGPPGCSKTLIARALATESGLNFIAIKGPELFSKWVGESEKAVREVFLKARATAPSIVFFDELDAIAGQRNSTGGSDVNDRVLTQLLTELDGVETLKD--VIFIAATNRPDMIDKALMRPGRVDRLIYVPLPCWDTRRHILEIHLART---------PC---EGSLDLEDLVER------TEGYSGAEIAAVCREA 523          

HSP 2 Score: 121.709 bits (304), Expect = 9.049e-29
Identity = 62/153 (40.52%), Postives = 93/153 (60.78%), Query Frame = 1
Query: 1294 NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGID-SHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKN 1749
             G++LYGP G GKTM+A+A++NE    F  ++  ++LS+Y GE+E  +RE F  A++  P I+FIDE+DALC +RD         +V T L  MDG+     +T ++++ ATN  + +D A+ R GR  R IE+ IP S   R  +L+   KN
Sbjct:   62 RGILLYGPSGTGKTMIARAVANETGVHFFCINGPEVLSRYYGETEARLREIFTEAQNKSPSIVFIDELDALCPRRDKVQNEFERRVVATLLTLMDGMHMKSTDTYVMVLAATNRPDALDPALRRPGRFDREIEIGIP-SVTDRRDILVTLLKN 213          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO26554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBQ1])

HSP 1 Score: 129.798 bits (325), Expect = 7.349e-33
Identity = 70/185 (37.84%), Postives = 109/185 (58.92%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR---NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRL 1722
            ++ +++IGG D  K++++  ++        YK        GV+LYGPPGCGKTMLAKA+++    +F+ +  ++ + KY GE  + VR+ F  A+ + P I+FIDEIDA+ +KR D   G+      I+   L +MDG D + N +  +I ATN  + +D A+ R GRL R IE  +P   Q+RL
Sbjct:  134 NVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPRGVLLYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVK--VIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRL 316          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: nvl (nuclear VCP like [Source:NCBI gene;Acc:101154831])

HSP 1 Score: 181.8 bits (460), Expect = 3.793e-47
Identity = 101/284 (35.56%), Postives = 159/284 (55.99%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLK-NIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES-------YQEMKNDPNADGSNCVTMLHVLSAHRAKNREK-KINISPK 2004
            D+ W  +G   +V+E+L   I+  V+  E F        +GV+L GPPGCGKT+LAKA++NE   +F+++   ++L+ Y GESE+ VR+ F   R+S PC++F DEIDALC +R     G+   +VN  L EMDG+++ +  Q+ I+ ATN  + ID A+ R GRL + + V +P  P  R ++L+A +K GT P+ GP          +    +I+SD+    +S +DL AL+ E+       Y + +    A  S C   + V   H  +   K + ++SPK
Sbjct:  531 DVSWEHVGALQDVREELTMAILAPVRSPELFRALGLGAPSGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCPRRSGHESGASIRVVNQLLTEMDGLETRR--QVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLP-GPADRCAILLAITKGGTRPQLGP----------DVHLEEIASDERCSSFSGADLTALVREASVNALKDYLKSQQGGEALPSGCTVDIQVSRVHFEEALNKVRPSVSPK 801          

HSP 2 Score: 130.183 bits (326), Expect = 1.519e-30
Identity = 73/201 (36.32%), Postives = 117/201 (58.21%), Query Frame = 1
Query: 1177 LKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNT-QLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNP 1761
            L+++   + + D+GG++E   ++  ++  +   E F +       G +L+GPPGCGKT+LA+A++ E +   + +S  +++S   GESE+ +RE F+ A SS PCILFIDEIDA+  KR+  +      +V   L  MD ++S   T Q++IIGATN  + +D A+ R+GR  R I + IP     RL +L    +  T P
Sbjct:  217 LELQYPCVTFEDVGGNEEALTEVCKLLIYMHHPEVFQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGELQLPLLKVSAPELVSGVSGESEQKLRELFDQAVSSSPCILFIDEIDAITPKREVASKDMERRMVAQLLTCMDDLNSLPVTVQVMIIGATNRPDSLDPALRRAGRFDREISLGIPDE-AARLRILETLCRKLTLP 416          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:101174924])

HSP 1 Score: 157.532 bits (397), Expect = 3.447e-39
Identity = 103/274 (37.59%), Postives = 156/274 (56.93%), Query Frame = 1
Query: 1015 GDIWNCEEMARLTPGYQIGEIEALCTK--LKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWS----------------------DIGGHDEVKEKLKNIMD-NVKDTERFYK-----SNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKR---DDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
             D  + E++A  T G+   ++ ALC++  L+   K   LID+ DE   I A     L +  DD KW+                      DIGG ++VK +L+ ++   V+  ++F K     S GV+ YGPPGCGKT+LAKA++NE + +F+++   ++L+ + GESE NVRE F+ AR + PC+LF DE+D++   R     D  G+ + ++N  L EMDG+ S KN  + IIGATN  + ID AI R GRL +LI + +P   + R+S+L A
Sbjct:  399 ADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE--TIDAEVMNSLAVTMDDFKWALSQSNPSALRETIVEVPNITWDDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDE-KSRISILKA 667          

