Protocadherin

Overview
NameProtocadherin
Smed IDSMED30015050
Length (bp)2871
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin (SMED30015050) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin (SMED30015050) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin (SMED30015050) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin (SMED30015050) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015050

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30015050SMESG000043597.1 dd_Smed_v4_23085_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30015050SMESG000043597.1 dd_Smed_v4_23085_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30015050SMESG000043597.1 SmedASXL_008276SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015050SMESG000043597.1 dd_Smed_v6_23085_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30015050SMESG000043597.1 dd_Smed_v4_23085_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 171.4 bits (433), Expect = 6.582e-43
Identity = 171/643 (26.59%), Postives = 284/643 (44.17%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXX---XXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNT-YQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKL----TRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSA 1955
            D+  NGV  Y L+   ++   + +               + +LD E    + L +   D G P   SS  L + ++D ND APKF   +Y   + E+  +G  +++V A D + G   +I Y   +  +     + +D N+G I ++ P+   D+  L  +V A D    N K     VV+ + D+N++ P I +      + Q  +G       I E+  E   V+ + V D+DEG+N  V C +         F L        ++  +Y L+    +D EKV +     I   D+G P L ST  L+V V+D N+   +FT+S   ++  EN     +++  +   DA S +   L  S      +  L +++  +GEI++   LDRE+   Y+  +   +    + + T  ATV V VLD NDN P+++    +F + EN      +G +   D D GEN+++ +S          E+ +G  D    +    +    S D E        +   D G P     + + +N+LDENDN P    PS      N SH  +   T+L    ++V A D DS  +  L Y +     +    I   +G I+L K+IE    G + L ++V+D G P R  +A
Sbjct:  196 DAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGT-NPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQ--DG----MANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDV----PFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA-EITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGT--ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLS---------VEQDNG--DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPS------NTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 806          

HSP 2 Score: 124.79 bits (312), Expect = 2.506e-28
Identity = 149/619 (24.07%), Postives = 265/619 (42.81%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFH-LNSSNNFNME-------SFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            G P+L   Q   I++ DIND  P F +   T  + E+  +GS+     A DR++G  G   Y+L    +    F   V+ D        K+P   +         D   LT++  D      +     + + ++D N++ P                  P Y  E+ EN+P    V  +   D D+G N +++    Q  ++++ L      +RL++NT    + ++  +DRE +S  L FS+  +D G     +   + V V D N+  P +  R    + ++ ++D  + +S  V ++ A++  +    +   N  +         F L   +++  +      ++   PLD EK   Y   I  V+    N   +S  ++ V V+D+NDN P   Q V  ++F   ENN P   + ++   D D G N+ +  S          E     + LF IS E   +QVK S+D E   + ++ +   D G P      +++VN+LD NDN+P+++      S ++N+  +S + +        V  ID D   + ++   ++  +    I   TG I  SL+ D E    Y   L+  D G P R++   +TI +  +N
Sbjct:  147 GSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE-----KQPQLIVMGNLDRERWDSYDLTIKVQDGGSP-PRASSALLRVTVLDTNDNAPKFE--------------RPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL------LRLDRNT--GLITVQGPVDREDLST-LRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIR---GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG--NPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAF--PENNKPGEVIAEITASDADSGSNAELVYS---------LEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM--------VTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN 709          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 171.4 bits (433), Expect = 8.593e-43
Identity = 171/643 (26.59%), Postives = 284/643 (44.17%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXX---XXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNT-YQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKL----TRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSA 1955
            D+  NGV  Y L+   ++   + +               + +LD E    + L +   D G P   SS  L + ++D ND APKF   +Y   + E+  +G  +++V A D + G   +I Y   +  +     + +D N+G I ++ P+   D+  L  +V A D    N K     VV+ + D+N++ P I +      + Q  +G       I E+  E   V+ + V D+DEG+N  V C +         F L        ++  +Y L+    +D EKV +     I   D+G P L ST  L+V V+D N+   +FT+S   ++  EN     +++  +   DA S +   L  S      +  L +++  +GEI++   LDRE+   Y+  +   +    + + T  ATV V VLD NDN P+++    +F + EN      +G +   D D GEN+++ +S          E+ +G  D    +    +    S D E        +   D G P     + + +N+LDENDN P    PS      N SH  +   T+L    ++V A D DS  +  L Y +     +    I   +G I+L K+IE    G + L ++V+D G P R  +A
Sbjct:  196 DAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGT-NPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQ--DG----MANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG----DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA-EITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGT--ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLS---------VEQDNG--DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPS------NTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 806          

HSP 2 Score: 125.176 bits (313), Expect = 2.019e-28
Identity = 149/619 (24.07%), Postives = 265/619 (42.81%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFH-LNSSNNFNME-------SFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            G P+L   Q   I++ DIND  P F +   T  + E+  +GS+     A DR++G  G   Y+L    +    F   V+ D        K+P   +         D   LT++  D      +     + + ++D N++ P                  P Y  E+ EN+P    V  +   D D+G N +++    Q  ++++ L      +RL++NT    + ++  +DRE +S  L FS+  +D G     +   + V V D N+  P +  R    + ++ ++D  + +S  V ++ A++  +    +   N  +         F L   +++  +      ++   PLD EK   Y   I  V+    N   +S  ++ V V+D+NDN P   Q V  ++F   ENN P   + ++   D D G N+ +  S          E     + LF IS E   +QVK S+D E   + ++ +   D G P      +++VN+LD NDN+P+++      S ++N+  +S + +        V  ID D   + ++   ++  +    I   TG I  SL+ D E    Y   L+  D G P R++   +TI +  +N
Sbjct:  147 GSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE-----KQPQLIVMGNLDRERWDSYDLTIKVQDGGSP-PRASSALLRVTVLDTNDNAPKFE--------------RPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL------LRLDRNT--GLITVQGPVDREDLST-LRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIR---GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG--NPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAF--PENNKPGEVIAEITASDADSGSNAELVYS---------LEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM--------VTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN 709          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 149.058 bits (375), Expect = 7.066e-36
Identity = 155/592 (26.18%), Postives = 272/592 (45.95%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLTL---TVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKD---IEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  VG+ ++++HA D + G   +I Y        +T    +++  +G I +++ L D ++  +   TV A D +   ++     V I + DVN++ PNI    D R     +NG  +Y   + E +P N +++ I V DKD   NG V C I+     +  F+L       K  Y  QY L     +D E      +F I   D+G+P L  T +++V + D+N+ P +F +    LS+ E N+    + + +  D+D+    +  + L  + +F         L + +G +      DRE+  R+ F++     A+DN      S A V V VLD NDN P++      F + E N+P Y  +G +   D D GEN  +++S            L+ N++        +++   S D E   +   D+   D G P   +   + +N++D NDN P  I P S +    +  ++   G+ +  V A+D D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:  218 YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL-DREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNI----DLRYIISPINGT-VY---LSEKDPVNTKIALITVSDKDTDVNGKVICFIER----EVPFHL-------KAVYDNQYLLETSSLLDYEGTKE-FSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-------FDLDRKTGVLTASRVFDREEQERFIFTV----TARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLS-----------ILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPS-NTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 73.9442 bits (180), Expect = 1.124e-12
Identity = 135/599 (22.54%), Postives = 246/599 (41.07%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC--QIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            K+ I + D ND AP F +      + E+  + S      A D ++G  G   Y+L+  +  F    V + +G     ++ +   D    D   + ++  D      K     + + + DVN++RP    G  +              + I EN P    V  ++  D D G N +++     Q     K LF L++   L        + +++S+DRE+ +     ++   D      ++T+   ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +   + LD E +  + F I   +  + +   T  A V V + D NDN P   Q V  +S  + ENN     L  +   D+D G+N+ I              +L  N   F +  +  +L   +  D E        +   D G P   ++ ++IV +LDENDN P++ +    ++       N+   + +  +   DAD+  +  +T  +   +D+  +DP++G I  +++ D E    Y   ++ TD G P R+S+A +TI +   N
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQ-KSSTAILQVTVSDVNDNRPVFKEGQVE--------------VHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGL--------ITVQRSLDREETAI-HKVTVLASDGSSTPARATV--TINVTDVNDNPPNIDLRYIISPINGTVYLSE-KDPVNTKIALITVSDKDTDVNGKVICFIEREV---------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQT--ALVRVKLEDENDNPPIFNQPVIELS--VSENNRRGLYLTTISATDEDSGKNADI------------VYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVN 669          

HSP 3 Score: 68.9366 bits (167), Expect = 4.481e-11
Identity = 71/275 (25.82%), Postives = 119/275 (43.27%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE 1010
            DYE   +F  +++A D G+P L  +  + + + D ND  P F        V E+   G  +  + A D +SG    I+Y+L  N     SF  +D  +G +   + +FD    ++   TV A D+     +     V++ ++D N++ P            +  + +  +F+   EN P+   V  I V D D G+N  V   I       + F LD         Y   ++   S DRE+ S+   F +   D GQP   ST  + ++V+D N+
Sbjct:  428 DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREEQERFIFTVTARDNGTPPLQ-SQAAVIVTVLDENDNSP------------KFTHNHFQFFVS--ENLPKYSTVGVITVTDADAGENKAVTLSILND---NDNFVLDP--------YSGVIKSNVSFDREQQSS-YTFDVKATDGGQPPRSSTAKVTINVMDVND 670          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 148.673 bits (374), Expect = 1.044e-35
Identity = 155/592 (26.18%), Postives = 272/592 (45.95%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLTL---TVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKD---IEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  VG+ ++++HA D + G   +I Y        +T    +++  +G I +++ L D ++  +   TV A D +   ++     V I + DVN++ PNI    D R     +NG  +Y   + E +P N +++ I V DKD   NG V C I+     +  F+L       K  Y  QY L     +D E      +F I   D+G+P L  T +++V + D+N+ P +F +    LS+ E N+    + + +  D+D+    +  + L  + +F         L + +G +      DRE+  R+ F++     A+DN      S A V V VLD NDN P++      F + E N+P Y  +G +   D D GEN  +++S            L+ N++        +++   S D E   +   D+   D G P   +   + +N++D NDN P  I P S +    +  ++   G+ +  V A+D D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:  218 YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL-DREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNI----DLRYIISPINGT-VY---LSEKDPVNTKIALITVSDKDTDVNGKVICFIER----EVPFHL-------KAVYDNQYLLETSSLLDYEGTKE-FSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-------FDLDRKTGVLTASRVFDREEQERFIFTV----TARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLS-----------ILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPS-NTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 74.7146 bits (182), Expect = 8.058e-13
Identity = 135/599 (22.54%), Postives = 246/599 (41.07%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC--QIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            K+ I + D ND AP F +      + E+  + S      A D ++G  G   Y+L+  +  F    V + +G     ++ +   D    D   + ++  D      K     + + + DVN++RP    G  +              + I EN P    V  ++  D D G N +++     Q     K LF L++   L        + +++S+DRE+ +     ++   D      ++T+   ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +   + LD E +  + F I   +  + +   T  A V V + D NDN P   Q V  +S  + ENN     L  +   D+D G+N+ I              +L  N   F +  +  +L   +  D E        +   D G P   ++ ++IV +LDENDN P++ +    ++       N+   + +  +   DAD+  +  +T  +   +D+  +DP++G I  +++ D E    Y   ++ TD G P R+S+A +TI +   N
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQ-KSSTAILQVTVSDVNDNRPVFKEGQVE--------------VHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGL--------ITVQRSLDREETAI-HKVTVLASDGSSTPARATVT--INVTDVNDNPPNIDLRYIISPINGTVYLSE-KDPVNTKIALITVSDKDTDVNGKVICFIEREV---------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQT--ALVRVKLEDENDNPPIFNQPVIELS--VSENNRRGLYLTTISATDEDSGKNADI------------VYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVN 669          

HSP 3 Score: 69.3218 bits (168), Expect = 3.034e-11
Identity = 71/275 (25.82%), Postives = 118/275 (42.91%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE 1010
            DYE   +F  +++A D G+P L  +  + + + D ND  P F        V E+   G  +  + A D +SG    I+Y+L  N     SF  +D  +G +   + +FD    ++   TV A D+     +     V++ ++D N++ P  +            N +  +   + EN P+   V  I V D D G+N  V   I       + F LD         Y   ++   S DRE+ S+   F +   D GQP   ST  + ++V+D N+
Sbjct:  428 DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREEQERFIFTVTARDNGTPPLQ-SQAAVIVTVLDENDNSPKFT-----------HNHFQFF---VSENLPKYSTVGVITVTDADAGENKAVTLSILND---NDNFVLDP--------YSGVIKSNVSFDREQQSS-YTFDVKATDGGQPPRSSTAKVTINVMDVND 670          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 148.673 bits (374), Expect = 1.170e-35
Identity = 155/592 (26.18%), Postives = 272/592 (45.95%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLTL---TVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKD---IEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  VG+ ++++HA D + G   +I Y        +T    +++  +G I +++ L D ++  +   TV A D +   ++     V I + DVN++ PNI    D R     +NG  +Y   + E +P N +++ I V DKD   NG V C I+     +  F+L       K  Y  QY L     +D E      +F I   D+G+P L  T +++V + D+N+ P +F +    LS+ E N+    + + +  D+D+    +  + L  + +F         L + +G +      DRE+  R+ F++     A+DN      S A V V VLD NDN P++      F + E N+P Y  +G +   D D GEN  +++S            L+ N++        +++   S D E   +   D+   D G P   +   + +N++D NDN P  I P S +    +  ++   G+ +  V A+D D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:  218 YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL-DREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNI----DLRYIISPINGT-VY---LSEKDPVNTKIALITVSDKDTDVNGKVICFIER----EVPFHL-------KAVYDNQYLLETSSLLDYEGTKE-FSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-------FDLDRKTGVLTASRVFDREEQERFIFTV----TARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLS-----------ILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPS-NTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 74.7146 bits (182), Expect = 7.575e-13
Identity = 135/599 (22.54%), Postives = 246/599 (41.07%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC--QIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            K+ I + D ND AP F +      + E+  + S      A D ++G  G   Y+L+  +  F    V + +G     ++ +   D    D   + ++  D      K     + + + DVN++RP    G  +              + I EN P    V  ++  D D G N +++     Q     K LF L++   L        + +++S+DRE+ +     ++   D      ++T+   ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +   + LD E +  + F I   +  + +   T  A V V + D NDN P   Q V  +S  + ENN     L  +   D+D G+N+ I              +L  N   F +  +  +L   +  D E        +   D G P   ++ ++IV +LDENDN P++ +    ++       N+   + +  +   DAD+  +  +T  +   +D+  +DP++G I  +++ D E    Y   ++ TD G P R+S+A +TI +   N
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQ-KSSTAILQVTVSDVNDNRPVFKEGQVE--------------VHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGL--------ITVQRSLDREETAI-HKVTVLASDGSSTPARATVT--INVTDVNDNPPNIDLRYIISPINGTVYLSE-KDPVNTKIALITVSDKDTDVNGKVICFIEREV---------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQT--ALVRVKLEDENDNPPIFNQPVIELS--VSENNRRGLYLTTISATDEDSGKNADI------------VYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVN 669          

HSP 3 Score: 69.3218 bits (168), Expect = 2.926e-11
Identity = 71/275 (25.82%), Postives = 118/275 (42.91%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE 1010
            DYE   +F  +++A D G+P L  +  + + + D ND  P F        V E+   G  +  + A D +SG    I+Y+L  N     SF  +D  +G +   + +FD    ++   TV A D+     +     V++ ++D N++ P  +            N +  +   + EN P+   V  I V D D G+N  V   I       + F LD         Y   ++   S DRE+ S+   F +   D GQP   ST  + ++V+D N+
Sbjct:  428 DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREEQERFIFTVTARDNGTPPLQ-SQAAVIVTVLDENDNSPKFT-----------HNHFQFF---VSENLPKYSTVGVITVTDADAGENKAVTLSILND---NDNFVLDP--------YSGVIKSNVSFDREQQSS-YTFDVKATDGGQPPRSSTAKVTINVMDVND 670          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 121.709 bits (304), Expect = 1.169e-27
Identity = 150/610 (24.59%), Postives = 279/610 (45.74%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHD---SAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIP-SYEL--GQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL----KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWI--YPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E + K +L++ A +   P + +S  +V+ ++D+ D +P F   +Y   ++ED  +G+ +L V A D +SG+ G+I Y L   E    + ++I+  SG I    PL   D+ TL++   D   S +   K + T +V I ++DVN++ P  +  S              Y + I EN      ++ +   D+D G NG V   + ++  +  L        ++ +T +  LR R  ID +  ++P+   I  +D  QP L ST+ L ++V+D N++      +   +++ EN      +     ID+D+        N    ++ME      + + SG I+    LDRE + RY  S+ V           +  T++VV+ DINDN P      +F+ KE N+  S E+  G  I   K +  +    I+      Y   E    + ++F I ++     IL V   +  +  H  +++I   D+G  +       +VN+  ++ N   +   +P S+  +   S I    G  +  ++A D D   + R+ Y + +      IDP +G+IS++ D+   +   + + +  +D+ +P  N+S  + +I+
Sbjct:  229 DREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSL--GEGNGKNLLAINAKSGVIQTAAPL---DRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDS--------------YNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL-------TIDYSTGEVTLRER--IDAK--NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDS------GPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARY--SLKVTARDMGTPSLNTSTTIAVVLKDINDNAP------TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKIT------YRIEE---ADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGGLQGR----CVVNVFIDDVNSAPYFNDHPFSV-KIPEHSPI----GYPVITLKAEDHDRGDNARIVYSIDSSQ-FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVIL 774          

HSP 2 Score: 104.76 bits (260), Expect = 1.945e-22
Identity = 152/632 (24.05%), Postives = 285/632 (45.09%), Query Frame = 3
Query:   36 EAGKAFQNPRIRIDSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTII-LKKPLFDID-KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDAL--SFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVV---NEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEM--KENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED--LFWISE-------LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKN-HNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI-NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI 1868
            E G+ +    I  DS  NG+  Y +E S+    ++ I   +  + +  L+   D E   ++ L++ A D+G P L +S  + + + DIND AP F  K Y   + E++  GS I+ + A+D +     KI Y++ + +    S + I G+ G I+ +   L   D K+ + + A D      +     V +FI DVN              S    N +P + ++I E++P  + V  +   D D G N  +            ++ +DS      +     + +   +DRE  +   +  +   D+  P L ++  ++V + D N+    FT S+Y+ +I E+     S L  + ID D       ++ LN S+  +  S  L  L ++SG +R+ + LDRE     QF++ V+      +     ++ + +++ + D+NDN P +  ++S+++   EN+     +G ++  D D G+N+ IS             ++ G  D  LF I E       ++IL  +   DYE   N      F  +       + + + +++ D NDN+     P+  D V+ ++   N+Q   ++  + A D D  ++  L Y L+ ++D I  + +TG+I
Sbjct:  497 EVGRVYA---IDEDSGPNGIIKYSMEGSE----DFIIDEDSGLIKTTKLL---DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDI-GDQGAILSVSGELKRQDHKVRVEISATDQGGLQGR---CVVNVFIDDVN--------------SAPYFNDHP-FSVKIPEHSPIGYPVITLKAEDHDRGDNARI------------VYSIDSSQFFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESS--SSPSIQLFRLDRTSGTLRVSSKLDRE-----QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF-EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF------------RIFGGADAKLFDIEEDAEQNGVVRIL-TRAEFDYEAKAN---KFFFELQASSGQLSSTVPVRIHVSDVNDNK-----PALKDFVILMNRFDNVQMARQIGFIPAFDPDQNAT--LEYFLE-ENDLIEAEKYTGKI 1052          

HSP 3 Score: 100.138 bits (248), Expect = 4.979e-21
Identity = 124/488 (25.41%), Postives = 206/488 (42.21%), Query Frame = 3
Query:  240 DIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIP-SYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP 1685
            D  QP L S+  L I++IDIND AP  +A      ++E++A+G  + +V+AID +SG  G I Y +  +EDF      ID +SG I   K L D +   + +L V A D    +     T + + + D+N++ P      DK+           Y + I E  P   ++  +  VD DE    D K   +  +  + +F +     L+       L +   + R+   + +   I+  D G   L+   ++ V + D N  P  F    +S+ I E+    + +++    D D         N+   ++++S     +  SSG+I + + LDRE   R  FS+ V      +    +   + V++ DINDN PQ+           +IP      Q+   D DIG N  +    L  +   P+ +      LF +      L+V   +D E      + I   D G P       I + + D NDN P
Sbjct:  453 DGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF-----IIDEDSGLIKTTK-LLDRETTARYSLKVTARDMGTPSLNTS-TTIAVVLKDINDNAPTF----DKKE----------YNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEEADREVFSI-----LDIGDQGAILSVSGELKRQ--DHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD------NARIVYSIDSSQFFRIDPSSGDISVSSDLDRED--RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQ------LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAP 890          

HSP 4 Score: 83.5741 bits (205), Expect = 5.838e-16
Identity = 97/397 (24.43%), Postives = 174/397 (43.83%), Query Frame = 3
Query:  816 KNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVG-RMSFEMKEN-NIPSYELGQLIFDDKDIGENSRISISSLTTTCYGP-TEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKID--IHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            +NLF LD        T   ++R+ +S+DRE +   +   +   +   P + ++  + V VLD  +   +F + +Y   I E+     ++LS    D D+    E  + L   N  N     L ++   SG I+   PLDRE     +  +   ++     K  S A V + V+D+NDN P +     +  + EN  IP+  +  +   D+D G N ++  S  +++  G  T   S  E          + +++ +D +   N  I   I   D   P   + + + +N++D ND+ P  I    +  +      N+  G ++ RV AID DS  +  + Y ++   D I ID  +G I  TK ++     +Y L +   D G P  N+S  + +++
Sbjct:  210 QNLFTLD--------TMSGEIRLAKSMDREVLDKHI-LKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKN-----LLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKG--TPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAV-IATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE----------VTLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEE----NVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVL 571          

HSP 5 Score: 73.9442 bits (180), Expect = 5.594e-13
Identity = 72/274 (26.28%), Postives = 129/274 (47.08%), Query Frame = 3
Query: 1161 SFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSF-EMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDIEAGKYDL--FLQVTDNGNPMRNSSANLTI 1967
            S +L +L   SGEIR+   +DRE   ++   +    E  D T  ++  TV V VLD+ DN P +     F E++E+      +  +   D D GEN  I  S           + +G   L   ++  ++Q    +D E +   ++D+   D+G PK  +   + + ++D NDN P  ++ S   NV  + +I I +   +  V+A D D  ++ ++ Y + +      ++ID  TGE++L + I+A    +   ++  D   P  +S+  LTI
Sbjct:  209 SQNLFTLDTMSGEIRLAKSMDREVLDKHILKV-TAYERVDPT-ISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYS---------LGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAP--VFASDSYNVTILENITIPA--VIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTI 467          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 104.375 bits (259), Expect = 2.780e-22
Identity = 152/632 (24.05%), Postives = 285/632 (45.09%), Query Frame = 3
Query:   36 EAGKAFQNPRIRIDSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTII-LKKPLFDID-KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDAL--SFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVV---NEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEM--KENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED--LFWISE-------LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKN-HNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI-NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI 1868
            E G+ +    I  DS  NG+  Y +E S+    ++ I   +  + +  L+   D E   ++ L++ A D+G P L +S  + + + DIND AP F  K Y   + E++  GS I+ + A+D +     KI Y++ + +    S + I G+ G I+ +   L   D K+ + + A D      +     V +FI DVN              S    N +P + ++I E++P  + V  +   D D G N  +            ++ +DS      +     + +   +DRE  +   +  +   D+  P L ++  ++V + D N+    FT S+Y+ +I E+     S L  + ID D       ++ LN S+  +  S  L  L ++SG +R+ + LDRE     QF++ V+      +     ++ + +++ + D+NDN P +  ++S+++   EN+     +G ++  D D G+N+ IS             ++ G  D  LF I E       ++IL  +   DYE   N      F  +       + + + +++ D NDN+     P+  D V+ ++   N+Q   ++  + A D D  ++  L Y L+ ++D I  + +TG+I
Sbjct:  138 EVGRVYA---IDEDSGPNGIIKYSMEGSE----DFIIDEDSGLIKTTKLL---DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDI-GDQGAILSVSGELKRQDHKVRVEISATDQGGLQGR---CVVNVFIDDVN--------------SAPYFNDHP-FSVKIPEHSPIGYPVITLKAEDHDRGDNARI------------VYSIDSSQFFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESS--SSPSIQLFRLDRTSGTLRVSSKLDRE-----QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF-EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF------------RIFGGADAKLFDIEEDAEQNGVVRIL-TRAEFDYEAKAN---KFFFELQASSGQLSSTVPVRIHVSDVNDNK-----PALKDFVILMNRFDNVQMARQIGFIPAFDPDQNAT--LEYFLE-ENDLIEAEKYTGKI 693          

HSP 2 Score: 99.7525 bits (247), Expect = 7.691e-21
Identity = 124/488 (25.41%), Postives = 206/488 (42.21%), Query Frame = 3
Query:  240 DIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIP-SYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP 1685
            D  QP L S+  L I++IDIND AP  +A      ++E++A+G  + +V+AID +SG  G I Y +  +EDF      ID +SG I   K L D +   + +L V A D    +     T + + + D+N++ P      DK+           Y + I E  P   ++  +  VD DE    D K   +  +  + +F +     L+       L +   + R+   + +   I+  D G   L+   ++ V + D N  P  F    +S+ I E+    + +++    D D         N+   ++++S     +  SSG+I + + LDRE   R  FS+ V      +    +   + V++ DINDN PQ+           +IP      Q+   D DIG N  +    L  +   P+ +      LF +      L+V   +D E      + I   D G P       I + + D NDN P
Sbjct:   94 DGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF-----IIDEDSGLIKTTK-LLDRETTARYSLKVTARDMGTPSLNTS-TTIAVVLKDINDNAPTF----DKKE----------YNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEEADREVFSI-----LDIGDQGAILSVSGELKRQ--DHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD------NARIVYSIDSSQFFRIDPSSGDISVSSDLDRED--RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQ------LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAP 531          

HSP 3 Score: 96.2857 bits (238), Expect = 8.423e-20
Identity = 133/582 (22.85%), Postives = 250/582 (42.96%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPF-----TGEISLTKDIEAGKYDLFLQ---VTDNGNPMRNSSANLTIIIYQQN 1985
            I ++D+ND AP F + +Y   + E++ + +VI  V A D + G  GK+ Y +  +       ++ID ++G + L++    ID     +T  + A D A+  +      + I +ID+N+H P             L+    +  LE  EN     EV  +  +D+D G NG +K  ++ ++     F +D    L K T   KL     +DRE  +   +  +  +D G P L ++  + V + D N+    F +  Y+++I E     S I++   +D D      + +  ++    E F +  +      + +   L R+        + V   A D         V+V + D+N + P +     S ++ E++   Y +  L  +D D G+N+RI + S+ ++ +   +  SG+           + V   +D E      + +   D   P  +    I V + D NDN P++   +S      IS  +I  GT   +V AIDAD   +  + Y L     S SI  F     +G + ++  ++  ++ + +      D G P  ++++ +T+ +   N
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--LTIDYSTGEVTLRE---RIDAKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPT------------LIAAQKMITLE--ENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE----DFIIDEDSGLIKTT---KL-----LDRETTAR-YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADR---EVFSILDIGDQGAILSVSGELKRQ-----DHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI-VYSIDSSQFFRIDPSSGD-----------ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISE-DIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVN 527          

HSP 4 Score: 54.6842 bits (130), Expect = 3.894e-7
Identity = 57/230 (24.78%), Postives = 104/230 (45.22%), Query Frame = 3
Query: 1308 VSVVVLDINDNVPQYVG-RMSFEMKEN-NIPSYELGQLIFDDKDIGENSRISISSLTTTCYGP-TEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKID--IHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            V + V+D+NDN P +     +  + EN  IP+  +  +   D+D G N ++  S  +++  G  T   S  E          + +++ +D +   N  I   I   D   P   + + + +N++D ND+ P  I    +  +      N+  G ++ RV AID DS  +  + Y ++   D I ID  +G I  TK ++     +Y L +   D G P  N+S  + +++
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAV-IATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE----------VTLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEE----NVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVL 212          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 100.138 bits (248), Expect = 6.470e-21
Identity = 149/618 (24.11%), Postives = 254/618 (41.10%), Query Frame = 3
Query:  222 LQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLD--QNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNN----FNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQD---NTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPS-----------------YELGQLIF--DDKDIGENSRISISS--LTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQS--GTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGK-YDLFLQVTDNGNPMRNSSANLTII 1970
            L++ A D G P   S + + + I D+N+ +P+F   +Y   + E+   G  I KV A D + G+ GKI + L  N++ S S +SID  +G + L K L   D D  T  + A D      +   T++ I + DVN++ P   V   +                I E+ P    VS +   D+D G+N  +K  + + K+   + +    + ++   Y         +D  K     N SI   D+G P+L ++  L V+++D   N     F       S+ EN +   I +  ++ +   + +E  + + N        + +   S+ Q  G +R  + LDRE    Y  ++   +   D   + +      V + +LD ND+ P     M       N P+                      L+F  +  D     RI ++S  +TT+     ++   +E   W+S                          D G P+  + + +IVN+LDENDN P +           I H +++S    KL R+ A+DAD   + RLTY +       SID   G I  ++ I   + Y L +Q TD+G P +  +A   ++
Sbjct:  688 LKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKS-SVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEG-FPMRVSVTNLTISVEDVNDNPPKCVVQHSR--------------ARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEY--------PLDYHKTPF-FNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSE---IGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVS------------------------ICDGGEPQLCSNVIVIVNVLDENDNSPTFTQA--------IHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDARFSIDN-NGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVL 1243          

HSP 2 Score: 84.7297 bits (208), Expect = 3.179e-16
Identity = 119/467 (25.48%), Postives = 208/467 (44.54%), Query Frame = 3
Query:  222 LQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFY------LDSRMRLNKNTYQYKLRIR-QSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVD--VLDQNEYPALFTRSNYSLSIIENKDNFSI-LSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFE-MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVK--QSMDYEFIH 1583
            L +  CD G+PQLCS+  ++++++D ND +P F    +   V+   A    + ++ A+D + G+  ++ Y + + +    +  SID N+G II  + +   +   LTV+A D      +F  T VV+   +    +P  S  S    S +  +    Y + I + +     V  +   D D    GD             L++       DS   + ++T Q  L  + + + R ++   LN S+    +GQ    ST+I+QV   +  + ++ A   +++ S  +      +++  S   +    L FN F   S ++  ME      +  SSG + +  PLD E + R +    VV   Q N K  SFAT SV + D NDN P +VG  +F  + E++     L  +   DKD GEN  ++ S            +SGNE+  +  + K  +V+  + +D E  H
Sbjct: 1124 LWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFA--GKLCRIFAVDADEGENARLTYNITEGD----ARFSID-NNGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVL-TANSAGQKPRKSKNSPPEISGKKSD----YVIPISDADQVGLTVGKLEASDAD----GD------------ELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELR--LNISVT---DGQAWDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLF---SVDDVAMED--KIRVEPSSGNVIVMEPLDYEAARRIRA---VVQVQQANMK--SFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSI-----------VSGNEESLFKIDAKSGEVRLAKPLDPELQH 1536          

HSP 3 Score: 71.633 bits (174), Expect = 2.584e-12
Identity = 80/309 (25.89%), Postives = 137/309 (44.34%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FD-IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQ-TTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDA 1109
            D E +  F L ++A D    +      +++ +ID ND AP F    Y+  V E  ++G  +    A     GD  + I   +K  D  TSFV+++  +G + L KPL F+ +  L LTV A DS     + +   V I ++D N++ P                    Y  ++ EN+    +V  +  +D D    G V  +++  ++   +   L   +  N +       I QSID EK+    N  +  +D G+P L+S  +L++ V D+N++   F   N +  + E +     +L F+V D D 
Sbjct: 3075 DSEILGFFNLTVVASD---GEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRA---SGGDQNETIEYYLKPSDV-TSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETE-AQVEISVMDENDNAPKFEKEK--------------YVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVL-----ISQSIDYEKIKK-YNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDG 3355          

HSP 4 Score: 71.633 bits (174), Expect = 3.009e-12
Identity = 96/419 (22.91%), Postives = 180/419 (42.96%), Query Frame = 3
Query:  222 LQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-VSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFI--IDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDR---EKVSN-PLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFD-DKDIGENSRI 1454
             ++IA   G  +  + + + I+I+D ND AP F AK   +        G V++KV A D++ G+ GKI+YK      F++   + I+ N+G I L +     +    TV A D     S+    +++ +     +      I +   +   + + + +P   +E+ E+ P    V+ +   D+D G NG ++  I             S   L  +    ++ +   + +   EK+    +   ++  D G P+  S   +++ + D N +   F   +Y L I EN+     + F V   D    N   +  S   N E   + S+   +G +++   LDRE    + F+I   +E        S   +++ V D+NDN P+ V + S      ++P       +   D+DIG+NS++
Sbjct:  460 FKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYK------FTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFP-EIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHD-------IAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDI-FKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEG--FPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKL 861          

HSP 5 Score: 70.0922 bits (170), Expect = 8.724e-12
Identity = 74/310 (23.87%), Postives = 134/310 (43.23%), Query Frame = 3
Query: 1092 VIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMK--ENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSIS---IDPFT----GEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            ++ +DA  F+E      ++F      L  +   +G + +  PLD E         F +     + +F   AT+ V V+D NDN P +  + ++ MK  E+    YEL        D  E     +     T +      +G           IL + + +D+E +   K+ +   D G P    +  + ++++DENDN P++      +  V     N +SG K+  V+A+D DS     ++YEL+   ++ +   + PF     G++ +++ I+     KY+L +   D G P   S A L I +  +N
Sbjct: 3037 IVAEDA-DFDEIKFRMVDDFG----GLFQIDDINGVVTVVKPLDSE-----ILGFFNLTVVASDGEFEDKATILVTVIDQNDNAPTF-EKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTG-----------ILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF----EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDEN 3320          

HSP 6 Score: 63.929 bits (154), Expect = 6.105e-10
Identity = 85/306 (27.78%), Postives = 140/306 (45.75%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDI--NDEAPKF--VAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKII-----YKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSA----EHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLD--SRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSI 1052
            DY   P F L +   D G P L +S  L ++++DI  N  A +F  VAK  +  V E+  +G+ ++ + A  +E+GD  K+      Y++I  + +     SID   GT+   +    +D+ T     +TVEA DS     +   + D  HV I I+D N+HRP              +   P+Y   + EN+P N       V+ K E  + D         L+  +   D  S  R++  +        + +DREK S      ++  D G+P L S +I+ V+VLD+N+    FT++ +  S+
Sbjct:  891 DYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEAS--VYENSEIGTEVIMIEA--KETGDEQKVKAENLEYRIIGGDGW--PHFSID-QKGTV---RTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRP--------------VAKKPMYIASVAENSPANV------VIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSE-HELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSV 1165          

HSP 7 Score: 59.6918 bits (143), Expect = 1.192e-8
Identity = 127/595 (21.34%), Postives = 239/595 (40.17%), Query Frame = 3
Query:  276 LVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENN--PENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDS-------RMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQ---PLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYE-----LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            + +DI D+ND AP F        + ED AVG+ +    A+DR+    G+I + L++       +  ++ NSG + +   L    ID   L   A D    N+   +T   I + DVN+  P      +      L +  PI    I +++  P N    FI     +EG                 +F++DS       R  + +N  QY+L++       + S  +  ++    +     P    T+IL      +N           SL +  N      ++F + D D    N F +N  N                 +++  + +D EK+ + +F    +   QDN++      ++VV+ ++NDN P+ + ++     + N+P+ E     + +++ +D D  E     I       +G          LF I ++  ++ V + +D E +    + +   D  F    +K +I+V ++D+NDN P +   +    V+    I    G +L   RA   D   +  + Y LK    +  ++++  TG ++L K ++        L +   D+G P   + A + I +  +N
Sbjct: 2698 VTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEE----NPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFT---IVVSDVNDSPPQFE-KEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIP-KGNEEG-----------------VFWIDSNNDLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVILA-----ENSKKGTVVLGESSL-LGPN------VTFKLSDNDG---NVFVVNFRNGIV--------------KVKESDQIDYEKNQQLEFHRLTI---QDNSEVCK-ELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDE-----IKFRMVDDFG---------GLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEF---EDKATILVTVIDQNDNAPTFEKSTYSMKVMESESI----GYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDEN 3210          

HSP 8 Score: 57.7658 bits (138), Expect = 4.922e-8
Identity = 62/264 (23.48%), Postives = 116/264 (43.94%), Query Frame = 3
Query:  906 KVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLN-SSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMS-FEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW 1691
            K    L+ +I   D+  P   +T  ++V++  ++     F+ S+Y  S++E+ D  +++    + Q     +E        +   +SF   S+ +S+G+I + + LDRE+  +++ +I     A       +  TV+V + D+NDN P + G    F + E+      +      D+D   + RI  S +    Y        NE+  W      L V   +D E I + K+     DEG        +I+V+  D ND+ P++
Sbjct: 2569 KAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVI--GRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTI----RADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPY-----FDLNENSGW------LTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVS--DVNDSPPQF 2813          

HSP 9 Score: 55.4546 bits (132), Expect = 2.488e-7
Identity = 67/247 (27.13%), Postives = 114/247 (46.15%), Query Frame = 3
Query:  966 KSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQ-----YVGRMSFEMKENNIPSYELGQLIFDDKDIGENS-RISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP 1685
            K+TI+  V V+DQN+    F +S YS+ ++E++   + +  F     D     E++L  S+   + SF   +L   +G + +  PLD E     + +  VV +        + A V + V+D NDN P+     YVG++  E  ++      +  L  D +  G  S  + I S TTT    T  L      F I+    + + QS+DYE I    + +   D G P   ++  + +++ DEND+ P
Sbjct: 3096 KATIL--VTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSD---VTSF--VNLNAQTGILTLAKPLDFETLSALKLT--VVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVK-ENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTT---DTPVLP-----FAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAP 3324          

HSP 10 Score: 54.6842 bits (130), Expect = 3.958e-7
Identity = 88/388 (22.68%), Postives = 149/388 (38.40%), Query Frame = 3
Query:  243 IGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL---FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLN----GYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILS-------FAVIDQDALSFNEFHLNSSNNFNMESF---HLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY 1352
            + Q  + S     ++I D ND +P FV       V E   V  V+  V A D++ G+ G + Y ++   +   S   ID  SG + L KPL       +  L + A DSA ++ K + +      I  +N  P  +    K   T L +    G P+  L    +   ++++              +  C       L    +L         T+  KL+ R+S++   +       +   +  Q + K    +   ++  N++  +F R  Y  +I EN     S+LS        + ID+D  S      N    + M S     + S+ Q SG IR     D EK   Y F +   +  Q   +    + + V V+D ND  P++
Sbjct: 1442 VQQANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNE--ESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMS----LHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHHGTVSYKL--------------EPNCTFFEVHTLSGAVHL--------ATWLTKLKHRKSVECTAI-------VESTEGQQDIAK----VIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGS------NGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRF 1784          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 93.2041 bits (230), Expect = 7.442e-19
Identity = 141/635 (22.20%), Postives = 273/635 (42.99%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFST-SFVSIDGNSGTIILKKPL-FDI-DKLTLTVEAHDSAEHNSKFD-WTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQ-----YKLRIRQSIDREKVSNPLN----FSINCQDNGQPLLKSTIILQVDV--LDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLN-----SSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSF-EMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS---ELKILQVKQSMDYEFIH----NCKIDIHFHDEGFPKNH--NKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGK---YDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSI 2000
            D E + ++ L++I    GQ Q+ +  ++ + + ++ND  P F   +  + V E+L VGS +  V A D +  +   + Y L+ +    T +  +ID  +GTI L  PL F++  + TLT++A D +     FD +T++ IF+ D+N++ P  S               P+Y   +   +P  F               G    +I+   L       D+R  L  +  Q     +++         KV  P       ++   DNG P   +++ + V +   +  + P  F ++ +   ++EN    S +   + +       EFH       +S  F+++ F         G + +  P+DRE+   ++F + + NE   + K        V+VLD NDN+P +     +  +K++     ++GQ++  D+D GEN R+S              LSGN DL  ++   +   +Q+ +  D +         +I +   D G P      K+ + + +   + + P ++ P    +V+  + +    GT L ++RA +   + ++ L Y LK     + ID  TGE++L   ++        ++L V+D     R++   L I++   + F  +
Sbjct: 1889 DREILERYSLKVIGTGSGQ-QIGT--RVDVRVNNLNDNVPSF-PMSKPRRVPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS-----FDTFTNLTIFVSDINDNAPTFS--------------KPLYQTTV---SPATF-------------SPGQPFAKIEAHDL-------DARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPG-FEKAEFRFEVMEN----SKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKF---------GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQ--CKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSY-----------RILSGN-DLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSV----GTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG--RSAVVPLKIVVEPVDEFAPV 2441          

HSP 2 Score: 89.3521 bits (220), Expect = 1.159e-17
Identity = 128/596 (21.48%), Postives = 250/596 (41.95%), Query Frame = 3
Query:  234 ACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYP-IYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKEN---NIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPE----WIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            A D G P L +  ++V D++D   + P+F    +   + ED  +G+ ++KV A + + G+  +I Y L +N+D     +++D  SGT+ ++K  FD +K         +   NS+   + + I + DVN++ P                 YP  Y L + E       +  ++  D D G  G+V   I           L      + N    ++  ++ + R +     +  ++ +D G    +++  + + V+D++     F+RS Y +   E+     +   A+    A+S  ++ +     ++ +  H  S+ + +G+I +   LD +       ++ +  +A   +  ++   V + + D NDN PQ+   +    ++E+   + P Y +     D K  GE  R SI S         ++ +G            L     +DYE   N K+ +   D G P   + +++ +++LD NDN PE    W     L+N            T + +V A D DS+ + ++ Y +    +   ID   G +   + I+       D+ +   D G P R+S+A+  I +   N
Sbjct:  512 AEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL-QNQD---EHLTVDTMSGTVCIQK-TFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIF---------------YPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI-----------LSESSSFSINPVTGEVFAQKPLARGR----FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDI----LPGIAIGSVGAMSKVKYSI-----YSGDQDHNFSIDEDTGKIYVTRYLDAD----VHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGE-VRYSIISSHPGSSIEIDQFTGQ-----------LSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENS--------PPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVN 1039          

HSP 3 Score: 83.1889 bits (204), Expect = 7.476e-16
Identity = 135/615 (21.95%), Postives = 248/615 (40.33%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRL----------NKNTYQYKLRIRQSIDREKVS-NPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVV--VLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTK----LTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D EF  K+ L + A D G+P      +  I+IID ND AP F    YT  V  ++++GS ++ V A D + G+  +I Y + K    S S  +I   SG I     L       + V A D   H S    +  V+ I  + +                 L+  P+  + + E+N  +           +    G +  ++   +      Y D+++RL              + Y L +   +DRE  S + L F +  + +GQ +++   +L +   D N+    +  S   +S+  N+      +    D D         N    +++    L S+ + +G I + N +D       +F +     A+D         + VV  +LD     PQ+   +   E+ E+      L +++ ++   G + RI  S      +   + +SG            + ++++ D+E   + +  +   +     + + ISI   + D NDN P + YP       N  H+ ++ G K    L  V A D DS +   ++Y + ++  S SI+P TGE+   K +  G++ L +   D G     +SAN+ I +  ++
Sbjct:  192 DREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAIS-QSGVITTTASLLPASTHDVIVVASD---HGSPSLSSSAVVTITVLGS----------------TLSSPPLDIIWLVESNSAHL---------MENSTLGSIVARVSIAQQ-----YRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLL--EKDGQIIIEHPQLLTIG--DINDNAPQWHSSQIHISL--NRTQGGSRTLTAKDPD------LGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRV----RAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGT-----------VCIQKTFDFEKQKSYQTTVIATNANSETSTSLISI--RLKDVNDNWPIF-YP-------NEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKD 735          

HSP 4 Score: 70.4774 bits (171), Expect = 5.874e-12
Identity = 106/418 (25.36%), Postives = 177/418 (42.34%), Query Frame = 3
Query:  213 KFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDI-DKLTLTVEAH-DSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVI-DQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRI 1454
            +F L + A D G     +S  + I +ID + + P+F    Y     ED+  G  I  V A+ +        IY   ++ +F     SID ++G I + + L  D+ D + L ++A   S E N     T VVIFI D N++ P  S                +  + I E+   +     +   DKD+ KNG+V+  I ++       +  S + +++ T Q  L     +D E   N     +   D G P   S + L + VLD N+    F +S Y++ ++EN    +I+   V  D+D+L   +     +N    E F    + +  G +     +DRE       SI  V E +     +S A+  + VLD+NDN P  +      +   +  S  +G ++  D D G N  +
Sbjct:  706 RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK----VKYSIYSGDQDHNF-----SIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQ----TQVVIFIEDHNDNPPQFSSS--------------LVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISS-------HPGSSIEIDQFTGQ--LSTGSLLDYEATRN-YKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN--GSEYF---GIDEKLGNVYTKRSIDREVISHVDISI--VAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSV 1079          

HSP 5 Score: 67.3958 bits (163), Expect = 5.908e-11
Identity = 80/340 (23.53%), Postives = 155/340 (45.59%), Query Frame = 3
Query:  999 DQNEYPALFTRSNYSLSIIEN---KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSS---LTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLT----RVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAG---KYDLFLQVTDNGNPMRNSSANLTIII 1973
            D N+ P  F+ S   +SI E+    + F ++  +  D+          N    +++ S H  S   + Q +G++  G+ LD E +  Y+  +   +        +S  T+ + VLD+NDN P++     + E+ EN+ P   +G+++  DKD  EN +I              +++   + F I E L  +  K+S+D E I +  I I   D+G P   +  S  +++LD NDN P         + ++I+ I + +G+ L+     + A+D D   +  + Y  + +  S+ +    G++ L + + A       L + V+D G P ++   ++ + I
Sbjct:  829 DHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKK--------NGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGI--PPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQI------------VYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP---------SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQ-SSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRI 1136          

HSP 6 Score: 65.4698 bits (158), Expect = 2.344e-10
Identity = 57/211 (27.01%), Postives = 97/211 (45.97%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIF-----ENNPENFEVSFINVVDKDEGKNGDV--KCQIQTT 806
            DYE    + L++ A D+G P   S+  L I ++D+ND AP+F    YT  V E+    +++ KV A D++S + G+I+Y++    +    +  ID   G +  K+    ID+  +                +HV I I+  +   P  S  +  R S   +N  P   L I        +P +  +  I  +D D+G NG V  + Q+Q++
Sbjct:  901 DYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE----YFGIDEKLGNVYTKR---SIDREVI----------------SHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSS 1088          

HSP 7 Score: 53.9138 bits (128), Expect = 6.542e-7
Identity = 73/290 (25.17%), Postives = 122/290 (42.07%), Query Frame = 3
Query: 1185 QSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISIS-SLTTTCYGPTEK--------LSGN-EDLFWISELKI-------LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPF----TGEISLTKD-IEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNM 1988
            + SGEI     LD EK  ++      V E+ +         + V V D NDN P +  ++                      +I E +++  S +L T   G   K        L GN  ++F ++  K+       L V   +D EF    ++ I   D G P    ++   + I+D NDN P +    S          NI  G+ L  V+A DAD   ++R++Y++K K  + S   F    +G I+ T   + A  +D+ +  +D+G+P  +SSA +TI +    +
Sbjct:   73 ERSGEISTIAHLDYEKRSKFDIVAVKVEESGETID------ILVEVDDENDNAPSFADQVV-------------------KLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF----SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIK-KTSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTL 332          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 82.4185 bits (202), Expect = 1.546e-15
Identity = 127/557 (22.80%), Postives = 234/557 (42.01%), Query Frame = 3
Query:  276 LVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-------LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRT---STQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSI---DREKVSNPLNFSINCQDNGQPLL--------KSTIILQVDVLDQN--EYPALFTRSNYSLSIIEN---KDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESF----HLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQL-IFD-DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-----SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKN-HNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA 1826
            L I I D+ND  P F    YT  V+ED+ +   ILKV A+D+++GD  +I Y  + N +FS        NS   I  K   D D+L          V A D  E  S    + ++    +  N    + + + + T   +     G P+  ++  + + +    SF++       KNG      ++T+ + NLF +D    L        +++R  +   D  +  NP+N ++  QD+G   +         +T+++ ++ ++ N  E+P     S+ +  I+E     D  +I+     D D+ +  +  + L  + + + ++F        LT S   +      DRE  PR   ++   +    +     F   SV V+DINDN PQ+  R S+E   +   +     + +F  D D   N+ I+ S    T  G  E+   + D F +      E+ +++       +FI N   D    D G P+   +   + +N+LD+    P+W         + +   N++    + R RA+ +    ++ + Y+L A
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYS-VDNHNFSI-------NSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVS-LSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMD-------KNG------RSTQKM-NLFSIDEHTGL--------VKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIA-KIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV-----FDRETRPREDVTVKATDRG--DRPLIGFCQFSVEVVDINDNSPQFE-RPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAG--EEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIAD----DNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDE-NVELNKVILRCRAVSSGDSRNSDVIYKLTA 1137          

HSP 2 Score: 77.7962 bits (190), Expect = 3.724e-14
Identity = 136/571 (23.82%), Postives = 232/571 (40.63%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQ-------KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGS--VILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDI-DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSN--PLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFN---------EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI--------SELKILQVKQSMDYEFI---HNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRL 1808
            D E I  ++L + A D     L  +        K+ I I D+ND AP F  + Y   V+E    G   + +K H +D+ S     + Y LI        F  +  +SGTI +K+PL F+  D+  L + A D   HN+    T+V I I DVN++ P         T  +     P     +   + +  E S   +V + EG+  D                     R+ K  Y   + + +++DR+  +     NF +   D+    L     +QV+V D N+   +F    +   I EN++         +D  A  F+         E+ +  +   N ES  +  + Q++G+I     LDRE S   +F I V    +       FA V++ V D+NDN P +  +  +E             + F   D  E ++ ++          T +LS   D F++        S + +L+VKQ +DYE +       + I   D    ++  + ++ V ++D ND+ P  I+ ++   V      ++  GT + R  A D D+  + R 
Sbjct: 1287 DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHS----NLRYHLIGAGGGRIPF-GVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNAT---TNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSS-RIVYRLEGQGAD------------------EVFRIGK--YSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGES--VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP-FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVF---------TYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPH-IHGATEHRVRE----DVPRGTSIGRYTATDRDAGDTARF 1806          