HSP 2 Score: 123.635 bits (309), Expect = 1.522e-28
Identity = 79/241 (32.78%), Postives = 132/241 (54.77%), Query Frame = 1
Query: 1192 DDIKWSDIGGHDEVKEKLKNIMDNVKDTER---FYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAES 1887
            +++ + DIGG   V+++L  I + V+   R    +K+       G++LYGPPG GKT++A+A++NE    F  ++  +I+SK  GESE N+R+AF  A  + P I+FIDE+DA+  KR+  +      IV+  L  MDG+   +   ++++ ATN    ID A+ R GR  R +++ IP +   RL +L   +KN             M  + +    Q++++  T     +DLAAL +E+
Sbjct:  207 NEVGYDDIGG---VRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL--KQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDA-TGRLEILQIHTKN-------------MKLADDVDLEQVANE--THGHVGADLAALCSEA 426          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:NCBI gene;Acc:101162317])

HSP 1 Score: 133.265 bits (334), Expect = 5.683e-33
Identity = 73/193 (37.82%), Postives = 111/193 (57.51%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS------NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSR---NSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASK 1746
            D+ ++DIGG D  K++++  ++        YK        GV++YGPPGCGKTMLAKA+++    +F+ +  ++ + KY GE  + VR+ F  A+ + P I+FIDEIDA+ +KR D   G+      I+   L +MDG D + N +  +I ATN  + +D A+ R GRL R IE  +P   Q+RL      SK
Sbjct:  160 DVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVK--VIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSK 350          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: pex6 (peroxisomal biogenesis factor 6 [Source:NCBI gene;Acc:101175128])

HSP 1 Score: 135.576 bits (340), Expect = 3.164e-32
Identity = 84/265 (31.70%), Postives = 143/265 (53.96%), Query Frame = 1
Query: 1033 EEMARLTPGYQIGEIEAL--------CTKLKMAYKGNPLIDIA--------DEFNRII-----ASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERF-------YKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSK--RDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMA 1737
            E +++LT G+ +G++ AL        C +L+ +       D+          +F   +     A  +     K  ++ W DIGG   VK   K I+D V+   +            GV+LYGPPG GKT+LAKA++ E   +F+++   ++++ Y G+SE+N+RE F+ ARS+ PC++F DE+D+L  +  R  D+ G  + +V+  L E+D ++S  +  + +IGATN  + +D+++ R GR  +LI V I +    +L VL A
Sbjct:  555 ERLSKLTAGFVLGDLNALVVEAGRAACRRLRQSCASRQQEDLCSSGVTVQNQDFTFALDVLQDAQSKSVGAPKIPNVHWEDIGGLQLVK---KEILDTVQLPLQHPELLSLGLNRTGVLLYGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENIREVFHRARSAAPCVVFFDELDSLAPRRGRSGDSGGVMDRVVSQLLAELDALNS--SVGVFVIGATNRPDLLDQSLLRPGRFDKLIYVGINEDRASQLQVLQA 814          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:101175703])

HSP 1 Score: 129.028 bits (323), Expect = 1.013e-31
Identity = 68/178 (38.20%), Postives = 106/178 (59.55%), Query Frame = 1
Query: 1195 DIKWSDIGGHDEVKEKLKNIMDN-VKDTERFY-----KSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLM---EMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIP 1701
            D+ +SD+GG  E  EKL+ +++  +   ERF         GV+L+GPPG GKT+ A+A++N  +  F+ +  ++++ KY GE  + VRE F  AR+ + C++F DEIDA+   R DD  G  N +  T L    ++DG D   N ++L+  ATN  + +D A+ R GRL R IE ++P
Sbjct:  131 DVTYSDVGGCKEQIEKLREVVETPLLHPERFVSLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLM--ATNRPDTLDPALMRPGRLDRKIEFSLP 306          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000040165.1 (SMESG000040165.1)

HSP 1 Score: 1348.95 bits (3490), Expect = 0.000e+0
Identity = 668/705 (94.75%), Postives = 681/705 (96.60%), Query Frame = 1
Query:  475 KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCKKIAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEXXXXXXXXXXXXMENMDFDSFDRDIERLGEGFEKVLLHFKFNYYPTKISDNFRFESDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLI---EVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVEICAGAKTIFIGGRHLSGKSTVIAMIAQKYKYNLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIHIDEREITERTLSEHFRFKKDFAVKLVFETLSTLKADITIPDFSRGELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE 2580
            KRQKVKSFNIEKDFC+YSTETLNMKLENFIEFPESLCKKIA +DSYI NQKRYLKILISGPA CGKSTLIY LAQEYKYRY RVGKRYMENMD DSFDRDIERLGEGFEKVLLHFKFN YPTKI+DNFRFESDASSKFLM+FESSDPGSL K A+WSIEFPII+KLNREKYL+HFL    EVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDN GSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDW+HSDLAALIAES+QEMKNDPNAD SNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQFNSHI+SQ+EICAGAKTIFIGGRHLSGKSTVIAMIAQKYKYNLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIH DEREITERTL E FRFK D AVKLVFETLSTLKADITIPDFSR ELKR FQECTRNK+DEIEIGKYLDRIPHWTHG+FNDFE  LNGILDLDE
Sbjct:  110 KRQKVKSFNIEKDFCLYSTETLNMKLENFIEFPESLCKKIAEIDSYIRNQKRYLKILISGPAKCGKSTLIYRLAQEYKYRYARVGKRYMENMDLDSFDRDIERLGEGFEKVLLHFKFNNYPTKIADNFRFESDASSKFLMVFESSDPGSLEKTADWSIEFPIINKLNREKYLRHFLFGNQEVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNSGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWNHSDLAALIAESHQEMKNDPNADSSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQFNSHIISQLEICAGAKTIFIGGRHLSGKSTVIAMIAQKYKYNLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIHFDEREITERTLLELFRFKTDLAVKLVFETLSTLKADITIPDFSREELKRLFQECTRNKIDEIEIGKYLDRIPHWTHGHFNDFEYYLNGILDLDE 814          