HSP 3 Score: 77.0258 bits (188), Expect = 5.931e-14
Identity = 157/680 (23.09%), Postives = 276/680 (40.59%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL----IKNEDFSTS---FVSIDGNSGTIILKKPL-FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRL-----NKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSI---------IENKDNFSILSFAVIDQDALSF-NEFH---LNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEA-----------QDNTKFTSFATVSVVVLDINDNVP-----QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKIS-IIVNILDENDNEPEW---IYPSS-LDNVVNISHINIQSGTKLTRVRAIDADS-VSSNRLTYELKAKH--DSISIDPFTGEISLTK----DIEAG--KYDLFLQ-VTDNGNPM 1940
            DS+ NG   Y L  +Q   R  F+++R   +L+       D E  P+  + + A D G   L    +  ++++DIND +P+F   +Y   V    AVG+ ++ V A D ++    +I Y L       E+       F  ++  SG I L KP+     K    V A D+    +      V + ++D     P      D +             + + EN   N  +     V   + +N DV  ++  +    N    +S+ R      N N +  ++ I + +D E+V+N    ++   D     + ST    V+V D N+    FT   ++ +I         +E  +   I++   ID D+    NE H   +  +N    + F +  LT   GEI      DREK   Y  ++   + +           +DN K      V +V+ D+NDN P     +Y+GR    +KE+    +++  +   D D   N R  +               G    F + ++   + VK+ +D+E      + +   D      HN  + + ++I D NDN P++    Y ++ ++  V+I  +       L  V A DAD    S+R+ Y L+ +   +   I  ++G I L K    D  AG   ++  +Q + D+GN +
Sbjct:  898 DSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPG-----------ITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGN--KAESKFRQFNKFENGNEW-VEVVIMEGLDYEQVNN-YTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELT---GEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVK------VQIVINDVNDNAPSFEEQKYIGR----VKESEGEGHDVITIKAHDLDKHSNLRYHLIG-----------AGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD----GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKV-------LFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGL 1526          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 143.28 bits (360), Expect = 4.626e-34
Identity = 157/625 (25.12%), Postives = 258/625 (41.28%), Query Frame = 3
Query:  210 PKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRT---STQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNME-------------SFHLSSLTQ------SSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVV--VLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS-----ISIDPFTGEIS---LTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P  +L + A D G  +  +   + + IID     P F    Y   V+ED+  G+V+  V A   +      + Y +   +     + SI+ NSG I + KPL    K  + +    +      +  T V I + DVN++ P       + +   S +L  G P+Y                    DKD G +G V   +   +  K LF +D+R           L + Q +D E  S      +   D G P L + + + VDV D N+ P +F +  YS+++ E++          I+   +  N   L++ NN  +              S   S ++Q      +SG I +  PLDRE   RYQ ++     A DN    + A   V+  VLD NDN P++   +  F ++EN      +G +   D D+GEN+ I  S L          ++G            +  ++ +D E      + +   D+G P    ++ + +++ D NDN PE   P   ++VV++       GT++ RVRA+D D   +  +TY +    DS      SIDP +G I    +    E   Y L +  +D GNP R +   L + +   N
Sbjct:  791 PMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAEL--GAPLYAAHAH---------------DKDSGSSGQVTYSL-VKESGKGLFAIDAR--------SGHLILSQHLDYES-SQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRS---------INAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVL----ATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGE-----------ISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQ--EDVVSVRE-EQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLN 1359          

HSP 2 Score: 112.079 bits (279), Expect = 1.575e-24
Identity = 127/505 (25.15%), Postives = 215/505 (42.57%), Query Frame = 3
Query:  219 VLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI---QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNM----ESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVV--VLDINDNVPQYVGRMS--FEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW 1691
            VL  I   +G+P +    ++ I++ D+ND AP+F A      V E   +G+ +   HA D++SG  G++ Y L+K  +      +ID  SG +IL + L      + TL V A D    +   + T +++ + DVN++ P      D+            Y + + E+   N ++  +N  D D G N  +  +I       +  ++   D             + +R  +DRE   +    ++   DNG P   +   + V VLD N+    F +S Y   I EN    S++   V+    L   E   N++  +++     SF +  +T   GEI    PLDRE    Y      V EA+D       A V V   V D+NDN P+          ++E   P  E+ ++   D+D G+N+ I+ S +         + S    LF I     +++ +  +D+E     ++ +   D G P       + V +LD NDN P +
Sbjct:  898 VLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVK--ESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLT-ILVDVQDVNDNPPVFE--KDE------------YSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRE-TRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVV--GVVTASDLDLGE---NAAIRYSLLPINSSFQVHPVT---GEISTREPLDRELRELYDL----VVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKG-------RDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 3 Score: 109.768 bits (273), Expect = 7.321e-24
Identity = 153/640 (23.91%), Postives = 281/640 (43.91%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQ---PQLCSSQKLVIDIIDINDEAPKFVAKNYTK------VVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLF----DIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRM----------RLNKNTYQYKLRIRQSIDREKVSNPL------NFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEG-FPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSIS----IDPFTGEISLTKDI--EAGKYDLFLQVT--DNGNPMRNSSANLTIII 1973
            D+E + +++L + A D       +L +S  + + I+D ND AP FV+ N +        + +   +G V+  + A+D +SGD G++ Y++            I+  +G I L K L     D++K     L + A D  +   K    ++ + +   +N+ P            + L    +Y   I EN P    V  +        +N ++  +I    +  +LF++D +           R ++ +Y   + +R +  +  +S+        + SI    NGQ    +TI + V  ++ N  P     S Y LS+ EN +   I +    D D      L ++    N  N F+++S        SSGE+    PLDRE+  RY   I   +  Q  ++      +++ V D NDN P++ + + +  ++E+      + Q+   D D+G N+R+  S    T +     + G   L  I+ +  L  +    Y F+      +   D G +      + + +N+LD NDN P +     +  V  +    IQ G  L +V+A+DAD  ++  + Y L A++ ++S    I+P TG +S ++ +  E+GK  L L+V   D GNP ++S   + ++I
Sbjct: 1558 DFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN--GEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPP------------RFLQA--VYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNS-PEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDS--------SSGELS-ARPLDREQHSRYTLQIQASDRGQPKSR-QGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW--QFAIDGQSGL--ITTVGKLDRELQASYNFM------VLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL----IQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 4 Score: 100.138 bits (248), Expect = 8.016e-21
Identity = 145/624 (23.24%), Postives = 263/624 (42.15%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL-----------IKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQL--IFDDKDIGENS--------RI--SISSLTTTCYGPT---EKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKN--HNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL--------KAKHDSISI---DPFTGEISLTK--DIEA-GKYDLFLQVTD 1925
            DYE   +  L + A D G P L ++  +++D+ D+ND  P F    Y+  V E  ++ + I++V+A D ++G+  +I Y++           I + D S  F  I  NSG I L+ PL     D+  LTV A D+    +    T V++ ++D N++ P                    Y   I EN      V  +   D D G+N  ++          +L  ++S  +++  T +  +  R+ +DRE +    +  +  +D G P+  + + +++ V D N+  P +       +S+ E +     ++    +D+D         +     + +   L S+  +SG IR    LD E+   Y+  +   +    N    +   + V VLD+NDN P +    + F ++E+    + +G +  I    D+  NS        R+  +++ LT          ++ SGN           L V + +D E     +++I   D     N   + I++ + + D NDN PEW        V   + +    GT +    A DAD+ ++  L Y L        +++  ++S+   D  TG +SL    D EA  +Y L +Q  D
Sbjct:  995 DYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHF-GIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGT-PAAHAKTRVIVRVLDANDNDPKFQKSK--------------YEFRIEENLRRGSVVGVVTASDLDLGENAAIRY---------SLLPINSSFQVHPVTGE--ISTREPLDRE-LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGG--NPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN-----------LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPV----GTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALD 1573          

HSP 5 Score: 90.1225 bits (222), Expect = 8.846e-18
Identity = 143/636 (22.48%), Postives = 256/636 (40.25%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQ-KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPAL-FTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFN-EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNP---------------LDREKSPRY-----------------------------------QFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK---ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH----DSISI---DPFTGEISLTKDIE 1889
            D E   ++ LQ+ A D GQP+       + I + D ND AP+F    YT  VQED  +G+ ++++ A+D + G   +++Y L     +     +IDG SG I     +  +D+         V A D   +  +     V I ++D+N++RP             +   YP Y  ++         +  +  +D D G N ++   +           + ++ R+N +T    L   QS+  E     L+  +  +D G P   S  ++++ + +  +  P L F    Y + + EN  + + +L    +  D      +F   + N   + S  L SL   SGEIR+  P               L R ++  Y                                   +  + +V    D     S+A + + + D NDN P++  +     + E N     + Q+   D D G N+R+               + GN D  ++ E     I++    +D E     K+ I   DEG P+     +I V I+D NDN+P   +P   +N+V +S    + G  +T + A D D+  +  LTY L A+     +++SI   D ++G++ L + ++
Sbjct: 1910 DREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ---FAIDGQSGLITT---VGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP-------------IFERYP-YIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAEN-----SAVSAKFRINPST--GALSASQSLASES-GKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILS--LDSL---SGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY-----------HIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP--TFPP--NNLVTVSEAT-ELGAVITSISANDVDTYPA--LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLD 2494          

HSP 6 Score: 89.7373 bits (221), Expect = 1.112e-17
Identity = 152/619 (24.56%), Postives = 260/619 (42.00%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDIDKL-TLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISV--GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYVGRMSF---EMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI------LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWI---YPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK-DIEAGK----YDLFLQVTDNGNPMRNSSA 1955
            D E  P + L + A D G P L     + I I D+ND  P F    Y   V E+  VG+ +L+V+A D ++ + G + Y + + +        ID  +G I + K L F+  +L  L V A D  E     + T  V I + DVN+++P I+V   SD  +     +  P  F+     +  + +  + NV     G +G               F L +R     +   Y + +   +DRE VSN    S+   D G P L ++  + + + D N+ P  F +  Y  +++E  D   S+L     D+D     AL+++   L  +   + + F +   T   G I   + +D E  P  Q ++     A+D      +S ATV V + D+NDN P +    SF    + EN      + ++   D D G N+ ++ +                E    ++E ++      + +   +D+E   + +  +   D G       I +   + D NDN P +    Y  SL      S  +  S T +  V A D D  +  +++Y + A +++    ID  TGEI + + D+ + +    + L +  TD GN   N+ A
Sbjct:  245 DRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQ--PLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH--------------FALTTR-----DNSIYLVIVHLPLDREIVSN-YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYS---LAETPETHAQWFQIDPQT---GLITTRSHIDCETEPVPQLTVV----ARDGGVPPLSSTATVLVTIHDVNDNEPIF--DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--------------GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKM--QLTDVNDNRPVFYPREYKVSLRESPKAS--SQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADA 811          

HSP 7 Score: 74.7146 bits (182), Expect = 3.967e-13
Identity = 139/571 (24.34%), Postives = 241/571 (42.21%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDF---STSFVSIDGNSGTIILKKPL-FDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFL------EIFENNPENFEVSFINVVDKD-EGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDAL--SFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVN----EAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPS--YELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL--KILQVKQSMDYE-FIHNCKIDIHFHDEGFPKNHNKISII------VNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL 1820
            D E    + L++IA D G PQ+  +  + + I+D+ND  P F   N    V E   +G+VI  + A D ++  +  + Y+L         + S  ++D  SG ++LK+ L +++ +   L V A D+A H ++       +  + VN+   N  V         L    P YF       EI E+   +F++  +N  D D EG N  V   I+  +   ++   +  + +N +  Q  +           S      I  +D G+P LKS+ +L+V   D     + F ++ Y   I E     S++    + QDAL  S      N  + F         L QS   + +  PLDRE++  Y+  + + +        +   +S  +V + +LD NDN P +     +E + + +    Y + QL   D D  EN+  S        Y  T   SGN++  +  +L   +L V   +DY+    + ++ I   D     +H++  +       + + DENDNEP++     L   V+    N   G+ + R  A D D     +L Y +
Sbjct: 2387 DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-HEAR------TVLTVRVNDENDNAPV--------FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAV---------SSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV--LQLGQDALDQSLAIIAGNEESAFE--------LLQSKAIVLV-KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QENTPNS-----EVVYDIT---SGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACD-----SHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI 2901          

HSP 8 Score: 52.7582 bits (125), Expect = 2.307e-6
Identity = 51/209 (24.40%), Postives = 87/209 (41.63%), Query Frame = 3
Query:  195 DYEFIPK-FVLQLIACDIG-QPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL--IKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVG----SDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI 797
            DY+   K + L + ACD   Q  LCS Q   +++ D ND  PKF    Y   + E+  VGS + + HA D + G FG++ Y +    +++ S     +D  SG ++    +FD              E   ++D     +   D+   + +++V     S    + Q       + L      P+ + V  +   D D G +G V  Q+
Sbjct: 2819 DYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG-LVTSAFVFDY-------------EQRQRYDME---LLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL 3010          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 143.28 bits (360), Expect = 4.626e-34
Identity = 157/625 (25.12%), Postives = 258/625 (41.28%), Query Frame = 3
Query:  210 PKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRT---STQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNME-------------SFHLSSLTQ------SSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVV--VLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS-----ISIDPFTGEIS---LTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P  +L + A D G  +  +   + + IID     P F    Y   V+ED+  G+V+  V A   +      + Y +   +     + SI+ NSG I + KPL    K  + +    +      +  T V I + DVN++ P       + +   S +L  G P+Y                    DKD G +G V   +   +  K LF +D+R           L + Q +D E  S      +   D G P L + + + VDV D N+ P +F +  YS+++ E++          I+   +  N   L++ NN  +              S   S ++Q      +SG I +  PLDRE   RYQ ++     A DN    + A   V+  VLD NDN P++   +  F ++EN      +G +   D D+GEN+ I  S L          ++G            +  ++ +D E      + +   D+G P    ++ + +++ D NDN PE   P   ++VV++       GT++ RVRA+D D   +  +TY +    DS      SIDP +G I    +    E   Y L +  +D GNP R +   L + +   N
Sbjct:  791 PMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAEL--GAPLYAAHAH---------------DKDSGSSGQVTYSL-VKESGKGLFAIDAR--------SGHLILSQHLDYES-SQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRS---------INAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVL----ATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGE-----------ISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQ--EDVVSVRE-EQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLN 1359          

HSP 2 Score: 112.079 bits (279), Expect = 1.575e-24
Identity = 127/505 (25.15%), Postives = 215/505 (42.57%), Query Frame = 3
Query:  219 VLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI---QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNM----ESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVV--VLDINDNVPQYVGRMS--FEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW 1691
            VL  I   +G+P +    ++ I++ D+ND AP+F A      V E   +G+ +   HA D++SG  G++ Y L+K  +      +ID  SG +IL + L      + TL V A D    +   + T +++ + DVN++ P      D+            Y + + E+   N ++  +N  D D G N  +  +I       +  ++   D             + +R  +DRE   +    ++   DNG P   +   + V VLD N+    F +S Y   I EN    S++   V+    L   E   N++  +++     SF +  +T   GEI    PLDRE    Y      V EA+D       A V V   V D+NDN P+          ++E   P  E+ ++   D+D G+N+ I+ S +         + S    LF I     +++ +  +D+E     ++ +   D G P       + V +LD NDN P +
Sbjct:  898 VLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVK--ESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLT-ILVDVQDVNDNPPVFE--KDE------------YSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRE-TRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVV--GVVTASDLDLGE---NAAIRYSLLPINSSFQVHPVT---GEISTREPLDRELRELYDL----VVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKG-------RDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 3 Score: 109.768 bits (273), Expect = 7.321e-24
Identity = 153/640 (23.91%), Postives = 281/640 (43.91%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQ---PQLCSSQKLVIDIIDINDEAPKFVAKNYTK------VVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLF----DIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRM----------RLNKNTYQYKLRIRQSIDREKVSNPL------NFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEG-FPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSIS----IDPFTGEISLTKDI--EAGKYDLFLQVT--DNGNPMRNSSANLTIII 1973
            D+E + +++L + A D       +L +S  + + I+D ND AP FV+ N +        + +   +G V+  + A+D +SGD G++ Y++            I+  +G I L K L     D++K     L + A D  +   K    ++ + +   +N+ P            + L    +Y   I EN P    V  +        +N ++  +I    +  +LF++D +           R ++ +Y   + +R +  +  +S+        + SI    NGQ    +TI + V  ++ N  P     S Y LS+ EN +   I +    D D      L ++    N  N F+++S        SSGE+    PLDRE+  RY   I   +  Q  ++      +++ V D NDN P++ + + +  ++E+      + Q+   D D+G N+R+  S    T +     + G   L  I+ +  L  +    Y F+      +   D G +      + + +N+LD NDN P +     +  V  +    IQ G  L +V+A+DAD  ++  + Y L A++ ++S    I+P TG +S ++ +  E+GK  L L+V   D GNP ++S   + ++I
Sbjct: 1558 DFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN--GEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPP------------RFLQA--VYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNS-PEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDS--------SSGELS-ARPLDREQHSRYTLQIQASDRGQPKSR-QGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW--QFAIDGQSGL--ITTVGKLDRELQASYNFM------VLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL----IQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 4 Score: 100.138 bits (248), Expect = 8.016e-21
Identity = 145/624 (23.24%), Postives = 263/624 (42.15%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL-----------IKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQL--IFDDKDIGENS--------RI--SISSLTTTCYGPT---EKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKN--HNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL--------KAKHDSISI---DPFTGEISLTK--DIEA-GKYDLFLQVTD 1925
            DYE   +  L + A D G P L ++  +++D+ D+ND  P F    Y+  V E  ++ + I++V+A D ++G+  +I Y++           I + D S  F  I  NSG I L+ PL     D+  LTV A D+    +    T V++ ++D N++ P                    Y   I EN      V  +   D D G+N  ++          +L  ++S  +++  T +  +  R+ +DRE +    +  +  +D G P+  + + +++ V D N+  P +       +S+ E +     ++    +D+D         +     + +   L S+  +SG IR    LD E+   Y+  +   +    N    +   + V VLD+NDN P +    + F ++E+    + +G +  I    D+  NS        R+  +++ LT          ++ SGN           L V + +D E     +++I   D     N   + I++ + + D NDN PEW        V   + +    GT +    A DAD+ ++  L Y L        +++  ++S+   D  TG +SL    D EA  +Y L +Q  D
Sbjct:  995 DYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHF-GIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGT-PAAHAKTRVIVRVLDANDNDPKFQKSK--------------YEFRIEENLRRGSVVGVVTASDLDLGENAAIRY---------SLLPINSSFQVHPVTGE--ISTREPLDRE-LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGG--NPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN-----------LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPV----GTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALD 1573          

HSP 5 Score: 90.1225 bits (222), Expect = 8.846e-18
Identity = 143/636 (22.48%), Postives = 256/636 (40.25%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQ-KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPAL-FTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFN-EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNP---------------LDREKSPRY-----------------------------------QFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK---ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH----DSISI---DPFTGEISLTKDIE 1889
            D E   ++ LQ+ A D GQP+       + I + D ND AP+F    YT  VQED  +G+ ++++ A+D + G   +++Y L     +     +IDG SG I     +  +D+         V A D   +  +     V I ++D+N++RP             +   YP Y  ++         +  +  +D D G N ++   +           + ++ R+N +T    L   QS+  E     L+  +  +D G P   S  ++++ + +  +  P L F    Y + + EN  + + +L    +  D      +F   + N   + S  L SL   SGEIR+  P               L R ++  Y                                   +  + +V    D     S+A + + + D NDN P++  +     + E N     + Q+   D D G N+R+               + GN D  ++ E     I++    +D E     K+ I   DEG P+     +I V I+D NDN+P   +P   +N+V +S    + G  +T + A D D+  +  LTY L A+     +++SI   D ++G++ L + ++
Sbjct: 1910 DREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ---FAIDGQSGLITT---VGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP-------------IFERYP-YIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAEN-----SAVSAKFRINPST--GALSASQSLASES-GKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILS--LDSL---SGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY-----------HIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP--TFPP--NNLVTVSEAT-ELGAVITSISANDVDTYPA--LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLD 2494          

HSP 6 Score: 89.7373 bits (221), Expect = 1.112e-17
Identity = 152/619 (24.56%), Postives = 260/619 (42.00%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDIDKL-TLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISV--GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYVGRMSF---EMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI------LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWI---YPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK-DIEAGK----YDLFLQVTDNGNPMRNSSA 1955
            D E  P + L + A D G P L     + I I D+ND  P F    Y   V E+  VG+ +L+V+A D ++ + G + Y + + +        ID  +G I + K L F+  +L  L V A D  E     + T  V I + DVN+++P I+V   SD  +     +  P  F+     +  + +  + NV     G +G               F L +R     +   Y + +   +DRE VSN    S+   D G P L ++  + + + D N+ P  F +  Y  +++E  D   S+L     D+D     AL+++   L  +   + + F +   T   G I   + +D E  P  Q ++     A+D      +S ATV V + D+NDN P +    SF    + EN      + ++   D D G N+ ++ +                E    ++E ++      + +   +D+E   + +  +   D G       I +   + D NDN P +    Y  SL      S  +  S T +  V A D D  +  +++Y + A +++    ID  TGEI + + D+ + +    + L +  TD GN   N+ A
Sbjct:  245 DRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQ--PLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH--------------FALTTR-----DNSIYLVIVHLPLDREIVSN-YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYS---LAETPETHAQWFQIDPQT---GLITTRSHIDCETEPVPQLTVV----ARDGGVPPLSSTATVLVTIHDVNDNEPIF--DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--------------GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKM--QLTDVNDNRPVFYPREYKVSLRESPKAS--SQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADA 811          

HSP 7 Score: 74.7146 bits (182), Expect = 3.967e-13
Identity = 139/571 (24.34%), Postives = 241/571 (42.21%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDF---STSFVSIDGNSGTIILKKPL-FDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFL------EIFENNPENFEVSFINVVDKD-EGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDAL--SFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVN----EAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPS--YELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL--KILQVKQSMDYE-FIHNCKIDIHFHDEGFPKNHNKISII------VNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL 1820
            D E    + L++IA D G PQ+  +  + + I+D+ND  P F   N    V E   +G+VI  + A D ++  +  + Y+L         + S  ++D  SG ++LK+ L +++ +   L V A D+A H ++       +  + VN+   N  V         L    P YF       EI E+   +F++  +N  D D EG N  V   I+  +   ++   +  + +N +  Q  +           S      I  +D G+P LKS+ +L+V   D     + F ++ Y   I E     S++    + QDAL  S      N  + F         L QS   + +  PLDRE++  Y+  + + +        +   +S  +V + +LD NDN P +     +E + + +    Y + QL   D D  EN+  S        Y  T   SGN++  +  +L   +L V   +DY+    + ++ I   D     +H++  +       + + DENDNEP++     L   V+    N   G+ + R  A D D     +L Y +
Sbjct: 2387 DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-HEAR------TVLTVRVNDENDNAPV--------FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAV---------SSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV--LQLGQDALDQSLAIIAGNEESAFE--------LLQSKAIVLV-KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QENTPNS-----EVVYDIT---SGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACD-----SHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI 2901          

HSP 8 Score: 52.7582 bits (125), Expect = 2.307e-6
Identity = 51/209 (24.40%), Postives = 87/209 (41.63%), Query Frame = 3
Query:  195 DYEFIPK-FVLQLIACDIG-QPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL--IKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVG----SDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI 797
            DY+   K + L + ACD   Q  LCS Q   +++ D ND  PKF    Y   + E+  VGS + + HA D + G FG++ Y +    +++ S     +D  SG ++    +FD              E   ++D     +   D+   + +++V     S    + Q       + L      P+ + V  +   D D G +G V  Q+
Sbjct: 2819 DYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG-LVTSAFVFDY-------------EQRQRYDME---LLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL 3010          
BLAST of Protocadherin vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 125.946 bits (315), Expect = 8.944e-29
Identity = 156/633 (24.64%), Postives = 274/633 (43.29%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLI---KNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENN--PENFEVSFINVVDKDEGK-NGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDALSFNEFHLNSSNNFN-----MESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNT---KFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYEL---GQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHF------HDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK--HDSISIDPFTGEISLTKDI----EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E    ++L + A D G+P   +  +L+I I+D ND +P F  K Y+  V E+ ++G+++L+V A D + G  G+I Y ++   +N DF     SI  ++G + + K L    + + +LTV A D A  N   D   + I I+D+N++RP              L+    Y   + EN   P    V  +N  D D    N  V+  ++      +LF      R+N ++    L   + +DRE+ S     ++   D G P L  T I++V+V D N+   +F   +Y  ++ EN      +L+    D+D        LN+   FN     M  FH+ S T   GEI     LDRE++  Y  ++     AQD++      S   +++ V D+NDN+P+      F+    N+   E    G+ +F     D D GEN+ +  +            +SG +  ++    K   V   ++ +       D+ +       D+G     +K  + V IL   +  P + Y   + N       +++ G  +T+V A         ++ Y +      DS+ +DP +G +S+ +D         Y+++++  D   P   S   +T+ +   N
Sbjct: 2237 DRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDF-----SISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPT------------FLDS--PYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGD--SDLF------RINASSGDIAL--LKPLDREQQSE-YTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDE------GLNAKLRFNLLGEHMHRFHIDSET---GEISTATTLDREETSVYHLTLM----AQDSSITEPRASSVNLTISVSDVNDNIPK------FDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYT------------ISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAY---MANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDAN 2804          

HSP 2 Score: 122.094 bits (305), Expect = 1.585e-27
Identity = 156/608 (25.66%), Postives = 258/608 (42.43%), Query Frame = 3
Query:  222 LQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREK-------------VSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDA-------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMS-FEMKENNIPSYELGQLIFDDKDIGENSRI--SISSLTTTCYGPTEKLSGN-EDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSI------SIDPFTGEISLTKDIEAGKYDLF---LQVTDNGNP 1937
            ++L+A D G P L S   L + I D+ND  P F   +Y   + E   V +    + A D + GD G+I Y++I+        V  D   G + ++ PL   + D   LTV   D+ +  S+     VVI +ID N++ P            Q  N    +   I EN P +  V  +  VD+D G+N ++   + +       F +D+R    K    +       + R                 N +       DNG P L+  + ++V V D N+    F R+ Y ++I E     + ++  V  QDA       + ++    N +  FN++S        ++G++ +G  LDRE    +   I V  +A      +S A++++VVLD NDN P++    S   + E +    EL +    D D G NS++  SIS             +GN  D F I  +   L + + +DYE I +  ++I   D G P     +   V ++D+NDN P  I+PS+   +V      I   T +  V A D DS  + +++Y +  +   +       I+  TG I   ++I+    D F   +  TD   P
Sbjct: 1017 VELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPD---GYLFVRAPLDREERDYYALTVSCRDAGQP-SRSSVVPVVIHVIDENDNAP------------QFTNS--TFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQ---TQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITH-VFTQDADEGLNGDVYYSLAKGNEAGQFNLDS--------ATGQLSLGRRLDRESQEIHHL-IVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSIS-------------AGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPP--IFPSTA--IVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQP 1576          

HSP 3 Score: 119.398 bits (298), Expect = 1.073e-26
Identity = 149/617 (24.15%), Postives = 257/617 (41.65%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNE-----DFSTSFVS----IDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI-LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISII-VNILDENDNEPE-----WIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSI-SIDPFTGEISLTKDIEAG-----KYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L + A D G P      ++ + I+D+ND  P F   +Y   + E    G+ ++ V A D + GD  KI Y L + E     +  T  +S    ++    T +           T+    H S   + +   T+V + ++D N+H P IS            +G  +  ++  EN      V+ + V D D G NG    +I +   L +        RL +    + +R+   +DRE++    N ++   D G P   +T  L +DV D N++  +F +S YS  + E     S + S    D+D     + H +  +   ++ F +  LT   G I    PLDRE     + SI    +   N KF ++  + V++LD ND  PQ+  R  +  + E+  P   +  +   D D G N      S+T       E+L   +  F +  L   L  ++ +D E +   +I +   D+G P   +  + + +N+ D NDN+P+     +IY  + D+        ++    L  V A D D   +  + Y L++  + +  +D  +G ISL  D  A       Y L +   D G       A + I++
Sbjct:  229 DRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGR---TYVTVNLLDTNDHDPIISF-------RFFPDGGKVATVD--ENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHF-------RLEEAADLHIVRVNGVLDREEIGK-YNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLT---GLIVTTGPLDREIRDTVELSI-SARDGGPNPKF-AYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTN-----GSVTFALAPSVERLYPLQ--FALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVL 813          

HSP 4 Score: 116.316 bits (290), Expect = 8.674e-26
Identity = 157/672 (23.36%), Postives = 284/672 (42.26%), Query Frame = 3
Query:   27 KVSEAGKAFQNPRIRIDSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFV-AKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTL---TVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAV-IDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDI-GENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNC-KIDIHFHDEGFPKNHNKISIIVNILDENDNEP-----EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIIIYQQNM 1988
            ++S+    F    + +D  +N V HY +    + + +       +S    +  K+  ++ +  + + + A D G+  L S  +L + I+   +  P F    N    + ED+  G +I KV A   + G  GKI Y +          + +D NSG + + +   D +   L    +EA D  +  S    T + + + D N++ P +          QL     IY  E+ E       ++ +   D+D G NG+V  ++Q           D    + ++   Y    R  +DRE++ +   F +   D G P +  T  + + +LD+N+ P  FTR  +SL++ EN +   I SF + +    L     + N+S +F+        +   SG I +   LDRE+   Y   +   + A     + +   +++ + D NDN P++     SF   E       +GQ+I  D+D  G NS IS S        P+   S +     +   K ++ K S       N   + +   D G P  +++  + +NI+D ++N P     E++ P   D V          G ++ RV A D   + +N + Y L   + S   S+    G I+L K I+     +Y+L ++ TD G P ++    + I++  +NM
Sbjct: 2608 RISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDL-TYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGG--IMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAAD-GDTPSLRSVTLITLNVTDANDNAPVME---------QL-----IYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQND--------FDGTFEITESGEIY---TRMRLDREEIGD-YAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRL-FSLNVTENAE---IGSFVIRVTSSDLDLGA-NANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGA-----WRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYS-----LQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAV---------RGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENM 3224          

HSP 5 Score: 103.99 bits (258), Expect = 5.741e-22
Identity = 139/558 (24.91%), Postives = 238/558 (42.65%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYL------DSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQV--DVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSF-NEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGP-TEKLSGNEDLFWISELK---ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPS---SLDNVVNISHINIQSGTKLTRVRAIDADSVSSNR 1805
            DY+ I ++ L +   D+G   L S   L I + D+ND  P F  K Y   + E+  VG+ + + HA D++S     I Y  + +      F+ ++ ++GTI      FD ++    TL ++A +    +S   + ++ + ++ VN   P            Q L   P++  ++ E +     V  +   DKD G++G V             +YL      D   R++ NT    + + + +DRE   N +  ++  ++ G      T   QV   + D N+ P  F +  Y+ +I E       + +   ID+D  +  N+F  +  N    +SF +   T   GEI   + LDRE++  Y   I  ++        T  ATV + + D+NDN P +    ++  + EN      +  LI  D D+  N             GP T +L G +   W+S  +   +++   S D E     +  I   D G PK  ++  + + +LD+NDN      PS   SL   V++ + ++ S  KL  VR  D D V   R
Sbjct: 3293 DYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFI-MNQSNGTIS-SAVSFDYEERRIYTLQIKAKNP--DSSMESYANLYVHVLGVNEFYP------------QFLQ--PVFHFDVSETSAVGTRVGAVQATDKDSGEDGRV-------------YYLLVGSSNDKGFRIDTNT--GLIYVARHLDRE-TQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQT---GEISTASRLDREETSTYNLVIGAIDTGL--PPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNG------------GPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN------PSTTRSLHIAVSLFNGDLPSNVKLADVRPNDIDIVGDYR 3792          

HSP 6 Score: 101.293 bits (251), Expect = 3.261e-21
Identity = 155/615 (25.20%), Postives = 247/615 (40.16%), Query Frame = 3
Query:  282 IDIIDINDEAPKFV---AKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLI--KNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDS-AEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI--QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN--KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQS------SGEIRIGNPLDREK---------------SPRYQFS---IFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYVGRMSFE--MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNE--DLFWISELKILQVKQSMDYEF--IHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I IID+ND AP F        T  + E+ AVG  I      DR++G   +I Y L    N+ F    V     +G + L++P+       + VE   + A          + + I DVN+H P     S              Y   + E    N     +   D D G NG +  +I    T+ +  +F          + Y   L +R  +DRE+  +    +++C+D GQP   S + + + V+D+N+    FT S ++ SI EN   D F +     +D+D     E            SF LSS TQ       +G I+   P DRE                S R   +   + +     DN   +      V V+V D+NDN P+++ R  +   + E       +  +   D D G N  +  S              GNE       S    L + + +D E   IH+  +         P + N  SI + +LDENDN PE+   SS  +V+  S     +GT+L R RA DAD   ++++ + + A  + D+  ID  TG + L K +   +   Y L +  +D G P  +++    +++   N
Sbjct:  930 IAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPV-----TGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTS--------------YETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVF---------PDGY---LFVRAPLDREE-RDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTF-VGKLTAVDRDIGRNAEL-----------SFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFL-RAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYS-----------LAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNA-SITIVVLDENDNAPEFTQSSSEVSVLETS----PTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDN 1483          

HSP 7 Score: 99.3673 bits (246), Expect = 1.254e-20
Identity = 153/651 (23.50%), Postives = 268/651 (41.17%), Query Frame = 3
Query:  195 DYEFIPK-FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN------------KD----NFSILSFAVIDQDALSFNEFHLNSSNNF----NMESFHLSSLT------------QSSGEIRIGNPLDREKSPR-YQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI--------LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW---IYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYE--LKAKHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNG--NPMRNSSANLTIIIYQQN 1985
            D E  P+ + +++ A  +G     S  K+ + ++D ND  P+F+   +   V EDL +G  I  + A D ++   G + + L+   D    F+ ++ ++G +IL   L      K  L +   D  ++   +      I + D N++ P              L    +Y  +I EN    ++V  I   D D G+N  +   + +        + +    LN  T    L  R  +D E+V + +   +  QDNGQP L +TI +  +VLD N+   +F   +YS  + EN            KD    N  ++ +++   D  S  EF ++S+       N++  H S+ T             S  E+       + +SPR YQ +       Q   + +S   V++++ D+ND VP ++      + EN   +  +  +   D D G N  I              K + +ED+     L          L+V  ++D E   +  ++I   D G P    +  +++ ILDENDN P +    Y +S+    +I       G  + +V A D D  ++ R+ Y   L  ++   SI   TG + + K++      +Y L ++  D    NP    +A LTI I   N
Sbjct: 1781 DREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHD--GKFL-LEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAY----ATIQVSDTNDNPP--------------LFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSD-------WANDVFSLNPQTGMLTLTAR--LDYEEVQHYI-LIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDS--EFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDY----------LMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASI-------GAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPA-GDTAELTINILDIN 2378          

HSP 8 Score: 98.9821 bits (245), Expect = 1.563e-20
Identity = 147/626 (23.48%), Postives = 260/626 (41.53%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL-IKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-LTVEAHDSAEHNSKF-----------------------DWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNG--QPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIP-SYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKIS---IIVNILDENDNEPEWIYPSSLDNVVNISHINIQSG--TKLTRVRAIDADSVSSNRLTYEL-KAKHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNG--NPMRNSSANLTII 1970
            + L +   D GQP   S   +VI +ID ND AP+F    +T  + E+    + + K+ A+DR+ G   ++ + L  + +DF     +ID  +G I   +P FD + L  ++  A  S E  S                         D   V + + DVN++ P            + L     Y + I E   E   ++ +   D DEG NGDV           +L   +   + N ++   +L + + +DRE  S  ++  I    +   +  L S   + + VLD+N+    FT+S+  +S++E     + ++ F   D D    ++   + S     ++FH+ S+T   G + +  PLD E    Y  +I   +        ++    +V+V+D NDN P +         +  IP    +  +  DD D G N ++S +        P  +       F I +E  ++   + +D E I   ++ +   D   P      +   + V + D NDN P ++   S++  +     +   G  T + +V A DADS S+  +TYE+     +   +   TG I+ T      +  +Y L L+ TD    +  R+S   +TII
Sbjct: 1119 YALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDF-----TIDTRNGFIKTLRP-FDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAP------------EFLRA--PYHVTISEGASEGTHITHVFTQDADEGLNGDV---------YYSLAKGNEAGQFNLDSATGQLSLGRRLDRE--SQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSIT---GSLYLHKPLDYEDITSYTLNITASDCG--TPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGR------HFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFV---SMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITII 1699          

HSP 9 Score: 86.2705 bits (212), Expect = 1.329e-16
Identity = 142/617 (23.01%), Postives = 257/617 (41.65%), Query Frame = 3
Query:  249 QPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIY--KLIKNEDFSTS---FVSIDGNSGTIILKKPLFDIDKL--------TLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNG-QPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN---KDNFSILSFAVIDQDALSFN---EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPK-NHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS-ISIDPFTGEISL-------TKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQS 1997
            Q +L S+ K+ I I D+NDE P F++ N T ++ E++A+ +V++ V A+D + G  G I Y  K  ++ED   S     S++   G + +      +D L         L + A D  E     + + ++I I+D N++ P   V   K+           Y   + EN      V  ++  D DEG NG ++  I            D     + +     +R+ ++++ E++S   + ++  +D   +     T  L +++LD N+    F  S Y   ++EN    +   +L+    D D    N    + L   ++       L  +  SSG+I +  PLDRE+   Y  ++  ++    +   T    V V V DINDN P +  +        N+PS   G  +      DKD G N+++  + L    +            F I SE   +    ++D E      + +   D    +   + +++ +++ D NDN P+  + S+  NV     I+   G  +   RA+D D   +  + Y +  +      I+  TG +S        TK  +   Y + +   D G    +S A LT+I+    +F +
Sbjct: 2144 QQRLSSTVKVTILIKDVNDEVPVFISANETAIM-ENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRV------VDALDRELRSSYLLNITARDRGEPPQSTE-SQLLIRILDENDNSP---VFDPKQ-----------YSASVAENASIGAMVLQVSATDVDEGANGRIRYSI---------VLGDQNHDFSISEDTGVVRVAKNLNYERLSR-YSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS------DLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTG--SPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPS---GTHVLTPRATDKDEGLNAKLRFNLLGEHMH-----------RFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPK--FDSTTYNVAVPERIS--KGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPT 2702          

HSP 10 Score: 78.9518 bits (193), Expect = 2.408e-14
Identity = 144/632 (22.78%), Postives = 257/632 (40.66%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED--FSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFII--DVNNHRP-----NISV-----GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--------QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLN--SSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSP-RYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP---EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIIIY 1976
            DYE I  + L + A D G P L ++    + ++D ND  P F +    + ++E + + + I+ V A D +SG  GK+ Y + K E          I+  +G I   + +    ID   LTV A D A+ + +   T  ++ +I  D+N++ P     N ++      + K +ST ++                      ++  D D   NG V  +I +    + LF      +L +NT         Q+K  +R  +  +     +       +     +  TII       ++  P    RS  S S+ EN+    SIL+  V    A +  E+ +   ++     +   L  +    G +     LDRE  P  Y+  ++ +  A      TS   V V VLD ND+ PQ++     + + E+    + +  L   D D       ++ S+T         + G++  F +      L +  ++D E     ++ I   D      + +    + + D NDN P   + +Y   +         N Q G ++ ++ A DAD   + +L+Y + +   +D  S++P TG ++LT  +   E   Y L +Q  DNG P    S + TI +Y
Sbjct: 1448 DYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQ---------------------VHAKDADSSSNGLVTYEIVSGP--QELF------KLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSE-----VYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILT--VTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAI--ALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD-------TLGSVTFLL------MDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPE-------NAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQP----SLSTTITVY 2014          

HSP 11 Score: 77.7962 bits (190), Expect = 5.465e-14
Identity = 137/631 (21.71%), Postives = 254/631 (40.25%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIA--CDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAV--GSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNG--QPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE--NKDNF--------------SILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP--QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP---EWIYPSSLDNVVNISHINIQSGTKLTR-VRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            +YE + ++ L + A  C +  P    + +L I+I+DIND  P F+   Y   V E+     G  +L V+A D ++      +   +K  D  +    I+ +SG I L KPL      + TLT+ A D+   +     T +V + + D+N++ P   + S              Y   + EN P    V      DKDEG N  ++  +    + +  F++DS           ++    ++DRE+ S   + ++  QD+   +P   S++ L + V D N+    F  + Y++++ E  +K  F              +++ + +  +D    + F +N+          L + T+S  ++               ++I +    Q     +S A ++V+ L   +  P   Y+    F M E+  P   + ++       G   +I  + +     G + ++  N  L  + +         +DYE  H  +I I   D   P   +   I +N+ D NDN P   + IY        N   +  +S  +L   V+A D DS  +  + Y L+   D       +GEI     +   E G Y   ++  D G P    +A++ + +  +N
Sbjct: 2342 NYERLSRYSLTVRAEDCALENPA-GDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGD--SDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTG--SPPLTGTGIVRVEVQDINDNDPVFELQS--------------YHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR--FHIDSETG--------EISTATTLDREETSV-YHLTLMAQDSSITEPR-ASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQ---HYFDINTKTGVVSTKLELKTKTKSHDDL--------------TYTIVISAMDQGEQSLSSKAELTVI-LRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYA-IAGGIMGDSLRVDPNSGLLSVGQ-------DGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIY--------NAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKN 2907          

HSP 12 Score: 73.1738 bits (178), Expect = 1.277e-12
Identity = 133/604 (22.02%), Postives = 237/604 (39.24%), Query Frame = 3
Query:  213 KFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLI---KNEDFSTSFVSIDGNSGTIILKKPL-FD-IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDRE-KVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDAD-SVSSNRLTYEL-KAKHDS-ISIDPFTGEISLTKDIEAGKYDLF---LQVTDNGNPMRNSSANLTIIIYQQN 1985
            ++ L + A D G P      ++VI +   N + P+F   +Y  +V E+  VGS IL V A D ++G  G + Y +    + +DFS     +D  +G I++++ L +D I +  L +   D   H        + I + DVN++ P             + N +  Y   I EN P    V   +  DKD  KN  +      +   ++ F ++       +   +    R+    + K  NP              ++S   L V VL  NE+   F +  +   + E       + +    D+D+      +     + N + F + +   ++G I +   LDRE   R   ++   N        T  A V + + D ND  P+++            P   +G  +   K I ++ R   +  + +      K S   D+    +   +     +D E      + I   D G P      ++ + + D NDN P +  P  L+  ++    N  +GT +  + A D D   +    TY+L   KH S +S+D  +G +  T   +     +    ++V D+G P + S   LTI +  QN
Sbjct: 3194 RYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFS-----VDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLS-SVAMLTIILTDVNDNPP-------------VFN-HKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNP-----------DSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDT---NTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP-PEFIKHYYTSTISEAAP---VGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDV----QTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFT-PEGLNGYISE---NEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQN 3751          

HSP 13 Score: 71.633 bits (174), Expect = 3.962e-12
Identity = 136/644 (21.12%), Postives = 265/644 (41.15%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIG-QPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKN-EDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVS----------FINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNP-LNFSINCQDNGQPLLKSTIILQV------DVLDQNEYPALFTRSNYSLSIIENKDN---------FSILSFAVIDQDALSFNEFHL---NSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF----ATVSVVVLDINDNVPQYV----GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFT-GEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E      L + A D G  P+   +Q  VI I+D NDEAP+F  +     + ED    +++  + A D + G  G + + L  + E       ++D  +G +  ++PL D +K++   ++V A D      +     V + + DVN++ P                 YP +++    ++ ++ ++            +   DKD+G N  ++ ++++    + LF LD+R           + +R          P     ++ +D GQ   +   I+++      ++L+  +  A      Y   ++E+ +            I+     +  A S  E+ +   + + NF +++         SG I    PLDRE+   Y+ +I   + +  +   +S       V++ ++D+NDN P +        +  + EN     E+      D+D G NSRIS  SLT     P ++       F I  +  +L +++ +  E      +++   D G P   +K+S+ V I D ND+ P + + S   ++   + +N    T+   + A D D   + R++YE+   +       F  G + +   +   E   Y L +   D G P R+S   + I +  +N
Sbjct:  558 DREIRDTVELSISARDGGPNPKFAYTQLKVI-ILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPL-DREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQF---------------YPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGG--EGLFQLDAR--------SGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQA----GGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDT--------RSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISY-SLTNN---PNQQ-------FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVN----TRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDEN 1147          

HSP 14 Score: 71.2478 bits (173), Expect = 4.651e-12
Identity = 139/621 (22.38%), Postives = 255/621 (41.06%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSA-EHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFH-LSSLTQSSGEIRIGNPLDRE-----KSPRYQFSIFVVNEAQDNTK--FTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYE---LGQLIF-----DDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHD--SISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            DYE    + + + A D   P L S   + +++ D ND AP      Y   V E+ +   +I  V A DR+SGD G +IY+L    DF  +F   +  SG I  +  L   +I      VEA D    H +      V++ ++D N++ P  +                ++ L + EN      V  +   D D G N +              F  +   +         + +   +DRE+    +   +   D      ++   + + + DQN+    F  S YS S  E + + +++   +    A   ++   NS  +++++    + S+  ++GE+     +  +     +SP   +++ V+  A DN K    S   V++ ++D ++N P+      FE  E   P  +    GQ I      D +D+G N  +  S +T   +  +   S      WI+ +K +QV  +  YE +      +   D G P   ++  +++ +  EN + P +    S+++   I   N   G+ +  V A D D+  +  L Y +   ++    S+D  TG I + + ++     +Y L + V D G    +S A LTII+   N
Sbjct: 2769 DYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRL--QNDFDGTFEITE--SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTG--TASVLLHLLDKNDNPPKFTR---------------LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYS----------FSENPGEKFRIEPQSGNITVAGHLDREQQDEYI-LKVVASDGA---WRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQII----ATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVL--ATDNGKPPLYSECLVNINIVDAHNNPPK------FEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMT---FNLSSIFSVGRHDGWITLVKPIQVPPNTRYELV------VRATDRGVPPQSDETRVVIVVTGENMDTPRF----SVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVN 3328          

HSP 15 Score: 66.2402 bits (160), Expect = 1.669e-10
Identity = 114/518 (22.01%), Postives = 202/518 (39.00%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKN--EDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDW---THVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKD-EGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSL---TQSSGEIRIGNPLDREKSPRYQFSIFVVNEA----QDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENS--RISISSLTTTCYGPTEKLSGNE--DLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP 1685
            D E I  +   + A D G P +  +  +++ ++D ND  PKF  + ++  V E+  +GS +++V + D + G      Y   +N  E F      I+  SG I +   L     D+  L V A D A       W   T + I I D N++ P                 +  Y     E       V  I   D+D +G N  +   +Q       +F +D      +   +  +R + S       N    ++   DNG+P L S  ++ ++++D +  P  F ++ Y   + ++      I+     D+  L  NE       ++++ +F+LSS+    +  G I +  P+    + RY+  +   +       D T+      V +VV   N + P++ V      + EN      +  +   D D G N   R SIS              GNE  D         + ++Q +DY+ I    ++I   D G+    +   + + + D NDN P
Sbjct: 2872 DREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT-RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFR-----IEPQSGNITVAGHLDREQQDEYILKVVASDGA-------WRAETPITITIQDQNDNAPEFE--------------HSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS---PMFSIDPAT--GEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEM------DYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETR------VVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISG-------------GNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPP 3332          

HSP 16 Score: 65.855 bits (159), Expect = 1.993e-10
Identity = 88/359 (24.51%), Postives = 152/359 (42.34%), Query Frame = 3
Query:  975 IILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALS---FNEFHLNSSNNFNMESFHLSSLTQSSGEIR------IGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFA--TVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFI---HNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP--EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADS----------VSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTI 1967
            I +++ VLD N+    F   + ++S  E+  + + +L  A  D D       +++ + + N  N   F L +    SG+         GN LDRE    YQ +I     A+D      F    V+V +LD+NDN P +     +  + E  +P   +  ++  D D+G+NS+I+     T       + + N +   IS  + +   Q  + +      +C   +   D G P+   +  + VN+LD ND++P   + +      V  +   N  +GT +  V   D+DS          VS N L +    +   + I    G +      E GKY+L +   D G P R ++A+L I
Sbjct:  140 IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDN--KFRLVTTANPSGDTSYLHLETTGN-LDRESRGSYQLNI----SARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETE-----HQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDE-NAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDRE---EIGKYNLTVVAMDQGTPARTTTAHLII 482          

HSP 17 Score: 63.1586 bits (152), Expect = 1.266e-9
Identity = 120/593 (20.24%), Postives = 238/593 (40.13%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFG-----KIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPAL-----FTRSNYSLSIIENKDNFSIL-SFAVIDQDA-----LSFNEFHLNSSNNFNMES---FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE---LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSI-----SIDPFTGEISLTKDIEAGK---YDLFLQVTDNGNPMRNSS 1952
            I ++D+ND +P+F   +      E    G+ +L   A D + G+ G     +I+   + N+    +  +  G++  + L+    ++D+ +     L + A D      +F +  V + I+DVN++ P I   SD             Y + + E       V  +   D D G N  +   +  T   ++ F ++    +   T +     + ++          F++  +D+G P       + V++LD N++  +     F       ++ EN  N +++ + AV D D+      S      N   +F +E     H+         +R+   LDRE+  +Y  ++  ++  Q     T+ A + + V D+ND+ P +     S  + E       +  +   D+D G N+++             + LSGNE L W S      ++     +D E     ++ I   D G         + V ILDEND  P++   S  +  V +   +    T +  + A D D  ++  +T+ L    + +     ++D  TG+++  + ++  K   Y++ +   D G P   S+
Sbjct:  144 IKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLET-TGNLDRESRGSYQLNISARDGGSP-PRFGYLQVNVTILDVNDN-PPIFDHSD-------------YNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAET---EHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHI---------VRVNGVLDREEIGKYNLTVVAMD--QGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHY-----------DILSGNE-LKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQF---SQREQNVTLGE-DAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSA 690          

HSP 18 Score: 52.373 bits (124), Expect = 2.515e-6
Identity = 60/238 (25.21%), Postives = 106/238 (44.54%), Query Frame = 3
Query: 1176 SLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDI 1886
            +L   +GE++    LDRE   R  + + V++     ++ T    V + VLD+NDN P++    ++    E+      L      D D+GEN       +         +L    +    +    L+   ++D E   + +++I   D G P     + + V ILD NDN P  I+  S D  V+++   +  GT +  V A D D   ++++TY L       +++P TG IS T+ +
Sbjct:  104 TLDPVTGEVKTNVVLDREGM-RDHYDLVVLS-----SQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPP--IFDHS-DYNVSLNETAL-PGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERV 331          
BLAST of Protocadherin vs. Ensembl Fly
Match: Cad87A (gene:FBgn0037963 transcript:FBtr0082513)