HSP 2 Score: 225.713 bits (574), Expect = 4.490e-62
Identity = 111/113 (98.23%), Postives = 112/113 (99.12%), Query Frame = 2
Query:  149 MNKDEIKKSIHLANIFITENSNGNVDEFIKYLFKNHPTLLNGRNIAKRKTVNKAFEYVRKQKESNIDESDWMFLDINVYRDEELLDTKDELNVSNKRKSQDSDDNAPTPKGKK 487
            MNKDEIKKSIHLANIFITENSNGNVDEFIKYLFKNHPTLLNGRNIAKRKTVNKAFEYVRKQKESNIDESDWMFLDINVYRDEELLDTKDELNVSNKRKSQDSDDNAPTPK +K
Sbjct:    1 MNKDEIKKSIHLANIFITENSNGNVDEFIKYLFKNHPTLLNGRNIAKRKTVNKAFEYVRKQKESNIDESDWMFLDINVYRDEELLDTKDELNVSNKRKSQDSDDNAPTPKRQK 113          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000000064.1 (SMESG000000064.1)

HSP 1 Score: 1321.22 bits (3418), Expect = 0.000e+0
Identity = 649/702 (92.45%), Postives = 674/702 (96.01%), Query Frame = 1
Query:  475 KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCKKIAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEXXXXXXXXXXXXMENMDFDSFDRDIERLGEGFEKVLLHFKFNYYPTKISDNFRFESDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVEICAGAKTIFIGGRHLSGKSTVIAMIAQKYKYNLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIHIDEREITERTLSEHFRFKKDFAVKLVFETLSTLKADITIPDFSRGELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE 2580
            KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCK+IAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHF+FNYYPTKISDNFRF+SDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTKLK++Y  NPLIDIADEF RII SGEIK K KTDDIKWSDIGGHDEVKE+LKNIM+ VK T+ + KS+GVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSK+QGESE+ VREAFNTARSSQPCILF+DEIDALCSKR DDN GS NSIVNTFLME+DG+  HKNTQLLIIGATNFIE+ID+AISR+ R+GR IE+NIPKSP+QR SVLMAASKNGTNPKFGPCSLDEMNFSVEN+F+QISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKK NISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVE  AGAK IFIGGRHLSGKST+I MIAQKYKYNLVTFDRNYFN FHID+FTQEI KFIKKNGPTLIHIDEREITERTLSE FRFKKDFAVKLVFETLSTLKADITIPDFSR ELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE
Sbjct:  107 KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCKQIAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHFEFNYYPTKISDNFRFKSDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTKLKISYNENPLIDIADEFKRIIESGEIKRKYKTDDIKWSDIGGHDEVKEQLKNIMNEVKGTKSYIKSDGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKFQGESEQKVREAFNTARSSQPCILFMDEIDALCSKRHDDNSGSLNSIVNTFLMELDGVAGHKNTQLLIIGATNFIERIDEAISRTCRMGRHIEINIPKSPEQRFSVLMAASKNGTNPKFGPCSLDEMNFSVENIFTQISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKTNISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVETRAGAKIIFIGGRHLSGKSTLIVMIAQKYKYNLVTFDRNYFNKFHIDEFTQEIRKFIKKNGPTLIHIDEREITERTLSELFRFKKDFAVKLVFETLSTLKADITIPDFSREELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE 808          

HSP 2 Score: 198.749 bits (504), Expect = 6.511e-53
Identity = 101/113 (89.38%), Postives = 105/113 (92.92%), Query Frame = 2
Query:  149 MNKDEIKKSIHLANIFITENSNGNVDEFIKYLFKNHPTLLNGRNIAKRKTVNKAFEYVRKQKESNIDESDWMFLDINVYRDEELLDTKDELNVSNKRKSQDSDDNAPTPKGKK 487
            MNK EIKKSIHLANIFITENSNG+VDEFIKYLFKNHPTLLNGRNI KRKTVNKAFEYVRKQKESNIDE++WMFLDI VYRDEE L   DELNVSNKRKSQDSDDNAPTPK +K
Sbjct:    1 MNKAEIKKSIHLANIFITENSNGDVDEFIKYLFKNHPTLLNGRNINKRKTVNKAFEYVRKQKESNIDENEWMFLDIYVYRDEEQL---DELNVSNKRKSQDSDDNAPTPKRQK 110          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000000064.1 (SMESG000000064.1)

HSP 1 Score: 1320.45 bits (3416), Expect = 0.000e+0
Identity = 649/702 (92.45%), Postives = 674/702 (96.01%), Query Frame = 1
Query:  475 KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCKKIAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEXXXXXXXXXXXXMENMDFDSFDRDIERLGEGFEKVLLHFKFNYYPTKISDNFRFESDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVEICAGAKTIFIGGRHLSGKSTVIAMIAQKYKYNLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIHIDEREITERTLSEHFRFKKDFAVKLVFETLSTLKADITIPDFSRGELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE 2580
            KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCK+IAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHF+FNYYPTKISDNFRF+SDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTKLK++Y  NPLIDIADEF RII SGEIK K KTDDIKWSDIGGHDEVKE+LKNIM+ VK T+ + KS+GVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSK+QGESE+ VREAFNTARSSQPCILF+DEIDALCSKR DDN GS NSIVNTFLME+DG+  HKNTQLLIIGATNFIE+ID+AISR+ R+GR IE+NIPKSP+QR SVLMAASKNGTNPKFGPCSLDEMNFSVEN+F+QISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKK NISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVE  AGAK IFIGGRHLSGKST+I MIAQKYKYNLVTFDRNYFN FHID+FTQEI KFIKKNGPTLIHIDEREITERTLSE FRFKKDFAVKLVFETLSTLKADITIPDFSR ELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE
Sbjct:   40 KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCKQIAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHFEFNYYPTKISDNFRFKSDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTKLKISYNENPLIDIADEFKRIIESGEIKRKYKTDDIKWSDIGGHDEVKEQLKNIMNEVKGTKSYIKSDGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKFQGESEQKVREAFNTARSSQPCILFMDEIDALCSKRHDDNSGSLNSIVNTFLMELDGVAGHKNTQLLIIGATNFIERIDEAISRTCRMGRHIEINIPKSPEQRFSVLMAASKNGTNPKFGPCSLDEMNFSVENIFTQISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKTNISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVETRAGAKIIFIGGRHLSGKSTLIVMIAQKYKYNLVTFDRNYFNKFHIDEFTQEIRKFIKKNGPTLIHIDEREITERTLSELFRFKKDFAVKLVFETLSTLKADITIPDFSREELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE 741          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000013648.1 (SMESG000013648.1)

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 629/705 (89.22%), Postives = 657/705 (93.19%), Query Frame = 1
Query:  475 KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCKKIAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEXXXXXXXXXXXXMENMDFDSFDRDIERLGEGFEKVLLHFKFNYYPTKISDNFRFESDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLI---EVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVEICAGAKTIFIGGRHLSGKSTVIAMIAQKYKYNLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIHIDEREITERTLSEHFRFKKDFAVKLVFETLSTLKADITIPDFSRGELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE 2580
            KRQKVKSFNIEKDFCIYSTETLNMKL NFIEFPESLCKKIA VDS ISNQ+ YLKILISGPA CGKSTLIY LAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHFKFN YPTKISDNFR ESDASSKFLMIFESSDPGSLVK A+ SIEFPIIDKLNRE YL+HFLI   EVNGDIWNCEEMARLTPGYQIGEI+ALCTKLK AY  NPLIDIADEFNRII SGEIK K KTDDIKWSDIGGHDEVKE+LKNIM+ VK  + + KS+GVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESE+ VREAFNTARSSQPCILF+DEIDALCSKR DD+ GS NSIVNTFLME+DG+  HKNTQLLIIGATNFIE+ID+AISR+ R+GR IE+NIPKSP+QR SVLMAASKNGTNPKFGPCSLDEMNFSVE +F+QISSDDFTEDW+HSDLA+LI +SYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKK NISPKFNKYAKPILAEELERKF NKFQFNSHIMSQVE  AGAK IFIGGRHLSGKST+IAMIAQKYKYNLVTFDRNYFN FHID+FTQEI KFIKKNGPTLIHIDEREITERTLSE FRFKKDFAVKLVFETLSTLKADI IPDFSR ELK  FQECTRNKLDEIEIGKYLDRIPHWTHG+FNDFEQCLNGILDLDE
Sbjct:  107 KRQKVKSFNIEKDFCIYSTETLNMKLGNFIEFPESLCKKIATVDSDISNQENYLKILISGPAKCGKSTLIYRLAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHFKFNNYPTKISDNFRLESDASSKFLMIFESSDPGSLVKTADLSIEFPIIDKLNRENYLRHFLIGNQEVNGDIWNCEEMARLTPGYQIGEIKALCTKLKNAYNENPLIDIADEFNRIIESGEIKRKYKTDDIKWSDIGGHDEVKEQLKNIMNEVKGKKSYIKSDGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEQKVREAFNTARSSQPCILFMDEIDALCSKRHDDSRGSLNSIVNTFLMELDGVAGHKNTQLLIIGATNFIERIDEAISRTCRMGRHIEINIPKSPEQRFSVLMAASKNGTNPKFGPCSLDEMNFSVEKIFTQISSDDFTEDWTHSDLASLIYDSYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKTNISPKFNKYAKPILAEELERKFLNKFQFNSHIMSQVETRAGAKIIFIGGRHLSGKSTLIAMIAQKYKYNLVTFDRNYFNKFHIDEFTQEIRKFIKKNGPTLIHIDEREITERTLSELFRFKKDFAVKLVFETLSTLKADIKIPDFSREELKSSFQECTRNKLDEIEIGKYLDRIPHWTHGHFNDFEQCLNGILDLDE 811          