HSP 1 Score: 112.464 bits (280), Expect = 1.068e-24
Identity = 159/644 (24.69%), Postives = 272/644 (42.24%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILK-KPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINV--VDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDN-GQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-----NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED-LFWISELKI-LQVKQSMDYE--------FIHNCKIDIHFHDE--------GFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADS----------VSSNRLTYELKAKHDSISIDPFT----GEIS---LTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIY 1976
            DYE + +   Q+   D G P L ++  +V+DII++ND  PKF   +Y   V E+   G+V  KV A D + G FG+I Y LI   +    + SID  +G +++    + D   I +LTL+V A D A    +   T  + I I+DVN++ P  +                +Y   + EN       + + V  +D+DEG  GDV+  I     +  LF LD++  +        +   QS+  +  +  L  +I+ +D  G   ++ST    + VL  N +   F     S + IE      + ++ +L+   +D D     +  +HL   NN N +      + + +GE+R    L+R+   R  + I +V     N  F S   +SV ++D N+N P++          +N     + +    D  IG     S S      +     L GNED  F++ +L   +   +S+D E         + + K D+H  +E           +++    + + +LD NDN P +  P     V    + N + G  +T V A DAD           V+SN   +       SI   PF     G IS   +  +    +++L +   +   P  ++S  + I ++
Sbjct: 1062 DYEVVKEVKFQVTVSDTGVPALTATADVVVDIINLNDNDPKFSQSDYYFNVTENSPRGTVAGKVEAHDGDVGVFGEITYTLIGENN---KYFSIDAYTGNVMVANSSILDREQIKELTLSVVAQDKAPAAVQKSATATIHINILDVNDNAPVFT--------------RDVYNSTVAENAAYQPPAALLQVQAIDQDEGLYGDVRYIITAGNEM-GLFKLDAQSGI--------VYPAQSLSGKHGAYEL--TISARDTQGSGTMESTTKAIITVLRVNRHKPEFVIPALSNATIEIPGDIVQPDYLLLTVRAMDNDTEENGKVSYHLQ-VNNRNEQQTGEFKIDEVTGELRAKTQLNRKN--RANYDIILVARDAGNPPFESLRLLSVSIVDANENRPEF-------PDASNPYKVSINENSGRDVKIGHIQAASRSKHNRDIF--YYMLLGNEDGAFYVDKLTGDIYTNKSLDREETDVYTLYILASIKADLHISEEERASFSIKTLNRDNTVAKVAITVLDVNDNPPVFEKPIYYAGV----NANAKMGAAITLVNATDADQGKNAKIEFMIVASNLYKFGATKSTGSIVPSPFAISQDGRISANTIMAEYNQDRFELEIVARELEQPQSSASTKVNIWVF 1661          

HSP 2 Score: 95.9005 bits (237), Expect = 1.373e-19
Identity = 142/635 (22.36%), Postives = 261/635 (41.10%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIY-------------KLIKNEDFSTSFVSIDGNSGTII---LKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVG---SDKRTSTQLLNGYPI-YFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNE--FHLNSSNN--FNMESFHLSSLTQSSGEIRIGNP--LDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNI--PSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKL--SGNE-DLFWI-SELKILQVKQSMDYEFIHNC-KIDIHFHD-EGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA------KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            + LQ+ A D G P L  +  L I++ + ND+ P FV       V+ D   G ++  + A+D +  +   + +             K + + D    +  I  N    +   L + LF + ++ + V   DS   N +     ++I IIDVN + P  +        +   Q++   P+   L   + N E+  +   N+ D D           QT+ ++  +  LD                       +V   + F +   D G P L +T  + VD+++ N+    F++S+Y  ++ EN    ++       D D   F E  + L   NN  F+++++        +G + + N   LDRE+      S+   ++A    + ++ AT+ + +LD+NDN P +   + +  + EN    P   L Q+   D+D G              YG    +  +GNE  LF + ++  I+   QS+  +  H   ++ I   D +G     +    I+ +L  N ++PE++ P+  +  + I    +Q    L  VRA+D D+  + +++Y L+       +     ID  TGE+     +       YD+ L   D GNP   S   L++ I   N
Sbjct:  844 YQLQIQASDQGTPSLTGTATLTINVQNSNDKDPYFVPATQHAEVRADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPHYDQFKEYFKISRNGKVSVNKQLDRNLFAVMRINVLVT--DSTAPNVQQGRGLLIIQIIDVNKNPPRFNAPWSVEQPQIKLQMVEEQPVGTVLTTLQANDEDSSIGEFNISDND------YFAINQTSGMIYTIARLDY----------------------EVVKEVKFQVTVSDTGVPALTATADVVVDIINLNDNDPKFSQSDYYFNVTENSPRGTVAGKVEAHDGDVGVFGEITYTLIGENNKYFSIDAY--------TGNVMVANSSILDREQIKELTLSVVAQDKAPAAVQKSATATIHINILDVNDNAPVFTRDVYNSTVAENAAYQPPAALLQVQAIDQDEG-------------LYGDVRYIITAGNEMGLFKLDAQSGIVYPAQSLSGK--HGAYELTISARDTQGSGTMESTTKAIITVLRVNRHKPEFVIPALSNATIEIPGDIVQPDYLLLTVRAMDNDTEENGKVSYHLQVNNRNEQQTGEFKIDEVTGELRAKTQLNRKNRANYDIILVARDAGNPPFESLRLLSVSIVDAN 1425          

HSP 3 Score: 88.5817 bits (218), Expect = 2.069e-17
Identity = 132/582 (22.68%), Postives = 227/582 (39.00%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKK-PLFDI-----DKLTLTVEAHDS--AEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSIL-SFAVIDQDALSFNEFHLNSSNNF---NMESFHLSSLTQ--------SSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFE---MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS-ISIDPFTGEI 1868
            DYE    + L   A D       S   L I + D ND  P   +  Y   V E   V    L V A  R++    +I Y++  +E   + F  ID  +G II++     D+     D+L   VEA+D     H        V I + DVNNH PN    S              Y   + EN+     V  ++  D D GKN +++ +IQ                + + T +  +  +   DR    N     I   D G P L  T  L ++V + N+    F  +     +  +     ++ +   +D D  + N      +++    + E   L    Q         +G++ +   LDR      + ++ V +    N +      + + ++D+N N P++    S E   +K   +    +G ++   +   E+S I   +++   Y    + SG   ++ I+ L         DYE +   K  +   D G P       ++V+I++ NDN+P++   S  D   N++  N   GT   +V A D D      +TY L  +++   SID +TG +
Sbjct:  628 DYESETTYFLSYKATDDNGRGSASVVSLRISVTDANDSPPVCESPLYRASVDEGAVVFDSPLIVKA--RDADTMSRISYRIRGSEQVESIF-DIDRETGQIIIRPNATLDVTNLNSDQLIFAVEANDGLFTAH------CGVNITVRDVNNHVPNFEQQS--------------YSAVVEENSEIGTSVERVHATDLDTGKNAELRYRIQQGSF--------DDFGIVETTGEVFVSRKLDFDRR---NTYQLQIQASDQGTPSLTGTATLTINVQNSNDKDPYFVPATQHAEVRADAPPGQLVYTLIALDPDVANHNALEFAGTDDITAIDKEGKELPHYDQFKEYFKISRNGKVSVNKQLDRNLFAVMRINVLVTDSTAPNVQ-QGRGLLIIQIIDVNKNPPRFNAPWSVEQPQIKLQMVEEQPVGTVLTTLQANDEDSSIGEFNISDNDYFAINQTSGM--IYTIARL---------DYEVVKEVKFQVTVSDTGVPALTATADVVVDIINLNDNDPKF---SQSDYYFNVTE-NSPRGTVAGKVEAHDGDVGVFGEITYTLIGENNKYFSIDAYTGNV 1159          

HSP 4 Score: 66.6254 bits (161), Expect = 1.318e-10
Identity = 106/409 (25.92%), Postives = 178/409 (43.52%), Query Frame = 3
Query:  288 IIDINDEAPKFVAKNYTKVVQEDLAVGSVIL-KVHAIDR----ESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGS---DKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNP---LNFSINCQD--NG----QPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSF--AVIDQDALSFNEFHL---NSSNNFNMESFHLSSLTQSSGEIRIGN-PLDREKSPRYQFSIFVVNEAQD-NTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIG 1439
            I+D+ND  P+F    Y   V ED AVG+ I  K+   DR    ES D  K + +    E      + I     TI           L   V  +D+  +N +  + H  I   D   H+   +  +   D +    +  G     ++  E++P N  V  ++  D D G+   +   ++T     + F LD++          +LR  + +DRE + +    ++  I  ++  NG     PL  +T    V + D N+ P +F    YS+S++EN    + L+   +V D D    ++F L   + S  F++E   ++  +Q +  IR+ N  LD E   + +F + VV E  D N + +S AT++V VLD NDN P +     S  + E  +P   +  +   D D G
Sbjct:  122 ILDLNDNPPEFQNTPYEADVNEDAAVGTTIFDKITVKDRDIVGESLDL-KCLPQQQSPEACRKFRLHIIKRDATI-----------LEAAVVLNDTLNYNQRMVY-HFQIEATD-GPHKTQTTFEARVKDVQDKPPVFQGSLSTVID--EDSPINTLVLTVHARDGDTGEPRKIVYDLRTNP--NDYFLLDAQTG--------ELRTAKPLDREALEDSTGIISLVIRARELVNGVPSDDPLTSATAKATVTIRDVNDSPPVFNHKEYSVSLLENTLPGTPLALDMSVSDADVGINSKFALRLDDVSGVFDVEPKLVTGYSQVN--IRVANGTLDYENPNQRKFIVLVVAEETDTNPRLSSTATITVSVLDANDNKPVFEQESYSASVSEAALPGQYIATITARDVDSG 502          

HSP 5 Score: 58.151 bits (139), Expect = 4.486e-8
Identity = 114/495 (23.03%), Postives = 198/495 (40.00%), Query Frame = 3
Query:  342 VVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVV-----IFIIDVNNHRPNIS-------VGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKD-EGKNGDVKCQIQTTK-----------LLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD---NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQ--------DNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELG-QLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDL-----FWISELKILQVKQSMDYEFIHNCK---IDIHFHDEGFPKNHNKISIIVNILDENDNEP 1685
            ++ E++ VG+V+ ++ A D E      + Y  I  + FS     +D  SG I L KPL   + D L   V   D  +   + +  +VV       I+D+N++ P          V  D    T + +                     I V D+D  G++ D+KC  Q              + ++   L++ + LN +T  Y  R+             +F I   D      K+    +  V D  + P +F     SLS + ++D   N  +L+    D D     +   +   N N + F L + T   GE+R   PLDRE        I +V  A+        D+   ++ A  +V + D+ND+ P +  +  S  + EN +P   L   +   D D+G NS+ ++           + +SG  D+        S++ I     ++DYE  +  K   + +    +  P+  +  +I V++LD NDN+P
Sbjct:   35 ILYENVTVGTVVFRLEAYDPEGS---PVTYGAIGADHFS-----VDPVSGNITLIKPLDREEKDTLKFLVSIRDRVDPEGESERDNVVEVPITFIILDLNDNPPEFQNTPYEADVNEDAAVGTTIFDK--------------------ITVKDRDIVGESLDLKCLPQQQSPEACRKFRLHIIKRDATILEAAVVLN-DTLNYNQRMV-----------YHFQIEATDGPH---KTQTTFEARVKDVQDKPPVF---QGSLSTVIDEDSPINTLVLTVHARDGDTGEPRKIVYDLRTNPN-DYFLLDAQT---GELRTAKPLDREALEDSTGIISLVIRARELVNGVPSDDPLTSATAKATVTIRDVNDSPPVFNHKEYSVSLLENTLPGTPLALDMSVSDADVGINSKFALR---------LDDVSGVFDVEPKLVTGYSQVNIRVANGTLDYENPNQRKFIVLVVAEETDTNPRLSSTATITVSVLDANDNKP 470          
BLAST of Protocadherin vs. Ensembl Fly
Match: Cad74A (gene:FBgn0036715 transcript:FBtr0075240)

HSP 1 Score: 108.997 bits (271), Expect = 3.126e-24
Identity = 114/448 (25.45%), Postives = 202/448 (45.09%), Query Frame = 3
Query:   96 YHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACD-IGQPQLC--SSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKL---TLTVEAHDSAEHNSKFDW----THVVIFIIDV--NNHRP---NISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTR----SNYSLSIIENKDNFSILS-FAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFT---------SFATVSVVVLDINDNVPQY 1352
            YH ++   Q  H   F +N T   + +   +++D E  P+  LQ+ A D  G+P     S  +L I+++D+ND AP+F  K Y+ V+ E+  + S +L++ A+D + G  G++ Y+L+ NE  +     ID  SG I  ++ L    +     L V A D+     K       T V I+I DV  N+  P   +  VG     +   + G P++  ++  ++P           D +   +G +  +I         F +D+   L        +  RQS+DRE   +     +   DNGQP   +T ILQ+ +LD +++   F R       S+S+ E +   +I+  F+ +D+D            +  N + F +    +S   ++   P+DRE+   +  +I  +   +   KF          S   ++V VLDI+DN+P++
Sbjct: 1093 YHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPRIQLQIKAEDSPGRPTDAKQSVVELQIEVLDVNDNAPEFTQKKYSTVIPENAQIDSFVLQLEAVDADEGLGGEVRYELV-NEGEANGLFKIDTKSGLISTRRNLTGKGRAHPYVLIVRAQDNGNQMPKQPTLSTDTDVRIYIGDVSANDGVPYFLSPRVGQMANVTENAVTGAPVF--QVIASDP-----------DDESTPSGTITYRILPDTPDAEAFVIDAHSGL--------ITTRQSMDRE-TKDMYRILLEVSDNGQPKQSATRILQIAILDVDDHEPRFAREADAGPLSMSVREEEPAGTIVGNFSALDEDLGENAAIDYVIIDGNNEQLFTIERNNESLAILKTKKPIDREQVESFTLTIKCLKLGEPGYKFIGDPYDRQDLSHLRINVRVLDIDDNLPKF 1517          

HSP 2 Score: 23.483 bits (49), Expect = 3.126e-24
Identity = 8/21 (38.10%), Postives = 15/21 (71.43%), Query Frame = 1
Query:    7 DINDNSPKFQKLERHFKILES 69
            ++NDNSP+F++      I+E+
Sbjct: 1045 NVNDNSPRFERNSYQATIIEN 1065          

HSP 3 Score: 99.7525 bits (247), Expect = 7.283e-21
Identity = 151/643 (23.48%), Postives = 264/643 (41.06%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIG-QPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFG--KIIYKLIKNEDFST-SFVSI-DGNSGTIILK---KPL---------------FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQ-LLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPL-NFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFA-VIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFD----------DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI----SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI-----------NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLT------KDIEAGKYDLFLQVTDNGNPMRNSS 1952
            D+E  P ++L + A D     +L S   + I++IDI D+ P F    Y+  V E+   G  IL V A+D   GD G  + I+  +++E F     V   D   GT +L+   +PL               F I + T  ++    AEH+     T V I + DV++H+P  S      + T+ L NG P+  L IF             V D+D G+N   +  ++       +F +       +     K+     +D + V   L  F  +   + + + K+   +++ +LD N+   +F +  Y  +  EN    +I+      D D+  F          F  ++F+++  T   G + +  PLD EK   Y  ++  ++  Q       F    V V D+NDN P      +FE KE +    E G  +F+          D     N R+  S ++         ++GN  +F I     E+ I +  +SMD E     ++ +   D G P   N   ++V +    +  P  I+     N+ N+  I           N  +G+ +T V A D D + S  L Y +   +D+  ID  +G I+++      +D     +++ +   D+G P+  ++
Sbjct:  203 DFESRPSYILTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVD---GDVGIPREIFLSLEDEPFGHFELVPFGDPRDGTAVLQTTSEPLDRENAEILQNGGVYVFSI-RATELIDGAIPAEHS----LTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIF-------------VDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDLVASVKGVEKAKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEFGHVRY-VLKGFGADNFYVNPET---GGVYLLKPLDYEKQSSYSLTVVAIDGGQREANANLF----VGVTDVNDNHP------NFESKEYSRTIRE-GAALFEPQFFVRAHDADGPSQGNGRVKYSIVSENS------IAGN--VFRIEPDTGEIVIQKAARSMDTER-GEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRP--IFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDS-LLRYRIVGANDNFEIDEISGLITVSPQARIDRDSNMNSFEIIVNAVDSGTPIPETA 797          

HSP 4 Score: 92.4337 bits (228), Expect = 1.447e-18
Identity = 134/588 (22.79%), Postives = 251/588 (42.69%), Query Frame = 3
Query:  195 DYEFI----PKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDR--------ESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDID-----KLTLTVEAHDSAEH--NSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEV-SFI---NVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNG-----QPLLKSTIILQVDVLDQNE--------YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-----VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE----LKILQVKQSMDYEFIHNCKIDIHFHDEGFP-----------KNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADS 1790
            DYE +    P+F LQ+ A    + Q  +  ++ I + ++ND +P+F   +Y   + E+      +++V A+D+        E   + KIIY L   +        I+  +G II+      ID     ++ L ++A DS     ++K     + I ++DVN++ P     + K+ ST +               PEN ++ SF+     VD DEG  G+V+ ++        LF +D++  L        +  R+++  +  ++P    +  QDNG     QP L +   +++ + D +          P +   +N + + +     F +++    D+   S    +    +  + E+F + +    SG I     +DRE    Y+  + V +  Q     T    + + +LD++D+ P++      G +S  ++E       +G     D+D+GEN+ I    +             NE LF I      L IL+ K+ +D E + +  + I     G P           ++ + + I V +LD +DN P++  P   D  V I  IN+   T +T ++A DAD+
Sbjct: 1009 DYEALGDTGPEFELQVRANSADR-QRSTVSRVNITVENVNDNSPRFERNSYQATIIENRPHPERVIRVRALDKDAVLNARDERLGYHKIIYSL---QGEHAMLFDINNTTGEIIVASGQ-TIDRERTPRIQLQIKAEDSPGRPTDAKQSVVELQIEVLDVNDNAPEF---TQKKYSTVI---------------PENAQIDSFVLQLEAVDADEGLGGEVRYELVNEGEANGLFKIDTKSGL--------ISTRRNLTGKGRAHPYVLIVRAQDNGNQMPKQPTLSTDTDVRIYIGDVSANDGVPYFLSPRVGQMANVTENAVTGAPVFQVIASDPDDESTPSGTITYRILPDTPDAEAFVIDA---HSGLITTRQSMDRETKDMYRILLEVSDNGQPKQSATRI--LQIAILDVDDHEPRFAREADAGPLSMSVREEEPAGTIVGNFSALDEDLGENAAIDYVIID----------GNNEQLFTIERNNESLAILKTKKPIDREQVESFTLTIKCLKLGEPGYKFIGDPYDRQDLSHLRINVRVLDIDDNLPKFEQP---DPTVGI-RINVPIDTVVTTLKASDADA 1546          

HSP 5 Score: 86.6557 bits (213), Expect = 8.803e-17
Identity = 144/592 (24.32%), Postives = 259/592 (43.75%), Query Frame = 3
Query:  345 VQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWT--HVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSF---INVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNG-QPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSN----NFNMESFH----LSSLTQSSGEIRIGNPLDREKSP------RYQFSIFVVNEAQDNTKFT--SFATVSVVVLDINDNVPQYVG-RMSFEMKENNIPSYEL-GQLIF-DDKDIGENSRISIS------SLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFI----HNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP---EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA-KHDSISIDPFTGEISLTKDIEAGK---YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            + E+  VGS + ++   D E G   ++ Y +      S    S+D  +G + L++ L     D + + +   D   + ++ +      VI + D N+++P                G P Y   + E+ P   E+S    I VVD+DEG N +V+ +      + ++F + + ++++   Y  ++ ++Q +D E   + +  +I+  D+     L S   + ++V+D  + P +FT + YS ++ EN     SIL+   +D D     E  L+  +    +F +  F      +++ Q++ E     PLDRE +        Y FSI    E  D       S   V++VV D++D+ P + G   +  + EN      L G  IF DD+D+GENSR  +S      +       PTE   G   +     +K+L   + +DY+ +       + D+    +G  K   ++ I  ++LD NDN P   +  Y  +    + +  I       +  V+A D DS     + Y LK    D+  ++P TG + L K ++  K   Y L +   D G   R ++ANL + +   N
Sbjct:   36 LSENTPVGSPVFQLKGTDPEGG---RLKYSI------SGPVFSVDRETGVVRLRQELDRETQDTVEVIISITDEGIYGTEPNTVSQRRVIPVRDYNDNQPTFL-------------GRP-YTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVRA-VKISDGNYTARVALKQQLDFESRPSYI-LTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLEDEPFGHFELVPFGDPRDGTAVLQTTSE-----PLDRENAEILQNGGVYVFSIR-ATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTES-QGRTPVV----VKVLNASR-LDYDVVDPDLRKFEFDLVASVKGVEKAKTRVEI--HLLDANDNAPVFDQGTYRFTAAENLPVDAI-------IGHVKATDLDSGEFGHVRYVLKGFGADNFYVNPETGGVYLLKPLDYEKQSSYSLTVVAIDGGQ--REANANLFVGVTDVN 579          

HSP 6 Score: 84.3445 bits (207), Expect = 4.412e-16
Identity = 148/608 (24.34%), Postives = 237/608 (38.98%), Query Frame = 3
Query:  267 SQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVG---SVILKVHAIDRESGDFGKIIYKLIKNED----FSTSFVSI-DGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKL--LKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLN-----FSINCQ---DNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDN---FSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRI------GNPLDRE-KSP---RYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTR----VRAIDADSVS--SNRLTYELKAKHDSIS-----IDPFTGEISLTK-----DIEAGKYDLFLQVTDNGNP 1937
            SQ+ VI + D ND  P F+ + YT  V E L VG   SV   +  +DR+ G   ++  K ++  D    F    V I DGN    +  K   D +      LT+ A DSA  N       + I +ID+ +  P             +    P Y   + EN P    +  +  VD D G   ++   ++       + + + D R     +         + +DRE      N     FSI      D   P   S   + + V D +++   F+  ++++SI EN  N      LS  V D+D    + + L+  + FN       S T+S G   +       + LD +   P   +++F +    +  +  K      V + +LD NDN P +  G   F   EN      +G +   D D GE   +              K  G ++ +   E   + + + +DYE   +  + +   D G  +     ++ V + D NDN P +                I+ G  L      VRA DAD  S  + R+ Y +    +SI+     I+P TGEI + K     D E G+Y+L +  TD G P
Sbjct:  111 SQRRVIPVRDYNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVRAVKISDGNYTARVALKQQLDFESRPSYILTISASDSALDNRLSSLATISINVIDIQDQPP-------------IFTNAP-YSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLEDEPFGHFELVPFGDPR-----DGTAVLQTTSEPLDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDLVASVKGVEKAK----TRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEFGHVRY----------VLKGFGADNFYVNPETGGVYLLKPLDYEKQSSYSLTVVAIDGG--QREANANLFVGVTDVNDNHPNFESKE--------YSRTIREGAALFEPQFFVRAHDADGPSQGNGRVKYSI-VSENSIAGNVFRIEPDTGEIVIQKAARSMDTERGEYELVVSATDFGIP 674          

HSP 7 Score: 69.3218 bits (168), Expect = 1.500e-11
Identity = 107/402 (26.62%), Postives = 173/402 (43.03%), Query Frame = 3
Query:  213 KFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQT-TKLLKNLFYLDSRMRLNKNTYQYKL-RIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDV-LDQNEYP------------ALFTRSNYSLSIIENKDNFS-ILSFAVIDQDAL-SFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKF--TSFATVSVVVLDINDNVPQY 1352
            KF   L+A   G  +  +  ++ I ++D ND AP F    Y     E+L V ++I  V A D +SG+FG + Y L   + F      ++  +G + L KPL D +K    +LTV A D  +  +     ++ + + DVN++ PN      K  S  +  G  ++  + F    +          D     NG VK  I +   +  N+F      R+  +T +  + +  +S+D E+        ++  D G P L +T  + V V +  N+ P             +    +Y +SI EN    S + S +  D D L S   + +  +N+ N E   +S L   S + RI    DR+ S    F I +VN     T    T+  TV V V DIND  P++
Sbjct:  450 KFEFDLVASVKGVEK--AKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEFGHVRYVL---KGFGADNFYVNPETGGVYLLKPL-DYEKQSSYSLTVVAIDGGQREAN---ANLFVGVTDVNDNHPNF---ESKEYSRTIREGAALFEPQFFVRAHD---------ADGPSQGNGRVKYSIVSENSIAGNVF------RIEPDTGEIVIQKAARSMDTER--GEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDSLLRYRIVGAND-NFEIDEISGLITVSPQARI----DRD-SNMNSFEI-IVNAVDSGTPIPETATTTVYVNVKDINDERPKF 815          

HSP 8 Score: 58.9214 bits (141), Expect = 2.692e-8
Identity = 112/428 (26.17%), Postives = 179/428 (41.82%), Query Frame = 3
Query:  486 SGTIILKKPLFDIDKLT-------LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRM-RLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDN-GQP--LLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK--DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN----TKFTSFAT---VSVVVLDI--NDNVPQY----VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW 1691
            +G +ILKK L D + L        L V A+ +    S    + V I + +VN++ P     S              Y   I EN P    V  +  +DKD   N   + ++   K++ +L    + +  +N  T +  +   Q+IDRE+    +   I  +D+ G+P    +S + LQ++VLD N+    FT+  YS  I EN   D+F +L    +D D     E      N    E+  L  +   SG I     L  +   R    + +V  AQDN     K  + +T   V + + D+  ND VP +    VG+M+  + EN +    + Q+I  D D  + S  S     T  Y         E     +   ++  +QSMD E     +I +   D G PK      + + ILD +D+EP +
Sbjct:  999 TGEVILKKRL-DYEALGDTGPEFELQVRANSADRQRSTV--SRVNITVENVNDNSPRFERNS--------------YQATIIENRPHPERVIRVRALDKDAVLNARDE-RLGYHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPR-IQLQIKAEDSPGRPTDAKQSVVELQIEVLDVNDNAPEFTQKKYSTVIPENAQIDSF-VLQLEAVDADEGLGGEVRYELVNE--GEANGLFKIDTKSGLISTRRNLTGKG--RAHPYVLIV-RAQDNGNQMPKQPTLSTDTDVRIYIGDVSANDGVPYFLSPRVGQMA-NVTENAVTGAPVFQVIASDPD--DESTPS----GTITYRILPDTPDAEAFVIDAHSGLITTRQSMDRETKDMYRILLEVSDNGQPKQSATRILQIAILDVDDHEPRF 1394          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 186.037 bits (471), Expect = 1.204e-47
Identity = 179/603 (29.68%), Postives = 284/603 (47.10%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISV-GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L + A D G P   SS  L + I D ND APKF   +Y   V E+  +G  +L+V A D + G  G+I Y L +  D     + ID +SG I +K PL   +I+ L   V A D    + K   T+V I + D N++ P + + G    T +  +         I E+ P    V+ + V DKDEG+N  V C +      +     DS +    N  +Y L+    +D E+V +     I   D+G P L ST  L+V V D N+   +F+ + + +   E N+    ++   V+  DA S     L  S   +  +  L  +  +SGE+R  +PLDRE   RY+F +   ++   + + T  ATV + VLD NDN P+++    SF + EN  P   +G +   D D GEN+++ +S          +  +G      +S +   + K+S  Y F       +   D G P   + + + +N+LDENDN P    PS+  + + +S +     + +  V A D DS S+  L Y +     HD   I P  GEI+LTK++    +G + L ++V+D G P R++ A + I +
Sbjct:  202 DRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGP-SPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGV-------ANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSV---DNKRKYFLQTTTPLDYERVRD-YRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVE--VVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGT----ILSSISFDREKES-SYTF------RLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFIRLSPMAAPD-SVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYV 775          