HSP 2 Score: 199.134 bits (505), Expect = 5.599e-53
Identity = 101/113 (89.38%), Postives = 105/113 (92.92%), Query Frame = 2
Query:  149 MNKDEIKKSIHLANIFITENSNGNVDEFIKYLFKNHPTLLNGRNIAKRKTVNKAFEYVRKQKESNIDESDWMFLDINVYRDEELLDTKDELNVSNKRKSQDSDDNAPTPKGKK 487
            MNK EIKKSIHLANIFITENSNG+VDEFIKYLFKNHPTLLNGRNI KRKTVNKAFEYVRKQKESNIDE++WMFLDI VYRDEE L   DELNVSNKRKSQDSDDNAPTPK +K
Sbjct:    1 MNKAEIKKSIHLANIFITENSNGDVDEFIKYLFKNHPTLLNGRNINKRKTVNKAFEYVRKQKESNIDENEWMFLDIYVYRDEEQL---DELNVSNKRKSQDSDDNAPTPKRQK 110          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000013648.1 (SMESG000013648.1)

HSP 1 Score: 1259.2 bits (3257), Expect = 0.000e+0
Identity = 629/705 (89.22%), Postives = 657/705 (93.19%), Query Frame = 1
Query:  475 KRQKVKSFNIEKDFCIYSTETLNMKLENFIEFPESLCKKIAAVDSYISNQKRYLKILISGPANCGKSTLIYHLAQEXXXXXXXXXXXXMENMDFDSFDRDIERLGEGFEKVLLHFKFNYYPTKISDNFRFESDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLKHFLI---EVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADEFNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKSNGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVREAFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSHKNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAASKNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEELERKFPNKFQFNSHIMSQVEICAGAKTIFIGGRHLSGKSTVIAMIAQKYKYNLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIHIDEREITERTLSEHFRFKKDFAVKLVFETLSTLKADITIPDFSRGELKRWFQECTRNKLDEIEIGKYLDRIPHWTHGYFNDFEQCLNGILDLDE 2580
            KRQKVKSFNIEKDFCIYSTETLNMKL NFIEFPESLCKKIA VDS ISNQ+ YLKILISGPA CGKSTLIY LAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHFKFN YPTKISDNFR ESDASSKFLMIFESSDPGSLVK A+ SIEFPIIDKLNRE YL+HFLI   EVNGDIWNCEEMARLTPGYQIGEI+ALCTKLK AY  NPLIDIADEFNRII SGEIK K KTDDIKWSDIGGHDEVKE+LKNIM+ VK  + + KS+GVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESE+ VREAFNTARSSQPCILF+DEIDALCSKR DD+ GS NSIVNTFLME+DG+  HKNTQLLIIGATNFIE+ID+AISR+ R+GR IE+NIPKSP+QR SVLMAASKNGTNPKFGPCSLDEMNFSVE +F+QISSDDFTEDW+HSDLA+LI +SYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKK NISPKFNKYAKPILAEELERKF NKFQFNSHIMSQVE  AGAK IFIGGRHLSGKST+IAMIAQKYKYNLVTFDRNYFN FHID+FTQEI KFIKKNGPTLIHIDEREITERTLSE FRFKKDFAVKLVFETLSTLKADI IPDFSR ELK  FQECTRNKLDEIEIGKYLDRIPHWTHG+FNDFEQCLNGILDLDE
Sbjct:   36 KRQKVKSFNIEKDFCIYSTETLNMKLGNFIEFPESLCKKIATVDSDISNQENYLKILISGPAKCGKSTLIYRLAQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHFKFNNYPTKISDNFRLESDASSKFLMIFESSDPGSLVKTADLSIEFPIIDKLNRENYLRHFLIGNQEVNGDIWNCEEMARLTPGYQIGEIKALCTKLKNAYNENPLIDIADEFNRIIESGEIKRKYKTDDIKWSDIGGHDEVKEQLKNIMNEVKGKKSYIKSDGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEQKVREAFNTARSSQPCILFMDEIDALCSKRHDDSRGSLNSIVNTFLMELDGVAGHKNTQLLIIGATNFIERIDEAISRTCRMGRHIEINIPKSPEQRFSVLMAASKNGTNPKFGPCSLDEMNFSVEKIFTQISSDDFTEDWTHSDLASLIYDSYQEMKNDPNADGSNCVTMLHVLSAHRAKNREKKTNISPKFNKYAKPILAEELERKFLNKFQFNSHIMSQVETRAGAKIIFIGGRHLSGKSTLIAMIAQKYKYNLVTFDRNYFNKFHIDEFTQEIRKFIKKNGPTLIHIDEREITERTLSELFRFKKDFAVKLVFETLSTLKADIKIPDFSREELKSSFQECTRNKLDEIEIGKYLDRIPHWTHGHFNDFEQCLNGILDLDE 740          

HSP 2 Score: 67.0106 bits (162), Expect = 4.489e-11
Identity = 35/42 (83.33%), Postives = 36/42 (85.71%), Query Frame = 2
Query:  362 MFLDINVYRDEELLDTKDELNVSNKRKSQDSDDNAPTPKGKK 487
            MFLDI VYRDEE LD   ELNVSNKRKSQDSDDNAPTPK +K
Sbjct:    1 MFLDIYVYRDEEQLD---ELNVSNKRKSQDSDDNAPTPKRQK 39          
The following BLAST results are available for this feature:
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NVL2.382e-4536.93nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
NVL3.486e-4536.93nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
NVL3.486e-4536.93nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
NVL8.201e-4536.93nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
NVL1.183e-4436.93nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mac-16.216e-4530.85pep chromosome:WBcel235:II:13311459:13320911:-1 ge... [more]
cdc-48.23.331e-4033.95Transitional endoplasmic reticulum ATPase homolog ... [more]
cdc-48.23.331e-4033.95Transitional endoplasmic reticulum ATPase homolog ... [more]
prx-61.364e-3629.97PEX6; PeRoXisome assembly factor; Pex6p homolog [... [more]
cdc-48.12.073e-3532.92Transitional endoplasmic reticulum ATPase homolog ... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smid8.450e-4235.83gene:FBgn0016983 transcript:FBtr0331849[more]
smid8.450e-4235.83gene:FBgn0016983 transcript:FBtr0333404[more]
smid9.540e-4235.83gene:FBgn0016983 transcript:FBtr0331850[more]
smid1.023e-4135.83gene:FBgn0016983 transcript:FBtr0301611[more]
smid1.072e-4135.83gene:FBgn0016983 transcript:FBtr0076851[more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nvl1.840e-4429.82nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
vcp2.622e-3937.59valosin containing protein [Source:NCBI gene;Acc:3... [more]
vcp3.161e-3937.59valosin containing protein [Source:NCBI gene;Acc:3... [more]
zgc:1369083.739e-3735.29zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22][more]
psmc44.181e-3338.34proteasome 26S subunit, ATPase 4 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svep11.436e-4539.66sushi, von Willebrand factor type A, EGF and pentr... [more]
svep11.594e-4539.66sushi, von Willebrand factor type A, EGF and pentr... [more]
svep11.609e-4539.66sushi, von Willebrand factor type A, EGF and pentr... [more]
svep11.807e-4539.66sushi, von Willebrand factor type A, EGF and pentr... [more]
svep14.259e-4234.62sushi, von Willebrand factor type A, EGF and pentr... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nvl3.947e-4428.02nuclear VCP-like [Source:MGI Symbol;Acc:MGI:191470... [more]
Vcp3.096e-3836.50valosin containing protein [Source:MGI Symbol;Acc:... [more]
Spata51.207e-3633.80spermatogenesis associated 5 [Source:MGI Symbol;Ac... [more]
Spata51.288e-3633.80spermatogenesis associated 5 [Source:MGI Symbol;Ac... [more]
Spata51.441e-3633.80spermatogenesis associated 5 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NAG4|MAC1_CAEEL7.907e-4430.85Protein mac-1 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|O15381|NVL_HUMAN9.252e-4436.93Nuclear valosin-containing protein-like OS=Homo sa... [more]
sp|Q9DBY8|NVL_MOUSE2.761e-4328.02Nuclear valosin-containing protein-like OS=Mus mus... [more]
sp|Q8SSJ5|CDC48_ENCCU3.449e-3941.33Cell division control protein 48 OS=Encephalitozoo... [more]
sp|P54812|TERA2_CAEEL4.237e-3933.95Transitional endoplasmic reticulum ATPase homolog ... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YMX61.677e-5441.60Ribosome biogenesis ATPase OS=Clonorchis sinensis ... [more]
A0A3R7EUW74.231e-5341.60Nuclear valosin-containing protein-like OS=Clonorc... [more]
A0A0X3NKD84.580e-5337.34Nuclear valosin-containing protein-like OS=Schisto... [more]
A0A4S2LK415.040e-5341.60Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K3FF748.185e-5336.94Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nvl2.158e-4436.26nuclear VCP like [Source:NCBI gene;Acc:103033742][more]
nvl2.158e-4436.26nuclear VCP like [Source:NCBI gene;Acc:103033742][more]
zgc:1369081.041e-3837.23zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22][more]
psmc46.185e-3338.38proteasome 26S subunit, ATPase 4 [Source:NCBI gene... [more]
psmc21.001e-3138.20proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nvl1.211e-4436.71nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
vcp4.460e-4035.93valosin containing protein [Source:NCBI gene;Acc:3... [more]
vcp1.176e-3834.04valosin containing protein [Source:NCBI gene;Acc:3... [more]