HSP 2 Score: 103.605 bits (257), Expect = 6.380e-22
Identity = 144/578 (24.91%), Postives = 239/578 (41.35%), Query Frame = 3
Query:  360 AVGSVILKVH------------AIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIID-VNNHRPNISVGSDKRTSTQLLN------GYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP----QYVGRMSFEMKENNIPS-YELGQLI----FDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS---ISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            AVG ++ +VH            A D+   D G + YKL    +    ++ +DG +G I   +    ID+ TL         +  K  +    + + D + N  P +  G   R   Q +N        P+  L + EN       S     DKD  +NG     +        LF L  ++  ++     +L +  S+DRE + +  + +I   D G P   S+ +L+V + D N+    F +S+Y   + EN     S+L     D D     E         +     L  + +SSG I +  PLDRE+    +F  +VV   +  +  +S   VS+ V D NDN P    + +G ++      NI     +G  +      DKD GEN+ ++        +    +L    D    ++ K  LQ    +DYE + + +++I   D G P   +  S+ V + D NDN P  I+  +L   V  +  N Q G K+  V A DADS ++  L Y + A   +     IDP +GE+     ++     +Y+  +   D G P    +A + I +  +N
Sbjct:   21 AVGGILYRVHEEQPPSTLIGSLAADQGLPDTGHL-YKL----EVGAPYLRVDGKTGDIFTTE--IPIDRETLK-----DCRNKGKPCFLEFEVSVTDLIQNQSPRLIEG---RIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGL--QVAEDRGEKLPQLIVLGSLDRE-LKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVP-KLLRIDRSSGIIYVKGPLDREEINNLKF--YVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPF----QLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSP--IFSPTLFE-VEFAEEN-QPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRN 569          

HSP 3 Score: 98.2117 bits (243), Expect = 2.418e-20
Identity = 137/600 (22.83%), Postives = 250/600 (41.67%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-VSIDGNSGT-----IILKKPLFDI-DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPA-------LFTRSNYSLSIIENKDNFSILSFA-VIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I++ DIND  P+F +   T  V E+  +G++     A D+++   G   Y L    +    F + +  + G      I+L     ++ D   LT++A D   +  ++    + + I D N++ P     S              Y  E+ EN+P    V  +   D D G NG+++  + Q    +  L  +D    +        + ++  +DRE+++N L F +  +D G     S   + +DV DQN+  PA       L T S+   +I E+    + ++   V D+D     E  + +        F L   + SS +      ++   PLD E+   Y+  I  V+    N   +S  ++ V V D NDN P +   +   E  E N P  ++ +++  D D G N+ +  S +           S    LF I      ++ +  +D E     +  +   D+G P +    ++++ +LD NDN+P+++      S L+N+  +S + +        V   D D   + ++   ++       I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGG-NPPRYSSALLRVVIADANDNAPKFEKSS--------------YEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGI--------IYVKGPLDREEINN-LKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDE---GENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSG--NPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIAD---------SSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGM--------VTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDEN 672          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 185.267 bits (469), Expect = 1.590e-47
Identity = 179/603 (29.68%), Postives = 283/603 (46.93%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISV-GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L + A D G P   SS  L + I D ND APKF   +Y   V E+  +G  +L+V A D + G  G+I Y L +  D     + ID +SG I +K PL   +I+ L   V A D    + K   T+V I + D N++ P + + G    T +  +         I E+ P    V+ + V DKDEG+N  V C +      +     DS +    N  +Y L+    +D E+V +     I   D+G P L ST  L+V V D N+   +F+ + + +   E N+    ++   V+  DA S     L  S   +  +  L  +  +SGE+R  +PLDRE   RY+F +   ++   + + T  ATV + VLD NDN P+++    SF + EN  P   +G +   D D GEN+++ +S          +  +G      +S +   + K+S  Y F       +   D G P   + + + +N+LDENDN P    PS+  + + +S +       +  V A D DS S+  L Y +     HD   I P  GEI+LTK++    +G + L ++V+D G P R++ A + I +
Sbjct:  202 DRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGP-SPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGV-------ANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSV---DNKRKYFLQTTTPLDYERVRD-YRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVE--VVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGT----ILSSISFDREKES-SYTF------RLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFIRLSPMAAPDSV-VEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYV 775          

HSP 2 Score: 102.834 bits (255), Expect = 8.891e-22
Identity = 144/578 (24.91%), Postives = 239/578 (41.35%), Query Frame = 3
Query:  360 AVGSVILKVH------------AIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIID-VNNHRPNISVGSDKRTSTQLLN------GYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP----QYVGRMSFEMKENNIPS-YELGQLI----FDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS---ISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            AVG ++ +VH            A D+   D G + YKL    +    ++ +DG +G I   +    ID+ TL         +  K  +    + + D + N  P +  G   R   Q +N        P+  L + EN       S     DKD  +NG     +        LF L  ++  ++     +L +  S+DRE + +  + +I   D G P   S+ +L+V + D N+    F +S+Y   + EN     S+L     D D     E         +     L  + +SSG I +  PLDRE+    +F  +VV   +  +  +S   VS+ V D NDN P    + +G ++      NI     +G  +      DKD GEN+ ++        +    +L    D    ++ K  LQ    +DYE + + +++I   D G P   +  S+ V + D NDN P  I+  +L   V  +  N Q G K+  V A DADS ++  L Y + A   +     IDP +GE+     ++     +Y+  +   D G P    +A + I +  +N
Sbjct:   21 AVGGILYRVHEEQPPSTLIGSLAADQGLPDTGHL-YKL----EVGAPYLRVDGKTGDIFTTE--IPIDRETLK-----DCRNKGKPCFLEFEVSVTDLIQNQSPRLIEG---RIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGL--QVAEDRGEKLPQLIVLGSLDRE-LKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVP-KLLRIDRSSGIIYVKGPLDREEINNLKF--YVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPF----QLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSP--IFSPTLFE-VEFAEEN-QPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRN 569          

HSP 3 Score: 97.0561 bits (240), Expect = 5.034e-20
Identity = 137/600 (22.83%), Postives = 250/600 (41.67%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-VSIDGNSGT-----IILKKPLFDI-DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPA-------LFTRSNYSLSIIENKDNFSILSFA-VIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I++ DIND  P+F +   T  V E+  +G++     A D+++   G   Y L    +    F + +  + G      I+L     ++ D   LT++A D   +  ++    + + I D N++ P     S              Y  E+ EN+P    V  +   D D G NG+++  + Q    +  L  +D    +        + ++  +DRE+++N L F +  +D G     S   + +DV DQN+  PA       L T S+   +I E+    + ++   V D+D     E  + +        F L   + SS +      ++   PLD E+   Y+  I  V+    N   +S  ++ V V D NDN P +   +   E  E N P  ++ +++  D D G N+ +  S +           S    LF I      ++ +  +D E     +  +   D+G P +    ++++ +LD NDN+P+++      S L+N+  +S + +        V   D D   + ++   ++       I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGG-NPPRYSSALLRVVIADANDNAPKFEKSS--------------YEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGI--------IYVKGPLDREEINN-LKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDE---GENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSG--NPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIAD---------SSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGM--------VTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDEN 672          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 160.229 bits (404), Expect = 1.850e-39
Identity = 172/605 (28.43%), Postives = 265/605 (43.80%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRL-NKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI--SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L +   D G P   SS  L I I D ND  PKF   +Y   + E+  VG  +L+V A D + G  G++ Y L +        +SID N+G I +K  +   +I  L   V+A D+    SK     V I + D N++ P+I      R     L  +      I E+ P    V+ + V D+DEG+N  V C +         F L S     N    +Y L+    +D E++       I   D+G P L ST  L+V V D N+   +F+ + Y +   E N+    +L     D D+ +  E   + +     E   L  +  ++GE+R+ + LDRE+   YQF +   ++   + + T  ATV V VLD NDN P+++    SF ++EN  P   +G +  +D D GEN+R+ +S          E  +G    F I      IL    S D E        +   D G P   + + I +N+LDENDN P    P+  ++            T +  V A D D   ++ L + +     H    I    GEI+L K+      G + L ++V D G P R ++A + I +
Sbjct:  212 DRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQ-SKSSKALVTITVKDQNDNAPSI------RIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVP----FQLRSASETGNDRKRKYFLQTTTLLDYERIKE-YRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEG--LFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGT--ATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS---------VEPDNGK---FMIQNGTYTILSTI-SFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPA--NSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRIS-SEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 784          

HSP 2 Score: 94.3597 bits (233), Expect = 3.733e-19
Identity = 137/599 (22.87%), Postives = 251/599 (41.90%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSG---TIILK---KPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES--------FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFT----GEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I+I+D ND  P+F +   T  + E+  VG++     A DR+SG  G   Y L    + +  F   V+ D +      I+L    + L D   L + V    S    S      + I I D N++ P       +R+          Y  E+ EN+P    V  +   D D G NG+V   + Q +  +  L  +D    +        + ++ S+DRE++S  L F +  +DNG     S  ++ + V DQN+  P++  R    + ++ ++D  + +S  +    A++  E          + +        F L S +++  +      ++    LD E+   Y+  I  V+    N   +S  ++ V V D+NDN P +   +   E  E N P  ++  ++  D D G N+ ++ S    +           E LF I+     ++V   +D E + + +  +   D+G P      +++V +LD NDN+P+++    L+        N+   + +  V   D D   + R+   ++  +    I   T      IS  ++ E+  Y   L+  D G+P R+S   +TI +  +N
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSS---ALLRITITDANDNVPKF-----ERSH---------YEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGI--------IFVKGSVDREEISI-LKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIR---GIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSG--NPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV---------PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM----LNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKES-TYSFRLKAVDGGDPPRSSYVGITINVLDEN 682          

HSP 3 Score: 63.1586 bits (152), Expect = 1.433e-9
Identity = 105/406 (25.86%), Postives = 178/406 (43.84%), Query Frame = 3
Query:  891 SIDREKV--------SNP--LNFSINCQDNGQPLLKST----IILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAV-IDQDALS--FNEFHLNSSNNFNMESFHLSSL--TQSSGE-----IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPE-WIYPSSL----DNVVNISHINIQSGTKLTRVRAIDAD--------SVSSNRLTYELKAKHDSISIDP---FTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            SIDRE +         +P  L F ++  D    L+K T    I  ++++LD+N+    F+    +LSI EN    ++ +  V  D+D+ S    ++ L +      E+ +L SL   Q S E     I +GN LDRE    Y  +I VV+      +  S A + + + D NDNVP++       E+ EN+   + + Q+  +D D+G N  ++ S    +   P  +L     L       I+ VK S+D E I   K  +   D G     +K  + + + D+NDN P   I    L    D V NIS  ++  GT +  V   D D         V +  + ++L++  ++ +      F    +L       +Y + +   D+GNP  +S+ +L + +   N
Sbjct:   87 SIDRESLKDCRNLFEGDPCFLEFEVSITD----LMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTT----GPEATNLFSLQVAQDSDEKLPQLIVLGN-LDRELRDSYDLNIKVVDGGSPPRQ--SSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSS--PVMRL-----LSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISE-DMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMN 473          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 159.458 bits (402), Expect = 2.252e-39
Identity = 172/605 (28.43%), Postives = 265/605 (43.80%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRL-NKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI--SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L +   D G P   SS  L I I D ND  PKF   +Y   + E+  VG  +L+V A D + G  G++ Y L +        +SID N+G I +K  +   +I  L   V+A D+    SK     V I + D N++ P+I      R     L  +      I E+ P    V+ + V D+DEG+N  V C +         F L S     N    +Y L+    +D E++       I   D+G P L ST  L+V V D N+   +F+ + Y +   E N+    +L     D D+ +  E   + +     E   L  +  ++GE+R+ + LDRE+   YQF +   ++   + + T  ATV V VLD NDN P+++    SF ++EN  P   +G +  +D D GEN+R+ +S          E  +G    F I      IL    S D E        +   D G P   + + I +N+LDENDN P    P+  ++            T +  V A D D   ++ L + +     H    I    GEI+L K+      G + L ++V D G P R ++A + I +
Sbjct:  212 DRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQ-SKSSKALVTITVKDQNDNAPSI------RIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVP----FQLRSASETGNDRKRKYFLQTTTLLDYERIKE-YRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEG--LFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGT--ATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS---------VEPDNGK---FMIQNGTYTILSTI-SFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPA--NSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRIS-SEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 784          

HSP 2 Score: 93.9745 bits (232), Expect = 5.415e-19
Identity = 137/599 (22.87%), Postives = 251/599 (41.90%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSG---TIILK---KPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES--------FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFT----GEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I+I+D ND  P+F +   T  + E+  VG++     A DR+SG  G   Y L    + +  F   V+ D +      I+L    + L D   L + V    S    S      + I I D N++ P       +R+          Y  E+ EN+P    V  +   D D G NG+V   + Q +  +  L  +D    +        + ++ S+DRE++S  L F +  +DNG     S  ++ + V DQN+  P++  R    + ++ ++D  + +S  +    A++  E          + +        F L S +++  +      ++    LD E+   Y+  I  V+    N   +S  ++ V V D+NDN P +   +   E  E N P  ++  ++  D D G N+ ++ S    +           E LF I+     ++V   +D E + + +  +   D+G P      +++V +LD NDN+P+++    L+        N+   + +  V   D D   + R+   ++  +    I   T      IS  ++ E+  Y   L+  D G+P R+S   +TI +  +N
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSS---ALLRITITDANDNVPKF-----ERSH---------YEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGI--------IFVKGSVDREEISI-LKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIR---GIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSG--NPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV---------PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM----LNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKES-TYSFRLKAVDGGDPPRSSYVGITINVLDEN 682          

HSP 3 Score: 63.5438 bits (153), Expect = 1.334e-9
Identity = 105/406 (25.86%), Postives = 178/406 (43.84%), Query Frame = 3
Query:  891 SIDREKV--------SNP--LNFSINCQDNGQPLLKST----IILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAV-IDQDALS--FNEFHLNSSNNFNMESFHLSSL--TQSSGE-----IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPE-WIYPSSL----DNVVNISHINIQSGTKLTRVRAIDAD--------SVSSNRLTYELKAKHDSISIDP---FTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            SIDRE +         +P  L F ++  D    L+K T    I  ++++LD+N+    F+    +LSI EN    ++ +  V  D+D+ S    ++ L +      E+ +L SL   Q S E     I +GN LDRE    Y  +I VV+      +  S A + + + D NDNVP++       E+ EN+   + + Q+  +D D+G N  ++ S    +   P  +L     L       I+ VK S+D E I   K  +   D G     +K  + + + D+NDN P   I    L    D V NIS  ++  GT +  V   D D         V +  + ++L++  ++ +      F    +L       +Y + +   D+GNP  +S+ +L + +   N
Sbjct:   87 SIDRESLKDCRNLFEGDPCFLEFEVSITD----LMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTG----PEATNLFSLQVAQDSDEKLPQLIVLGN-LDRELRDSYDLNIKVVDGGSPPRQ--SSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSS--PVMRL-----LSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISE-DMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMN 473          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 159.458 bits (402), Expect = 2.633e-39
Identity = 172/605 (28.43%), Postives = 265/605 (43.80%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRL-NKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI--SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L +   D G P   SS  L I I D ND  PKF   +Y   + E+  VG  +L+V A D + G  G++ Y L +        +SID N+G I +K  +   +I  L   V+A D+    SK     V I + D N++ P+I      R     L  +      I E+ P    V+ + V D+DEG+N  V C +         F L S     N    +Y L+    +D E++       I   D+G P L ST  L+V V D N+   +F+ + Y +   E N+    +L     D D+ +  E   + +     E   L  +  ++GE+R+ + LDRE+   YQF +   ++   + + T  ATV V VLD NDN P+++    SF ++EN  P   +G +  +D D GEN+R+ +S          E  +G    F I      IL    S D E        +   D G P   + + I +N+LDENDN P    P+  ++            T +  V A D D   ++ L + +     H    I    GEI+L K+      G + L ++V D G P R ++A + I +
Sbjct:  235 DRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQ-SKSSKALVTITVKDQNDNAPSI------RIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVP----FQLRSASETGNDRKRKYFLQTTTLLDYERIKE-YRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEG--LFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGT--ATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS---------VEPDNGK---FMIQNGTYTILSTI-SFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPA--NSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRIS-SEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 807          

HSP 2 Score: 93.9745 bits (232), Expect = 5.262e-19
Identity = 137/599 (22.87%), Postives = 251/599 (41.90%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSG---TIILK---KPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES--------FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFT----GEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I+I+D ND  P+F +   T  + E+  VG++     A DR+SG  G   Y L    + +  F   V+ D +      I+L    + L D   L + V    S    S      + I I D N++ P       +R+          Y  E+ EN+P    V  +   D D G NG+V   + Q +  +  L  +D    +        + ++ S+DRE++S  L F +  +DNG     S  ++ + V DQN+  P++  R    + ++ ++D  + +S  +    A++  E          + +        F L S +++  +      ++    LD E+   Y+  I  V+    N   +S  ++ V V D+NDN P +   +   E  E N P  ++  ++  D D G N+ ++ S    +           E LF I+     ++V   +D E + + +  +   D+G P      +++V +LD NDN+P+++    L+        N+   + +  V   D D   + R+   ++  +    I   T      IS  ++ E+  Y   L+  D G+P R+S   +TI +  +N
Sbjct:  152 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSS---ALLRITITDANDNVPKF-----ERSH---------YEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGI--------IFVKGSVDREEISI-LKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIR---GIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSG--NPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV---------PEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM----LNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKES-TYSFRLKAVDGGDPPRSSYVGITINVLDEN 705          

HSP 3 Score: 62.7734 bits (151), Expect = 1.792e-9
Identity = 105/406 (25.86%), Postives = 178/406 (43.84%), Query Frame = 3
Query:  891 SIDREKV--------SNP--LNFSINCQDNGQPLLKST----IILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAV-IDQDALS--FNEFHLNSSNNFNMESFHLSSL--TQSSGE-----IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPE-WIYPSSL----DNVVNISHINIQSGTKLTRVRAIDAD--------SVSSNRLTYELKAKHDSISIDP---FTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            SIDRE +         +P  L F ++  D    L+K T    I  ++++LD+N+    F+    +LSI EN    ++ +  V  D+D+ S    ++ L +      E+ +L SL   Q S E     I +GN LDRE    Y  +I VV+      +  S A + + + D NDNVP++       E+ EN+   + + Q+  +D D+G N  ++ S    +   P  +L     L       I+ VK S+D E I   K  +   D G     +K  + + + D+NDN P   I    L    D V NIS  ++  GT +  V   D D         V +  + ++L++  ++ +      F    +L       +Y + +   D+GNP  +S+ +L + +   N
Sbjct:  110 SIDRESLKDCRNLFEGDPCFLEFEVSITD----LMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTT----GPEATNLFSLQVAQDSDEKLPQLIVLGN-LDRELRDSYDLNIKVVDGGSPPRQ--SSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSS--PVMRL-----LSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISE-DMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMN 496          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 167.162 bits (422), Expect = 1.230e-41
Identity = 169/591 (28.60%), Postives = 267/591 (45.18%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQS--GTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSA 1955
            + L +   D G P   SS  L I I+D ND APKF    Y   + E+  +G  +L+V A D + G   +I Y   +  D     + +D ++G I ++ P+   D+  L  +V A D    N K   T V I I D N+++P I +      + Q   G       I E+ P    V+ + V D DEG N  V C +      +     D+     K   +Y L+   ++D E V       I   D+G P L ST  L+V V D N+   +F++S   +   EN D N  ++  +  D D+   ++ H +   + +       S+   SG+IR+   LDRE+   Y F +  V++   + K T  A+V + VLD NDN P+++    +F + EN      +G +   D D GEN+ I +S          E  SG E +       IL    S D E        +   D G P   + + + +N+LDENDN P  + PS+    ++  ++  Q+  GT +  VRA D D+  +  L Y + + +  +   I    GE++L K I     G + L ++VTD G P R+ +A
Sbjct:  254 YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQ--GG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK---KYFLQTTTALDYESVKE-YTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF--SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT--ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS---------VEPESG-EFVIQNGTGTILS-SISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 92.4337 bits (228), Expect = 2.150e-18
Identity = 142/616 (23.05%), Postives = 253/616 (41.07%), Query Frame = 3
Query:  252 PQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEF-----HLNSSNNFNMES---FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEK--LSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P+L   Q   I+I+DIND  P F +   T  + E+  +G +     A DR+SG  G   Y+LI   +    F   V+ D +      K+P   +         D   LT++  D     ++     + I I+D N++ P     +              Y  E+ EN+P    V  +   D D+G N ++     Q +  ++ L +LD    L        + ++  IDRE V   L FS+  +D G     +   + + + D N+  P +  R      ++ ++   + +S  V  +  ++  +       +N++    +     F L  ++ +  +      ++    LD E    Y   I  V+    N   +S  ++ V V D+NDN P +    M     ENN  +  + ++   D D G NS++  S L      P+ +   S N D   I    +L  +Q   Y+F H   +     D+G P      S+++ +LD NDN+P+++      S ++N+  +S + +        V  IDAD   +  +   ++ +     I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  157 PRLLDGQ---IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDE-----KQPQLIVMGMLDREQRDSYDLTIKVQDGGTP-ARASSALLRISILDTNDNAPKFEKMA--------------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL--------ITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIR---GFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSG--NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPD----PSARGIFSINPDSGQIRVNTVLDREQREHYDF-HVVAV-----DKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGM--------VTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDEN 717          

HSP 3 Score: 77.0258 bits (188), Expect = 1.160e-13
Identity = 85/376 (22.61%), Postives = 164/376 (43.62%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES---FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF 1301
            DYE + ++ ++++A D G P L S+  L + + D+ND AP F       V  E+  +  ++++V A D +SG   ++ Y ++ +      F SI+ +SG I +   + D ++       V A D    + K     VVI ++D N++ P             +LNG   Y   + EN P    V  + V+D D+G+N  +   ++                +   T      I  S DRE  S    F +   D G P   S + + ++VLD+N+  P +   SN S   +  + +       V  +D     +  +N+  ++++ S   F L  ++ ++GE+ +   + R+    ++  + V ++ + +   T+ 
Sbjct:  473 DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF-SINPDSGQIRVNT-VLDREQREHYDFHVVAVDKGIPSLK-GTASVVITVLDRNDNDPKF-----------MLNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES---------GEFVIQNGTGTILSSI--SFDREHQST-YTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDM----DTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 815          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 167.162 bits (422), Expect = 1.377e-41
Identity = 169/591 (28.60%), Postives = 267/591 (45.18%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQS--GTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSA 1955
            + L +   D G P   SS  L I I+D ND APKF    Y   + E+  +G  +L+V A D + G   +I Y   +  D     + +D ++G I ++ P+   D+  L  +V A D    N K   T V I I D N+++P I +      + Q   G       I E+ P    V+ + V D DEG N  V C +      +     D+     K   +Y L+   ++D E V       I   D+G P L ST  L+V V D N+   +F++S   +   EN D N  ++  +  D D+   ++ H +   + +       S+   SG+IR+   LDRE+   Y F +  V++   + K T  A+V + VLD NDN P+++    +F + EN      +G +   D D GEN+ I +S          E  SG E +       IL    S D E        +   D G P   + + + +N+LDENDN P  + PS+    ++  ++  Q+  GT +  VRA D D+  +  L Y + + +  +   I    GE++L K I     G + L ++VTD G P R+ +A
Sbjct:  254 YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQ--GG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK---KYFLQTTTALDYESVKE-YTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF--SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT--ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS---------VEPESG-EFVIQNGTGTILS-SISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 92.8189 bits (229), Expect = 1.978e-18
Identity = 142/616 (23.05%), Postives = 253/616 (41.07%), Query Frame = 3
Query:  252 PQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEF-----HLNSSNNFNMES---FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEK--LSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P+L   Q   I+I+DIND  P F +   T  + E+  +G +     A DR+SG  G   Y+LI   +    F   V+ D +      K+P   +         D   LT++  D     ++     + I I+D N++ P     +              Y  E+ EN+P    V  +   D D+G N ++     Q +  ++ L +LD    L        + ++  IDRE V   L FS+  +D G     +   + + + D N+  P +  R      ++ ++   + +S  V  +  ++  +       +N++    +     F L  ++ +  +      ++    LD E    Y   I  V+    N   +S  ++ V V D+NDN P +    M     ENN  +  + ++   D D G NS++  S L      P+ +   S N D   I    +L  +Q   Y+F H   +     D+G P      S+++ +LD NDN+P+++      S ++N+  +S + +        V  IDAD   +  +   ++ +     I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  157 PRLLDGQ---IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDE-----KQPQLIVMGMLDREQRDSYDLTIKVQDGGT-PARASSALLRISILDTNDNAPKFEKMA--------------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL--------ITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIR---GFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSG--NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPD----PSARGIFSINPDSGQIRVNTVLDREQREHYDF-HVVAV-----DKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGM--------VTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDEN 717          