ENSPMAT00000006168.11.443e-3338.38pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-... [more]
spast2.860e-3234.91spastin [Source:NCBI gene;Acc:405851][more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RIX79.796e-4135.44Putative ATPase of the AAA family; required for ex... [more]
CDC481.441e-3834.93AAA ATPase; subunit of polyUb-selective segregase ... [more]
AFG24.615e-3735.41ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms... [more]
PEX61.862e-3435.71AAA-peroxin; heterodimerizes with AAA-peroxin Pex1... [more]
PEX13.213e-3231.23AAA-peroxin; heterodimerizes with AAA-peroxin Pex6... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362182.474e-3835.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357053.134e-3832.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486023.249e-3638.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390068.023e-3632.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265547.349e-3337.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nvl3.793e-4735.56nuclear VCP like [Source:NCBI gene;Acc:101154831][more]
vcp3.447e-3937.59valosin containing protein [Source:NCBI gene;Acc:1... [more]
psmc45.683e-3337.82proteasome 26S subunit, ATPase 4 [Source:NCBI gene... [more]
pex63.164e-3231.70peroxisomal biogenesis factor 6 [Source:NCBI gene;... [more]
psmc21.013e-3138.20proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040165.14.490e-6294.75SMESG000040165.1[more]
SMESG000000064.16.511e-5392.45SMESG000000064.1[more]
SMESG000000064.10.000e+092.45SMESG000000064.1[more]
SMESG000013648.15.599e-5389.22SMESG000013648.1[more]
SMESG000013648.14.489e-1189.22SMESG000013648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015057 ID=SMED30015057|Name=Transitional endoplasmic reticulum ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=2587bp
GGATTATTATTAAAACTTTGTGAATACAAAGTTGATAATTCGTGTTTCAT
AGAATTAATTTTTCACTTTTTGTAGAATAAATTAAATATCGTTACAAATC
ATATTTTATTAAATTTTTGTTTTAATAATATTTAAACGTTTTCAAAAAAT
GAATAAAGATGAAATTAAGAAATCTATTCATCTGGCAAATATTTTTATAA
CCGAAAATTCTAATGGGAATGTAGATGAATTTATTAAATATTTATTTAAA
AATCATCCAACATTATTAAATGGAAGAAATATTGCTAAACGAAAGACTGT
AAATAAAGCATTTGAATATGTTCGAAAGCAAAAAGAGTCAAATATTGATG
AAAGCGATTGGATGTTTTTAGATATAAATGTTTACAGAGATGAGGAGCTG
CTAGATACCAAAGATGAATTGAATGTATCAAATAAAAGAAAGTCCCAAGA
TAGCGATGATAATGCTCCTACACCAAAAGGCAAAAAGTCAAATCGTTTAA
TATCGAAAAAGATTTTTGCATTTATTCCACTGAAACATTGAACATGAAAC
TAGAGAATTTTATAGAATTTCCTGAATCTCTTTGTAAAAAAATAGCAGCA
GTGGATTCATATATTAGTAATCAGAAACGCTATCTGAAAATCCTAATTTC
TGGCCCAGCCAATTGCGGCAAATCGACACTTATTTACCACTTAGCCCAAG
AATATAAATACCGATACGTCCGTGTCGGTAAGCGCTACATGGAAAACATG
GATTTTGACAGTTTTGATCGCGATATTGAGAGATTAGGCGAAGGATTCGA
AAAAGTCCTTTTGCATTTCAAATTCAATTATTATCCCACCAAAATTTCCG
ATAATTTCAGATTCGAATCTGATGCCTCTTCAAAATTTCTCATGATTTTC
GAGTCCTCTGATCCAGGATCACTGGTAAAGAATGCCAATTGGTCCATAGA
GTTTCCAATTATTGATAAATTGAATAGAGAAAAATATTTGAAACATTTTC
TAATTGAGGTTAATGGTGACATTTGGAATTGTGAGGAAATGGCCAGGCTG
ACACCGGGATATCAAATTGGTGAGATTGAGGCCCTTTGCACCAAGTTAAA
AATGGCGTACAAAGGGAACCCCTTAATCGATATCGCTGATGAATTTAACC
GTATCATAGCAAGTGGGGAAATTAAACTCAAAATCAAAACCGATGACATA
AAGTGGAGTGACATTGGCGGTCATGATGAAGTAAAGGAAAAATTGAAAAA
TATCATGGACAATGTAAAGGATACAGAGCGTTTCTACAAGAGCAATGGAG
TAATTCTTTACGGTCCTCCCGGGTGCGGTAAAACGATGCTTGCAAAAGCT
TTATCAAACGAACATGAGTTCTCATTTGTCACAATGTCATGCGCAGATAT
TTTATCAAAATATCAAGGAGAGAGCGAGAAAAACGTTAGGGAAGCATTCA
ATACAGCTCGCAGTAGTCAGCCATGCATTTTGTTCATAGATGAAATAGAT
GCATTATGCAGCAAGCGAGACGATGATAACTGCGGAAGTCGCAATTCAAT
TGTCAATACGTTCCTCATGGAAATGGATGGCATTGACAGTCACAAAAATA
CGCAATTGCTTATCATTGGGGCTACGAATTTCATAGAGAAAATCGATAAA
GCCATCAGCAGATCTGGCCGACTGGGGCGTCTCATTGAGGTCAACATTCC
AAAATCACCTCAACAGAGATTATCTGTTCTAATGGCAGCCTCAAAAAATG
GAACGAATCCGAAATTTGGGCCTTGCTCTTTGGATGAGATGAATTTTTCA
GTTGAAAACGTTTTCTCTCAAATTTCTTCGGATGATTTCACCGAAGACTG
GAGTCATTCTGATCTTGCTGCGTTGATCGCTGAATCATACCAGGAAATGA
AAAATGACCCAAATGCTGACGGTAGCAACTGTGTCACCATGTTACATGTC
CTATCAGCTCATCGTGCAAAGAATAGAGAAAAGAAAATTAATATTTCACC
AAAATTCAACAAATATGCAAAACCAATTCTGGCCGAGGAACTGGAACGGA
AATTTCCCAATAAATTTCAATTCAATTCACATATAATGAGCCAAGTGGAA
ATCTGTGCCGGTGCAAAAACAATTTTCATTGGTGGTCGCCATTTATCCGG
CAAATCCACCGTAATAGCCATGATAGCACAGAAATATAAATATAACCTGG
TGACATTCGATCGGAATTATTTCAACAATTTCCACATCGACAAATTCACA
CAAGAGATCAGCAAATTTATCAAGAAAAACGGGCCGACATTGATTCACAT
CGATGAGAGAGAAATAACAGAAAGAACTCTTTCGGAACATTTTCGTTTTA
AAAAAGATTTCGCGGTTAAGTTGGTGTTTGAAACCCTGTCAACTCTCAAG
GCCGATATCACAATTCCAGATTTCAGTCGGGGGGAGCTGAAAAGGTGGTT
CCAAGAGTGCACAAGGAATAAACTCGATGAAATTGAGATTGGCAAATATC
TGGATCGTATTCCTCACTGGACTCATGGATATTTCAATGATTTCGAACAG
TGTTTGAATGGTATTCTGGATCTTGATGAGGCAGATC
back to top

protein sequence of SMED30015057-orf-1

>SMED30015057-orf-1 ID=SMED30015057-orf-1|Name=SMED30015057-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MNKDEIKKSIHLANIFITENSNGNVDEFIKYLFKNHPTLLNGRNIAKRKT
VNKAFEYVRKQKESNIDESDWMFLDINVYRDEELLDTKDELNVSNKRKSQ
DSDDNAPTPKGKKSNRLISKKIFAFIPLKH*
back to top

protein sequence of SMED30015057-orf-2

>SMED30015057-orf-2 ID=SMED30015057-orf-2|Name=SMED30015057-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=681bp
MKLENFIEFPESLCKKIAAVDSYISNQKRYLKILISGPANCGKSTLIYHL
AQEYKYRYVRVGKRYMENMDFDSFDRDIERLGEGFEKVLLHFKFNYYPTK
ISDNFRFESDASSKFLMIFESSDPGSLVKNANWSIEFPIIDKLNREKYLK
HFLIEVNGDIWNCEEMARLTPGYQIGEIEALCTKLKMAYKGNPLIDIADE
FNRIIASGEIKLKIKTDDIKWSDIGGHDEVKEKLKNIMDNVKDTERFYKS
NGVILYGPPGCGKTMLAKALSNEHEFSFVTMSCADILSKYQGESEKNVRE
AFNTARSSQPCILFIDEIDALCSKRDDDNCGSRNSIVNTFLMEMDGIDSH
KNTQLLIIGATNFIEKIDKAISRSGRLGRLIEVNIPKSPQQRLSVLMAAS
KNGTNPKFGPCSLDEMNFSVENVFSQISSDDFTEDWSHSDLAALIAESYQ
EMKNDPNADGSNCVTMLHVLSAHRAKNREKKINISPKFNKYAKPILAEEL
ERKFPNKFQFNSHIMSQVEICAGAKTIFIGGRHLSGKSTVIAMIAQKYKY
NLVTFDRNYFNNFHIDKFTQEISKFIKKNGPTLIHIDEREITERTLSEHF
RFKKDFAVKLVFETLSTLKADITIPDFSRGELKRWFQECTRNKLDEIEIG
KYLDRIPHWTHGYFNDFEQCLNGILDLDEAD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000785chromatin
GO:0005783endoplasmic reticulum
GO:0010494cytoplasmic stress granule
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0035861site of double-strand break
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042802identical protein binding
GO:0044877macromolecular complex binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0008289lipid binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0010498proteasomal protein catabolic process
GO:0016236macroautophagy
GO:0032510endosome to lysosome transport via multivesicular body sorting pathway
GO:0034605cellular response to heat
GO:0035617stress granule disassembly
GO:0061857endoplasmic reticulum stress-induced pre-emptive quality control
GO:1903843cellular response to arsenite ion
GO:0006281DNA repair
GO:0006302double-strand break repair
GO:0006810transport
GO:0006914autophagy
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0007626locomotory behavior
GO:0016567protein ubiquitination
GO:0018279protein N-linked glycosylation via asparagine
GO:0019985translesion synthesis
GO:0030433ubiquitin-dependent ERAD pathway
GO:0036503ERAD pathway
GO:0043009chordate embryonic development
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0097352autophagosome maturation
GO:2000058regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR003960ATPase_AAA_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..113