HSP 3 Score: 77.411 bits (189), Expect = 1.062e-13
Identity = 85/376 (22.61%), Postives = 165/376 (43.88%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES---FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF 1301
            DYE + ++ ++++A D G P L S+  L + + D+ND AP F       V  E+  +  ++++V A D +SG   ++ Y ++ +      F SI+ +SG I +   + D ++       V A D    + K   + VVI ++D N++ P             +LNG   Y   + EN P    V  + V+D D+G+N  +   ++                +   T      I  S DRE  S    F +   D G P   S + + ++VLD+N+  P +   SN S   +  + +       V  +D     +  +N+  ++++ S   F L  ++ ++GE+ +   + R+    ++  + V ++ + +   T+ 
Sbjct:  473 DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF-SINPDSGQIRVNT-VLDREQREHYDFHVVAVDKGIPSLKGTAS-VVITVLDRNDNDPKF-----------MLNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES---------GEFVIQNGTGTILSSI--SFDREHQST-YTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDM----DTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 815          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 167.548 bits (423), Expect = 1.393e-41
Identity = 169/591 (28.60%), Postives = 267/591 (45.18%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQS--GTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSA 1955
            + L +   D G P   SS  L I I+D ND APKF    Y   + E+  +G  +L+V A D + G   +I Y   +  D     + +D ++G I ++ P+   D+  L  +V A D    N K   T V I I D N+++P I +      + Q   G       I E+ P    V+ + V D DEG N  V C +      +     D+     K   +Y L+   ++D E V       I   D+G P L ST  L+V V D N+   +F++S   +   EN D N  ++  +  D D+   ++ H +   + +       S+   SG+IR+   LDRE+   Y F +  V++   + K T  A+V + VLD NDN P+++    +F + EN      +G +   D D GEN+ I +S          E  SG E +       IL    S D E        +   D G P   + + + +N+LDENDN P  + PS+    ++  ++  Q+  GT +  VRA D D+  +  L Y + + +  +   I    GE++L K I     G + L ++VTD G P R+ +A
Sbjct:  254 YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQ--GG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK---KYFLQTTTALDYESVKE-YTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF--SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT--ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS---------VEPESG-EFVIQNGTGTILS-SISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 92.4337 bits (228), Expect = 2.500e-18
Identity = 143/613 (23.33%), Postives = 252/613 (41.11%), Query Frame = 3
Query:  252 PQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEF-----HLNSSNNFNMES---FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEK--LSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI-NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P+L   Q   I+I+DIND  P F +   T  + E+  +G +     A DR+SG  G   Y+LI   +    F   V+ D +      K+P   +         D   LT++  D     ++     + I I+D N++ P     +              Y  E+ EN+P    V  +   D D+G N ++     Q +  ++ L +LD    L        + ++  IDRE V   L FS+  +D G     +   + + + D N+  P +  R      ++ ++   + +S  V  +  ++  +       +N++    +     F L  ++ +  +      ++    LD E    Y   I  V+    N   +S  ++ V V D+NDN P +    M     ENN  +  + ++   D D G NS++  S L      P+ +   S N D   I    +L  +Q   Y+F H   +     D+G P      S+++ +LD NDN+P+++      N  N S + N+   + +  V  IDAD   +  +   ++ +     I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  157 PRLLDGQ---IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDE-----KQPQLIVMGMLDREQRDSYDLTIKVQDGGTP-ARASSALLRISILDTNDNAPKFEKMA--------------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL--------ITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIR---GFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSG--NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPD----PSARGIFSINPDSGQIRVNTVLDREQREHYDF-HVVAV-----DKGIPSLKGTASVVITVLDRNDNDPKFML-----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDEN 717          

HSP 3 Score: 77.411 bits (189), Expect = 9.785e-14
Identity = 74/287 (25.78%), Postives = 127/287 (44.25%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYS 1043
            DYE + ++ ++++A D G P L S+  L + + D+ND AP F       V  E+  +  ++++V A D +SG   ++ Y ++ +      F SI+ +SG I +   + D ++       V A D    + K   + VVI ++D N++ P             +LNG   Y   + EN P    V  + V+D D+G+N  +   ++                +   T      I  S DRE  S    F +   D G P   S + + ++VLD+N+  P +   SN S
Sbjct:  473 DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF-SINPDSGQIRVNT-VLDREQREHYDFHVVAVDKGIPSLKGTAS-VVITVLDRNDNDPKF-----------MLNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES---------GEFVIQNGTGTILSSI--SFDREHQST-YTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNIS 730          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 167.162 bits (422), Expect = 1.434e-41
Identity = 169/591 (28.60%), Postives = 267/591 (45.18%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQS--GTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSA 1955
            + L +   D G P   SS  L I I+D ND APKF    Y   + E+  +G  +L+V A D + G   +I Y   +  D     + +D ++G I ++ P+   D+  L  +V A D    N K   T V I I D N+++P I +      + Q   G       I E+ P    V+ + V D DEG N  V C +      +     D+     K   +Y L+   ++D E V       I   D+G P L ST  L+V V D N+   +F++S   +   EN D N  ++  +  D D+   ++ H +   + +       S+   SG+IR+   LDRE+   Y F +  V++   + K T  A+V + VLD NDN P+++    +F + EN      +G +   D D GEN+ I +S          E  SG E +       IL    S D E        +   D G P   + + + +N+LDENDN P  + PS+    ++  ++  Q+  GT +  VRA D D+  +  L Y + + +  +   I    GE++L K I     G + L ++VTD G P R+ +A
Sbjct:  254 YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQ--GG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK---KYFLQTTTALDYESVKE-YTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF--SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT--ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS---------VEPESG-EFVIQNGTGTILS-SISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 92.4337 bits (228), Expect = 2.246e-18
Identity = 142/616 (23.05%), Postives = 253/616 (41.07%), Query Frame = 3
Query:  252 PQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEF-----HLNSSNNFNMES---FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEK--LSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P+L   Q   I+I+DIND  P F +   T  + E+  +G +     A DR+SG  G   Y+LI   +    F   V+ D +      K+P   +         D   LT++  D     ++     + I I+D N++ P     +              Y  E+ EN+P    V  +   D D+G N ++     Q +  ++ L +LD    L        + ++  IDRE V   L FS+  +D G     +   + + + D N+  P +  R      ++ ++   + +S  V  +  ++  +       +N++    +     F L  ++ +  +      ++    LD E    Y   I  V+    N   +S  ++ V V D+NDN P +    M     ENN  +  + ++   D D G NS++  S L      P+ +   S N D   I    +L  +Q   Y+F H   +     D+G P      S+++ +LD NDN+P+++      S ++N+  +S + +        V  IDAD   +  +   ++ +     I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  157 PRLLDGQ---IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDE-----KQPQLIVMGMLDREQRDSYDLTIKVQDGGTP-ARASSALLRISILDTNDNAPKFEKMA--------------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL--------ITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIR---GFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSG--NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPD----PSARGIFSINPDSGQIRVNTVLDREQREHYDF-HVVAV-----DKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGM--------VTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDEN 717          

HSP 3 Score: 77.0258 bits (188), Expect = 1.239e-13
Identity = 85/376 (22.61%), Postives = 164/376 (43.62%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES---FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF 1301
            DYE + ++ ++++A D G P L S+  L + + D+ND AP F       V  E+  +  ++++V A D +SG   ++ Y ++ +      F SI+ +SG I +   + D ++       V A D    + K     VVI ++D N++ P             +LNG   Y   + EN P    V  + V+D D+G+N  +   ++                +   T      I  S DRE  S    F +   D G P   S + + ++VLD+N+  P +   SN S   +  + +       V  +D     +  +N+  ++++ S   F L  ++ ++GE+ +   + R+    ++  + V ++ + +   T+ 
Sbjct:  473 DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF-SINPDSGQIRVNT-VLDREQREHYDFHVVAVDKGIPSLK-GTASVVITVLDRNDNDPKF-----------MLNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES---------GEFVIQNGTGTILSSI--SFDREHQST-YTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDM----DTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 815          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 167.162 bits (422), Expect = 1.534e-41
Identity = 169/591 (28.60%), Postives = 267/591 (45.18%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQS--GTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSA 1955
            + L +   D G P   SS  L I I+D ND APKF    Y   + E+  +G  +L+V A D + G   +I Y   +  D     + +D ++G I ++ P+   D+  L  +V A D    N K   T V I I D N+++P I +      + Q   G       I E+ P    V+ + V D DEG N  V C +      +     D+     K   +Y L+   ++D E V       I   D+G P L ST  L+V V D N+   +F++S   +   EN D N  ++  +  D D+   ++ H +   + +       S+   SG+IR+   LDRE+   Y F +  V++   + K T  A+V + VLD NDN P+++    +F + EN      +G +   D D GEN+ I +S          E  SG E +       IL    S D E        +   D G P   + + + +N+LDENDN P  + PS+    ++  ++  Q+  GT +  VRA D D+  +  L Y + + +  +   I    GE++L K I     G + L ++VTD G P R+ +A
Sbjct:  246 YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQ--GG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK---KYFLQTTTALDYESVKE-YTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF--SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT--ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS---------VEPESG-EFVIQNGTGTILS-SISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 806          

HSP 2 Score: 92.4337 bits (228), Expect = 2.669e-18
Identity = 143/613 (23.33%), Postives = 252/613 (41.11%), Query Frame = 3
Query:  252 PQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEF-----HLNSSNNFNMES---FHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEK--LSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI-NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P+L   Q   I+I+DIND  P F +   T  + E+  +G +     A DR+SG  G   Y+LI   +    F   V+ D +      K+P   +         D   LT++  D     ++     + I I+D N++ P     +              Y  E+ EN+P    V  +   D D+G N ++     Q +  ++ L +LD    L        + ++  IDRE V   L FS+  +D G     +   + + + D N+  P +  R      ++ ++   + +S  V  +  ++  +       +N++    +     F L  ++ +  +      ++    LD E    Y   I  V+    N   +S  ++ V V D+NDN P +    M     ENN  +  + ++   D D G NS++  S L      P+ +   S N D   I    +L  +Q   Y+F H   +     D+G P      S+++ +LD NDN+P+++      N  N S + N+   + +  V  IDAD   +  +   ++ +     I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  149 PRLLDGQ---IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDE-----KQPQLIVMGMLDREQRDSYDLTIKVQDGGT-PARASSALLRISILDTNDNAPKFEKMA--------------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL--------ITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIR---GFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSG--NPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPD----PSARGIFSINPDSGQIRVNTVLDREQREHYDF-HVVAV-----DKGIPSLKGTASVVITVLDRNDNDPKFML-----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDEN 709          

HSP 3 Score: 77.411 bits (189), Expect = 1.072e-13
Identity = 85/376 (22.61%), Postives = 165/376 (43.88%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES---FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF 1301
            DYE + ++ ++++A D G P L S+  L + + D+ND AP F       V  E+  +  ++++V A D +SG   ++ Y ++ +      F SI+ +SG I +   + D ++       V A D    + K   + VVI ++D N++ P             +LNG   Y   + EN P    V  + V+D D+G+N  +   ++                +   T      I  S DRE  S    F +   D G P   S + + ++VLD+N+  P +   SN S   +  + +       V  +D     +  +N+  ++++ S   F L  ++ ++GE+ +   + R+    ++  + V ++ + +   T+ 
Sbjct:  465 DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF-SINPDSGQIRVNT-VLDREQREHYDFHVVAVDKGIPSLKGTAS-VVITVLDRNDNDPKF-----------MLNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES---------GEFVIQNGTGTILSSI--SFDREHQST-YTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDM----DTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 807          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 174.481 bits (441), Expect = 5.052e-44
Identity = 174/643 (27.06%), Postives = 283/643 (44.01%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXX---XXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNT-YQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKL----TRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSA 1955
            D+  NGV  Y L+   ++   + +               + +LD E    + L +   D G P   SS  L + ++D ND APKF    Y   + E+  +G  +++V A D + G   +I Y   +  +     + +D N+G I ++ P+   D+  L  +V A D      K     VV+ + D+N++ P I +      + Q  +G       I E+  E   V+ + V D+DEG+N  V C +         F L        ++  +Y L+    +D EKV +     I   D+G P L ST  L+V V+D N+   +FT+S   ++  EN     +++  V   DA S +   L  S      +  L +++  +GEIR+   LDRE+   Y+  +   +    + + T  ATV V VLD NDN P+++    +F + EN      +G +   D D GEN+R+ +S          E+ +G  D    +    +    S D E        +   D G P     + + +N+LDENDN P    PS      N SH  +   T+L    ++V A D DS  +  LTY +     +    I   +G I+L K+IE    G + L ++V+D G P R  +A
Sbjct:  174 DAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGA-TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQ--DG----MANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDV----PFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA-EVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGT--ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLS---------VEQDNG--DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPS------NTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 784          

HSP 2 Score: 124.79 bits (312), Expect = 1.773e-28
Identity = 148/619 (23.91%), Postives = 265/619 (42.81%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFH-LNSSNNFNME-------SFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            G P+L   Q   I++ DIND  P F +   T  + E+  +GS+     A DR++G  G   Y+L    +    F   V+ D        K+P   +         D   LT++  D   +  +     + + ++D N++ P                  P Y  E+ EN+P    V  +   D D+G N ++     Q  ++++ L      +RL++NT    + ++  +DRE +S  L FS+  +D G     +   + V V D N+  P +  R    + ++ ++D  + +S  V ++ A++  +    +   N  +         F L   +++  +      ++   PLD EK   Y   I  V+    N   +S  ++ V V+D+NDN P   Q +  ++F   ENN P   + ++   D D G N+ +  S          E     + LF IS E   ++VK S+D E   + ++ +   D G P      +++VN+LD NDN+P+++      S ++N+  +S + +        V  ID D   + R+   ++  +    I   TG I  SL+ D E    Y   L+  D G P R++   +TI +  +N
Sbjct:  125 GSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE-----KQPQLIVMGNLDRERWDSYDLTIKVQDGG-NPPRASSALLRVTVLDTNDNAPKFE--------------RPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL------LRLDRNT--GLITVQGPVDREDLST-LRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIR---GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG--NPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAF--PENNKPGEVVAEVTASDADSGSNAELVYS---------LEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM--------VTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN 687          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 174.481 bits (441), Expect = 5.052e-44
Identity = 174/643 (27.06%), Postives = 283/643 (44.01%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXX---XXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNT-YQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKL----TRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSA 1955
            D+  NGV  Y L+   ++   + +               + +LD E    + L +   D G P   SS  L + ++D ND APKF    Y   + E+  +G  +++V A D + G   +I Y   +  +     + +D N+G I ++ P+   D+  L  +V A D      K     VV+ + D+N++ P I +      + Q  +G       I E+  E   V+ + V D+DEG+N  V C +         F L        ++  +Y L+    +D EKV +     I   D+G P L ST  L+V V+D N+   +FT+S   ++  EN     +++  V   DA S +   L  S      +  L +++  +GEIR+   LDRE+   Y+  +   +    + + T  ATV V VLD NDN P+++    +F + EN      +G +   D D GEN+R+ +S          E+ +G  D    +    +    S D E        +   D G P     + + +N+LDENDN P    PS      N SH  +   T+L    ++V A D DS  +  LTY +     +    I   +G I+L K+IE    G + L ++V+D G P R  +A
Sbjct:  174 DAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGA-TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQ--DG----MANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDV----PFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA-EVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGT--ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLS---------VEQDNG--DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPS------NTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 784          

HSP 2 Score: 124.79 bits (312), Expect = 1.773e-28
Identity = 148/619 (23.91%), Postives = 265/619 (42.81%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFH-LNSSNNFNME-------SFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            G P+L   Q   I++ DIND  P F +   T  + E+  +GS+     A DR++G  G   Y+L    +    F   V+ D        K+P   +         D   LT++  D   +  +     + + ++D N++ P                  P Y  E+ EN+P    V  +   D D+G N ++     Q  ++++ L      +RL++NT    + ++  +DRE +S  L FS+  +D G     +   + V V D N+  P +  R    + ++ ++D  + +S  V ++ A++  +    +   N  +         F L   +++  +      ++   PLD EK   Y   I  V+    N   +S  ++ V V+D+NDN P   Q +  ++F   ENN P   + ++   D D G N+ +  S          E     + LF IS E   ++VK S+D E   + ++ +   D G P      +++VN+LD NDN+P+++      S ++N+  +S + +        V  ID D   + R+   ++  +    I   TG I  SL+ D E    Y   L+  D G P R++   +TI +  +N
Sbjct:  125 GSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE-----KQPQLIVMGNLDRERWDSYDLTIKVQDGG-NPPRASSALLRVTVLDTNDNAPKFE--------------RPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL------LRLDRNT--GLITVQGPVDREDLST-LRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIR---GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG--NPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAF--PENNKPGEVVAEVTASDADSGSNAELVYS---------LEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM--------VTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN 687          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 174.096 bits (440), Expect = 6.451e-44
Identity = 174/643 (27.06%), Postives = 283/643 (44.01%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXX---XXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNT-YQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKL----TRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSA 1955
            D+  NGV  Y L+   ++   + +               + +LD E    + L +   D G P   SS  L + ++D ND APKF    Y   + E+  +G  +++V A D + G   +I Y   +  +     + +D N+G I ++ P+   D+  L  +V A D      K     VV+ + D+N++ P I +      + Q  +G       I E+  E   V+ + V D+DEG+N  V C +         F L        ++  +Y L+    +D EKV +     I   D+G P L ST  L+V V+D N+   +FT+S   ++  EN     +++  V   DA S +   L  S      +  L +++  +GEIR+   LDRE+   Y+  +   +    + + T  ATV V VLD NDN P+++    +F + EN      +G +   D D GEN+R+ +S          E+ +G  D    +    +    S D E        +   D G P     + + +N+LDENDN P    PS      N SH  +   T+L    ++V A D DS  +  LTY +     +    I   +G I+L K+IE    G + L ++V+D G P R  +A
Sbjct:   35 DAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGA-TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQ--DG----MANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG----DVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA-EVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGT--ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLS---------VEQDNG--DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPS------NTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 645          

HSP 2 Score: 115.546 bits (288), Expect = 1.409e-25
Identity = 141/601 (23.46%), Postives = 255/601 (42.43%), Query Frame = 3
Query:  300 NDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFH-LNSSNNFNME-------SFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            ND  P F +   T  + E+  +GS+     A DR++G  G   Y+L    +    F   V+ D        K+P   +         D   LT++  D   +  +     + + ++D N++ P                  P Y  E+ EN+P    V  +   D D+G N ++     Q  ++++ L      +RL++NT    + ++  +DRE +S  L FS+  +D G     +   + V V D N+  P +  R    + ++ ++D  + +S  V ++ A++  +    +   N  +         F L   +++  +      ++   PLD EK   Y   I  V+    N   +S  ++ V V+D+NDN P   Q +  ++F   ENN P   + ++   D D G N+ +  S          E     + LF IS E   ++VK S+D E   + ++ +   D G P      +++VN+LD NDN+P+++      S ++N+  +S + +        V  ID D   + R+   ++  +    I   TG I  SL+ D E    Y   L+  D G P R++   +TI +  +N
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE-----KQPQLIVMGNLDRERWDSYDLTIKVQDGG-NPPRASSALLRVTVLDTNDNAPKFE--------------RPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL------LRLDRNT--GLITVQGPVDREDLST-LRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIR---GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG--NPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAF--PENNKPGEVVAEVTASDADSGSNAELVYS---------LEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM--------VTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN 548          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 147.902 bits (372), Expect = 8.603e-36
Identity = 155/592 (26.18%), Postives = 273/592 (46.11%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLTL---TVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKD---IEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  VG+ ++++HA D + G   +I Y        +T    +++  +G I +++ L D ++  +   TV A D +   ++     V I + DVN++ PNI    D R     +NG  +Y   + E +P N +++ I V DKD   NG V C I+     +  F+L       K  Y  QY L     +D E      +F I   D+G+P L  T +++V + D+N+ P +F +    LS+ E N+    + + +  D+D+    +  + L  + +F         L + +G +      +RE+  R+ F++     A+DN      S A V V VLD NDN P++      F + E N+P Y  +G +   D+D GEN  +++S            L+ NE+        +++   S D E   +   D+   D G P   +   + +N++D NDN P  I P S +    +  ++   G+ +  V A+D D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:  218 YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL-DREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNI----DLRYIISPINGT-VY---LSEKDPVNTKIALITVSDKDTDVNGKVICFIER----EVPFHL-------KAVYDNQYLLETSSLLDYEGTKE-FSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-------FDLDRKTGVLTASRVFNREEQERFIFTV----TARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDEDAGENKAVTLS-----------ILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPS-NTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 66.2402 bits (160), Expect = 1.689e-10
Identity = 68/275 (24.73%), Postives = 119/275 (43.27%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLF---DIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE 1010
            DYE   +F  +++A D G+P L  +  + + + D ND  P F        V E+   G  +  + A D +SG    I+Y+L  N     SF  +D  +G +   + +F   + ++   TV A D+     +     V++ ++D N++ P            +  + +  +F+   EN P+   V  I V D+D G+N  V   I           L+       + Y   ++   S DRE+ S+   F +   D GQP   ST  + ++V+D N+
Sbjct:  428 DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN----ASFFDLDRKTGVLTASR-VFNREEQERFIFTVTARDNGTPPLQ-SQAAVIVTVLDENDNSP------------KFTHNHFQFFVS--ENLPKYSTVGVITVTDEDAGENKAVTLSI-----------LNDNENFVLDPYSGVIKSNVSFDREQQSS-YTFDVKATDGGQPPRSSTAKVTINVMDVND 670          

HSP 3 Score: 66.2402 bits (160), Expect = 1.704e-10
Identity = 132/599 (22.04%), Postives = 245/599 (40.90%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC--QIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            K+ I + D ND AP F +      + E+  + S      A D ++G  G   Y+L+  +  F    V + +G     ++ +   D    D   + ++  D      K     + + + DVN++RP    G  +              + I EN P    V  ++  D D G N +++     Q     K LF L++   L        + +++S+DRE+ +     ++   D      ++T+   ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +   + LD E +  + F I   +  + +   T  A V V + D NDN P   Q V  +S  + ENN     L  +   D+D G+N+ I              +L  N   F +  +  +L   +  + E        +   D G P   ++ ++IV +LDENDN P++ +    ++       N+   + +  +   D D+  +  +T  +   +++  +DP++G I  +++ D E    Y   ++ TD G P R+S+A +TI +   N
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQ-KSSTAILQVTVSDVNDNRPVFKEGQVE--------------VHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGL--------ITVQRSLDREETAI-HKVTVLASDGSSTPARATV--TINVTDVNDNPPNIDLRYIISPINGTVYLSE-KDPVNTKIALITVSDKDTDVNGKVICFIEREV---------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQT--ALVRVKLEDENDNPPIFNQPVIELS--VSENNRRGLYLTTISATDEDSGKNADI------------VYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVN 669          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 147.517 bits (371), Expect = 1.269e-35
Identity = 155/592 (26.18%), Postives = 273/592 (46.11%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLTL---TVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK---DIEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  VG+ ++++HA D + G   +I Y        +T    +++  +G I +++ L D ++  +   TV A D +   ++     V I + DVN++ PNI    D R     +NG  +Y   + E +P N +++ I V DKD   NG V C I+     +  F+L       K  Y  QY L     +D E      +F I   D+G+P L  T +++V + D+N+ P +F +    LS+ E N+    + + +  D+D+    +  + L  + +F         L + +G +      +RE+  R+ F++     A+DN      S A V V VLD NDN P++      F + E N+P Y  +G +   D+D GEN  +++S            L+ NE+        +++   S D E   +   D+   D G P   +   + +N++D NDN P  I P S +    +  ++   G+ +  V A+D D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:   95 YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL-DREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNI----DLRYIISPINGT-VY---LSEKDPVNTKIALITVSDKDTDVNGKVICFIER----EVPFHL-------KAVYDNQYLLETSSLLDYEGTKE-FSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-------FDLDRKTGVLTASRVFNREEQERFIFTV----TARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDEDAGENKAVTLSI-----------LNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPS-NTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 638          

HSP 2 Score: 68.1662 bits (165), Expect = 4.677e-11
Identity = 132/599 (22.04%), Postives = 245/599 (40.90%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC--QIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            K+ I + D ND AP F +      + E+  + S      A D ++G  G   Y+L+  +  F    V + +G     ++ +   D    D   + ++  D      K     + + + DVN++RP    G  +              + I EN P    V  ++  D D G N +++     Q     K LF L++   L        + +++S+DRE+ +     ++   D      ++T+   ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +   + LD E +  + F I   +  + +   T  A V V + D NDN P   Q V  +S  + ENN     L  +   D+D G+N+ I              +L  N   F +  +  +L   +  + E        +   D G P   ++ ++IV +LDENDN P++ +    ++       N+   + +  +   D D+  +  +T  +   +++  +DP++G I  +++ D E    Y   ++ TD G P R+S+A +TI +   N
Sbjct:    4 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQ-KSSTAILQVTVSDVNDNRPVFKEGQVE--------------VHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGL--------ITVQRSLDREETAI-HKVTVLASDGSSTPARATVT--INVTDVNDNPPNIDLRYIISPINGTVYLSE-KDPVNTKIALITVSDKDTDVNGKVICFIEREV---------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQT--ALVRVKLEDENDNPPIFNQPVIELS--VSENNRRGLYLTTISATDEDSGKNADI------------VYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVN 546          

HSP 3 Score: 67.781 bits (164), Expect = 6.917e-11
Identity = 68/275 (24.73%), Postives = 118/275 (42.91%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLF---DIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE 1010
            DYE   +F  +++A D G+P L  +  + + + D ND  P F        V E+   G  +  + A D +SG    I+Y+L  N     SF  +D  +G +   + +F   + ++   TV A D+     +     V++ ++D N++ P  +            N +  +   + EN P+   V  I V D+D G+N  V   I           L+       + Y   ++   S DRE+ S+   F +   D GQP   ST  + ++V+D N+
Sbjct:  305 DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN----ASFFDLDRKTGVLTASR-VFNREEQERFIFTVTARDNGTPPLQ-SQAAVIVTVLDENDNSPKFT-----------HNHFQFF---VSENLPKYSTVGVITVTDEDAGENKAVTLSI-----------LNDNENFVLDPYSGVIKSNVSFDREQQSS-YTFDVKATDGGQPPRSSTAKVTINVMDVND 547          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 3.161e-42
Identity = 171/643 (26.59%), Postives = 284/643 (44.17%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXX---XXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNT-YQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKL----TRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSA 1955
            D+  NGV  Y L+   ++   + +               + +LD E    + L +   D G P   SS  L + ++D ND APKF   +Y   + E+  +G  +++V A D + G   +I Y   +  +     + +D N+G I ++ P+   D+  L  +V A D    N K     VV+ + D+N++ P I +      + Q  +G       I E+  E   V+ + V D+DEG+N  V C +         F L        ++  +Y L+    +D EKV +     I   D+G P L ST  L+V V+D N+   +FT+S   ++  EN     +++  +   DA S +   L  S      +  L +++  +GEI++   LDRE+   Y+  +   +    + + T  ATV V VLD NDN P+++    +F + EN      +G +   D D GEN+++ +S          E+ +G  D    +    +    S D E        +   D G P     + + +N+LDENDN P    PS      N SH  +   T+L    ++V A D DS  +  L Y +     +    I   +G I+L K+IE    G + L ++V+D G P R  +A
Sbjct:  196 DAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGT-NPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQ--DG----MANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDV----PFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA-EITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGT--ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLS---------VEQDNG--DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPS------NTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 806          

HSP 2 Score: 124.79 bits (312), Expect = 1.203e-27
Identity = 149/619 (24.07%), Postives = 265/619 (42.81%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPLFDI---------DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFH-LNSSNNFNME-------SFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            G P+L   Q   I++ DIND  P F +   T  + E+  +GS+     A DR++G  G   Y+L    +    F   V+ D        K+P   +         D   LT++  D      +     + + ++D N++ P                  P Y  E+ EN+P    V  +   D D+G N +++    Q  ++++ L      +RL++NT    + ++  +DRE +S  L FS+  +D G     +   + V V D N+  P +  R    + ++ ++D  + +S  V ++ A++  +    +   N  +         F L   +++  +      ++   PLD EK   Y   I  V+    N   +S  ++ V V+D+NDN P   Q V  ++F   ENN P   + ++   D D G N+ +  S          E     + LF IS E   +QVK S+D E   + ++ +   D G P      +++VN+LD NDN+P+++      S ++N+  +S + +        V  ID D   + ++   ++  +    I   TG I  SL+ D E    Y   L+  D G P R++   +TI +  +N
Sbjct:  147 GSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEE-----KQPQLIVMGNLDRERWDSYDLTIKVQDGGSP-PRASSALLRVTVLDTNDNAPKFE--------------RPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL------LRLDRNT--GLITVQGPVDREDLST-LRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIR---GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG--NPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAF--PENNKPGEVIAEITASDADSGSNAELVYS---------LEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM--------VTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN 709          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 6.192e-35
Identity = 155/592 (26.18%), Postives = 272/592 (45.95%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLTL---TVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKD---IEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  VG+ ++++HA D + G   +I Y        +T    +++  +G I +++ L D ++  +   TV A D +   ++     V I + DVN++ PNI    D R     +NG  +Y   + E +P N +++ I V DKD   NG V C I+     +  F+L       K  Y  QY L     +D E      +F I   D+G+P L  T +++V + D+N+ P +F +    LS+ E N+    + + +  D+D+    +  + L  + +F         L + +G +      DRE+  R+ F++     A+DN      S A V V VLD NDN P++      F + E N+P Y  +G +   D D GEN  +++S            L+ N++        +++   S D E   +   D+   D G P   +   + +N++D NDN P  I P S +    +  ++   G+ +  V A+D D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:  218 YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSL-DREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNI----DLRYIISPINGT-VY---LSEKDPVNTKIALITVSDKDTDVNGKVICFIER----EVPFHL-------KAVYDNQYLLETSSLLDYEGTKE-FSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-------FDLDRKTGVLTASRVFDREEQERFIFTV----TARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLS-----------ILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPS-NTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 74.7146 bits (182), Expect = 3.776e-12
Identity = 135/599 (22.54%), Postives = 246/599 (41.07%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC--QIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP---QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            K+ I + D ND AP F +      + E+  + S      A D ++G  G   Y+L+  +  F    V + +G     ++ +   D    D   + ++  D      K     + + + DVN++RP    G  +              + I EN P    V  ++  D D G N +++     Q     K LF L++   L        + +++S+DRE+ +     ++   D      ++T+   ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +   + LD E +  + F I   +  + +   T  A V V + D NDN P   Q V  +S  + ENN     L  +   D+D G+N+ I              +L  N   F +  +  +L   +  D E        +   D G P   ++ ++IV +LDENDN P++ +    ++       N+   + +  +   DAD+  +  +T  +   +D+  +DP++G I  +++ D E    Y   ++ TD G P R+S+A +TI +   N
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQ-KSSTAILQVTVSDVNDNRPVFKEGQVE--------------VHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGL--------ITVQRSLDREETAI-HKVTVLASDGSSTPARATVT--INVTDVNDNPPNIDLRYIISPINGTVYLSE-KDPVNTKIALITVSDKDTDVNGKVICFIEREV---------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQT--ALVRVKLEDENDNPPIFNQPVIELS--VSENNRRGLYLTTISATDEDSGKNADI------------VYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVN 669          

HSP 3 Score: 69.3218 bits (168), Expect = 1.457e-10
Identity = 71/275 (25.82%), Postives = 118/275 (42.91%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE 1010
            DYE   +F  +++A D G+P L  +  + + + D ND  P F        V E+   G  +  + A D +SG    I+Y+L  N     SF  +D  +G +   + +FD    ++   TV A D+     +     V++ ++D N++ P  +            N +  +   + EN P+   V  I V D D G+N  V   I       + F LD         Y   ++   S DRE+ S+   F +   D GQP   ST  + ++V+D N+
Sbjct:  428 DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREEQERFIFTVTARDNGTPPLQ-SQAAVIVTVLDENDNSPKFT-----------HNHFQFF---VSENLPKYSTVGVITVTDADAGENKAVTLSILND---NDNFVLDP--------YSGVIKSNVSFDREQQSS-YTFDVKATDGGQPPRSSTAKVTINVMDVND 670          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|O35161|CELR1_MOUSE (Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 2.213e-34
Identity = 159/634 (25.08%), Postives = 276/634 (43.53%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFS--------INCQDNGQ-PLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFH---------------LNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSG--NEDLFWISELK---ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E     VL++ A D G P+  ++  L + + D ND +P F    Y + ++E+L VG  +L + A D ++     + Y+L++    +     ID  SG ++  + + D ++     L VEA+D   +      +  V I + D N++ P     S+KR           Y +++ E+   N  V  +   D+D+G+N  +   I +   LK  FYL S              +  S+D   V NPL+F         I  QD G+ PL+ S+ ++ V VLD N+   +F  S +  +++EN     S+L    +D DA                      ++S N  +   F    +  SSG I +   LDRE+   Y F +  V+    +   +S A+VS+ VLD+NDN P +  +  +E++ N   +     L    +D   NS I            T +L+G    + F +S      ++ +   +DY+      + +   D    ++H    + +N+ D N + P  ++ SS    V++S  +   GT +  + A D D+  + R+TY L+       IDP TG I    ++   +   Y L +   DNG P ++ + +L I+I   N
Sbjct:  327 DRETKDTHVLKVSAVDHGSPRRSAATYLTVTVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRLLEG---AGGVFEIDARSG-VVRTRAVVDREEAAEYQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQF---SEKR-----------YVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSIVSGN-LKGQFYLHS--------------LSGSLD---VINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPF-QIHNSSGWITVCAELDREEVEHYSFGVEAVDHG--SPAMSSSASVSITVLDVNDNDPMFT-QPVYELRLNEDAAVGSSVLTLRARDRDANSVI------------TYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASDG--TRSHTA-QVFINVTDANTHRP--VFQSS-HYTVSVSE-DRPVGTSIATISATDEDTGENARITYVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDAN 901          

HSP 2 Score: 105.531 bits (262), Expect = 1.785e-21
Identity = 142/599 (23.71%), Postives = 248/599 (41.40%), Query Frame = 3
Query:  309 APKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL-IKNEDFSTSFVSIDGNSGTIILKKPL----FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLK---NLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQ---PLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTK---FTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFD----DKDIGENSRIS---ISSLTTTCYGP---TEKLSGNEDL-FWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPS-----SLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN----MFQS 1997
            +P+F   +Y   V E+   G+ ++++ A D + GD G++ Y++    ++ S  +  ID  +G +   + L     D   L ++   H S   ++    T++ + + D N+H P                    Y   I EN    +EV  I   D D   N +++      +LL+    +F +D+R  +        +R R  +DRE+ +      +   D G+   PL  S  +  + V D+N+    F+   Y + + E+   N ++L     D+D       H +  +      F+L SL   SG + + NPLD E    Y   I    +AQD  +     S   VSV VLD+NDN P +V          N+P   LG  +      D D GEN+R+    + + +T   G    +E  +   D  F I +    + V   +D E + +    +   D G P   +  S+ + +LD NDN+P +  P      + D  V  S + +       R R  DA+SV + +LT        ++S     G I+L   ++  +   ++      +  R+ +A + I +   N    +FQS
Sbjct:  257 SPQFPLPSYQVSVPENEPAGTAVIELRAHDPDEGDAGRLSYQMEALFDERSNGYFLIDAATGAVTTARSLDRETKDTHVLKVSAVDHGSPRRSAA---TYLTVTVSDTNDHSPVFEQSE--------------YRERIRENLEVGYEVLTIRATDGDAPSNANMR-----YRLLEGAGGVFEIDARSGV--------VRTRAVVDREEAAE-YQLLVEANDQGRNPGPLSASATV-HIVVEDENDNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSL---SGSLDVINPLDFEAIREYTLRI----KAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVP---LGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTL-------RARDRDANSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASDGTRSHTAQVFINVTDANTHRPVFQS 806          

HSP 3 Score: 104.375 bits (259), Expect = 3.766e-21
Identity = 145/629 (23.05%), Postives = 274/629 (43.56%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLV-IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDG---------------NSGTIILKKPL--FDIDKLTLTVEA--HDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMES-FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYVGRMSFE--MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHN-KISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEIS--LTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D+E I ++ L++ A D G+P L +S  LV + ++D+ND AP FV+  +   V E++ +G  +L + A+D ++G+  ++ Y+L+          S+D                +SG I +   L   +++  +  VEA  H S   +S      V I ++DVN++ P  +               P+Y L + E+      V  +   D+D   N  +  Q+ T    +N F L S+      T    L  +Q  +R+ V      ++   D  +     T  + ++V D N +  +F  S+Y++S+ E++    SI + +  D+D         N+   + +E       +   +G I     LD E    Y  +I     AQDN   + +   ++ +++LD NDN P+++ R  ++  + E+  PS  + Q+   D+D G N R+  +          +     +  F+I     +++ ++ +D E +    +     D G P   +  + I V++LD NDN P +      D +      N   G+ + R+RA D D   + ++ Y++   +  +   +D  +G++   +  D E  + D  L V     P+  S A + I +  QN
Sbjct:  538 DFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSS---ASVSITVLDVNDNDPMFT--------------QPVYELRLNEDAAVGSSVLTLRARDRD--ANSVITYQL-TGGNTRNRFALSSQSGGGLITLALPLDYKQ--ERQYV-----LAVTASDGTR---SHTAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGE------NARITYVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAI----TAQDNGIPQKSDTTSLEILILDANDNAPRFL-RDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYT---------FQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVF----EKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEV-RRDYMLVVQATSAPLV-SRATVHIRLLDQN 1110          

HSP 4 Score: 103.99 bits (258), Expect = 5.111e-21
Identity = 114/426 (26.76%), Postives = 183/426 (42.96%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQP-LLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP-----QYVGRMSFEMKENNIPSYELGQLIFDDKDIGEN 1445
            DY+   ++VL + A D  +     + ++ I++ D N   P F + +YT  V ED  VG+ I  + A D ++G+  +I Y L   ED    F  ID ++GTI     L   D    TL + A D+     K D T + I I+D N++ P            + L  +  Y   +FE+ P +  V  ++  D+D G NG +    Q        FY++    +        +R ++ +DRE V+   N      D G P  L +++ +QV VLD N+ P +F +    L + EN    S+++     D D     +           E F L  L   SG++R    LD E    Y   +        +    S ATV + +LD NDN P     Q +       K N+ PS  +G++   D D+ ++
Sbjct:  766 DYKQERQYVLAVTASDGTRSH---TAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARITYVL---EDPVPQF-RIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGI-PQKSDTTSLEILILDANDNAP------------RFLRDF--YQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGV--------IRTQRRLDRENVA-VYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLL---SGDLRALVELDFEVRRDYMLVV-----QATSAPLVSRATVHIRLLDQNDNPPELPDFQILFNNYVTNKSNSFPSGVIGRIPAHDPDLSDS 1152          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9NYQ8|FAT2_HUMAN (Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 4.127e-34
Identity = 152/602 (25.25%), Postives = 268/602 (44.52%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSK-FDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTII-LQVDVLDQNE--YPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIP-SYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELK-AKHDSISIDPFTGEISLTKDIEAGKYDLF-LQVTDNGNPMRNSSANLTI 1967
            DYE    ++L +   D+G PQ  S + L +++ D ND AP+F    Y   + ED  VG+ I ++   D +S D G++ Y L+      T   S+   +G +++   L      +  L VEA D      + F  T ++I + DVN++ P      ++              L++ E+ P    ++F++  D D G  G+V+       +L +  +   R+ L        L + + +D E+ +   N S+   D G+PL + T+  ++V VLD NE  +P  F    +   + EN  + + ++  A  D D+    E          + +F   S+ Q +G I+   PLDRE +  Y  ++  V+    +   +S   V + V D NDN PQ    + +   + + P    + QL   D D     +++ +  +    G           F I  +  +L   Q +D E      +++   D G P   +   ++V ILD NDN P  I+   L NV     ++  S   + R+ A D D   + R+TY ++ +  ++ SID  TG +S +    AG+Y++  ++ TD+G P  ++S  L I
Sbjct:  779 DYEATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIAELTTKDADSEDNGRVRYTLLS----PTEKFSLHPLTGELVVTGHLDRESEPRYILKVEARDQPSKGHQLFSVTDLIITLEDVNDNSPQCITEHNR--------------LKVPEDLPPGTVLTFLDASDPDLGPAGEVR------YVLMDGAHGTFRVDLMTGA----LILERELDFERRAG-YNLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQVQENSPSGTQVIVVAAQDDDSGLDGELQYFLRAGTGLAAF---SINQDTGMIQTLAPLDREFASYYWLTVLAVDRG--SVPLSSVTEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMG----------FFMIHPVTGLLSTAQQLDRENKDEHILEVTVLDNGEPSLKSTSRVVVGILDVNDNPP--IFSHKLFNVRLPERLSPVSPGPVYRLVASDLDEGLNGRVTYSIEDSDEEAFSIDLVTGVVSSSSTFTAGEYNILTIKATDSGQPPLSASVRLHI 1334          

HSP 2 Score: 98.2117 bits (243), Expect = 2.742e-19
Identity = 147/595 (24.71%), Postives = 239/595 (40.17%), Query Frame = 3
Query:  234 ACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKN---EDFSTSFVSIDGNSGTIILKKP-------LFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKL--LKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPL-LKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFN-EFHLNSSNNFNMESFHLSSLTQSSGEIRIGN--PLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQ-----YVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELK-AKHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPM 1940
            A D G P   S   + + ++      PKF    YT    EDL  GS I  V A+  +      +IY L++    E       S+D ++G I ++KP       L+ ID     V AH   ++        V I + DVN++RP       K   T              EN P    V  +  +DKD G++G V  ++       +  LF +DS            +   Q +D E      +F +   D+GQ + L S  ++QV + D+N+    F    Y  S++EN +   +++    +D D    N +     +    +  F +S   Q   E RI +   LDRE + +Y   +        + KF +  TV + VLD+NDN PQ     Y G+    + E+  P + + ++   D D   N++I+ S      +GP     G  +         L    ++D E      +     D G      +  I +++ D NDN P + +PS     V     N    T +  V A D D  ++ ++ Y L  +     SID  TG I L K ++       +L ++ +D G P+
Sbjct: 2663 AQDGGPPHWNSLVPVRLQVVPKKVSLPKFSEPLYTFSAPEDLPEGSEIGIVKAVAAQD----PVIYSLVRGTTPESNKDGVFSLDPDTGVIKVRKPMDHESTKLYQID-----VMAH-CLQNTDVVSLVSVNIQVGDVNDNRPVFEADPYKAVLT--------------ENMPVGTSVIQVTAIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESGW--------ITTLQELDCETCQT-YHFHVVAYDHGQTIQLSSQALVQVSITDENDNAPRFASEEYRGSVVENSEPGELVATLKTLDADISEQNRQVTCYITEGDPLGQFGIS---QVGDEWRISSRKTLDREHTAKYLLRV-----TASDGKFQASVTVEIFVLDVNDNSPQCSQLLYTGK----VHEDVFPGHFILKVSATDLDTDTNAQITYS-----LHGP-----GAHEFKLDPHTGELTTLTALDRERKDVFNLVAKATDGG--GRSCQADITLHVEDVNDNAPRF-FPSHCAVAV---FDNTTVKTPVAVVFARDPDQGANAQVVYSLPDSAEGHFSIDATTGVIRLEKPLQVRPQAPLELTVRASDLGTPI 3196          

HSP 3 Score: 97.4413 bits (241), Expect = 4.521e-19
Identity = 129/593 (21.75%), Postives = 247/593 (41.65%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLT--VEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKN---LFYLDSRMRLNKNTYQYKLRIRQSIDREKVS-NPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW---IYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL--KAKHDSISIDPFTGEISLTKDIEAGKYDLF---LQVTDNGNPMRNSSANLTI 1967
            G+   C+ +   I + D ND  P+F A  YT  +Q +++  S +++V A D + G    + Y  +  ED     + I+  +G + +K  L  ++  TL   ++A D    +    W  +V   + V   + ++   S+           P+Y     E+ PE  E+  +  V     ++  +   ++ T    N   +F LD    +        +++R+ +D E      ++   +C  N    + S + + + V D N+   +F    Y   + EN     S++    ID+D     +     S +       L ++   SG I     LD E    Y F +   +  Q   + +S A V V + D NDN P++    S E + + + + E G+L+      D DI E +R        TCY       G   +  + +   +  ++++D E      + +   D  F      +++ + +LD NDN P+    +Y   +       H ++  G  + +V A D D+ ++ ++TY L     H+   +DP TGE++    ++  + D+F    + TD G   R+  A++T+
Sbjct: 2564 GRVAFCTVK---IILTDENDNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQNADVTYS-VNPEDLVKDVIEINPVTGVVKVKDSLVGLENQTLDFFIKAQDGGPPH----WNSLVPVRLQVVPKKVSLPKFSE-----------PLYTFSAPEDLPEGSEIGIVKAV---AAQDPVIYSLVRGTTPESNKDGVFSLDPDTGV--------IKVRKPMDHESTKLYQIDVMAHCLQNTD--VVSLVSVNIQVGDVNDNRPVFEADPYKAVLTENMPVGTSVIQVTAIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESGWITTLQELDCETCQTYHFHVVAYDHGQ-TIQLSSQALVQVSITDENDNAPRFA---SEEYRGSVVENSEPGELVATLKTLDADISEQNR------QVTCYITEGDPLGQFGISQVGDEWRISSRKTLDREHTAKYLLRVTASDGKF---QASVTVEIFVLDVNDNSPQCSQLLYTGKV-------HEDVFPGHFILKVSATDLDTDTNAQITYSLHGPGAHE-FKLDPHTGELTTLTALDRERKDVFNLVAKATDGGG--RSCQADITL 3101          

HSP 4 Score: 93.5893 bits (231), Expect = 7.333e-18
Identity = 146/565 (25.84%), Postives = 232/565 (41.06%), Query Frame = 3
Query:  264 SSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFVSIDGNSGTIILKKPLFDID----KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVV--LDINDNVPQ-----YVGRM-------SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPK--NHNKISIIVNILDENDNEP---EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISL 1874
            ++Q  +  I +IN   P+F+   Y   V +D   G  +L+V AID++ G    +IY +  ++D  S S   +D +SG ++    L D+     + TLTV   D  E   K ++  V I + D N H P           TQL      Y   + +      E+  +  +D D G N +V        LLK     +S    N N     + + Q +D+   + P   ++  +D G P       + + V   +    +F++S Y + I E+    S IL  + +    +++     N    F+M S+        SG I     LD EK   YQ  I   N A       +F  V VVV  +D NDN P      +VG++       S  M +NN P      +   D D   NS +    L        E L      F I   +  L +   MDYE + + +  ++ HD+G P         +I+++ D ND+ P   E IY  ++          I  G +L  VRA D DS     + Y +K  +  ++++I P TG IS+
Sbjct: 1430 ATQVHIFMIANINHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQDKGK--SLIYTIHGSQDPGSASLFQLDPSSGVLVTVGKL-DLGSGPSQHTLTVMVRDQ-EIPIKRNFVWVTIHVEDGNLHPPRF---------TQLH-----YEASVPDTIAPGTELLQVRAMDADRGVNAEVH-----YSLLKG----NSEGFFNINALLGIITLAQKLDQANHA-PHTLTVKAEDQGSPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSPSEVTYELREGNKDGVFSMNSY--------SGLISTQKKLDHEKISSYQLKIRGSNMA------GAFTDVMVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNPFV----IHASDSDKEANSLLVYKILE------PEALK----FFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPVLFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAIVG-------PIHPGMELLMVRASDEDS----EVNYSIKTGNADEAVTIHPVTGSISV 1927          

HSP 5 Score: 90.5077 bits (223), Expect = 6.296e-17
Identity = 151/601 (25.12%), Postives = 255/601 (42.43%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED---FSTSFVSIDGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEF-HLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK---HDSISIDPFTGEISLTKD----IEAGKYDLFLQVTDNGNPMRNS 1949
            DY+ + K+ L++IA D G P L S +++++ +   N   P F +  Y   V E++ + + IL   A    S +  ++IY +++ E    F+T F      +G + +  PL D +   K   TV A D+A     F    V + + DVN++ P  S         QL     +Y   I E  P    V  +   D+D G+N DV  QI       + F+     ++N +T +  +   Q +D E   +  +  +   D G P L    ++ V+V D N+ P  F +  Y  ++ E       +L    ID D+   +   +L  S N +   F    +  SSG I + N   +     Y   +     A D   F +   V +   + N   P++   +   E+ EN +   ++  L+  DKD G    I  + +       +EK S N +   I+ L+ L  + S +        I +   D G       + II+   DENDN P++    + +  V+I   N+   + + +V A DAD   +  +TY +  +    D I I+P TG + + KD    +E    D F++  D G P  NS
Sbjct: 2132 DYQALNKYHLKVIARDGGTPSLQSEEEVLVTV--RNKSNPLFQSPYYKVRVPENITLYTPILHTQA---RSPEGLRLIYNIVEEEPLMLFTTDF-----KTGVLTVTGPL-DYESKTKHVFTVRATDTAL--GSFSEATVEVLVEDVNDNPPTFS---------QL-----VYTTSISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFF-----QINGSTGE--MSTVQELDYEAQQH-FHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHFF----INSSSGIISMFNLCKKHLDSSYNLRV----GASDGV-FRATVPVYINTTNANKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDYTIINKLA---SEKFSINPN-GQIATLQKLDRENSTERVI----AIKVMARDGGGRVAFCTVKIILT--DENDNPPQF---KASEYTVSIQS-NVSKDSPVIQVLAYDADEGQNADVTYSVNPEDLVKDVIEINPVTGVVKV-KDSLVGLENQTLDFFIKAQDGGPPHWNS 2673          

HSP 6 Score: 84.7297 bits (208), Expect = 3.331e-15
Identity = 145/617 (23.50%), Postives = 260/617 (42.14%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYF-LEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSR---MRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTI-ILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNE-DLFWISELKI-LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVS-----SNRLTYELKAKHDSISIDPF--TGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMF 1991
            D E   K++L++ A D G+ Q  +S  + I ++D+ND +P+     YT  V ED+  G  ILKV A D ++    +I Y L            +D ++G +     L     D   L  +A D    + + D   + + + DVN++ P                 +P +  + +F+N      V+ +   D D+G N  V   +  +   +  F +D+    +RL K      L++R          PL  ++   D G P+  ST+  + V V+   +Y  +F  + +S+ + E+      +L  A + +       + + S N      F L + T   G + +   LD E SP+Y  SI    ++   +  +   TV V + D+N++ PQ+     S  + EN +    +  +   D+D   NS I+ S            + GN+   F I   K  LQV +++D E   +  + +   D G P  H    I + + D NDN P +   +    V   S I    G+K+ ++   D DS       S R+T         ++ D +  T E  L++  +   Y L +Q +D+G P  +S  ++ + + +Q+ +
Sbjct: 2973 DREHTAKYLLRVTASD-GKFQ--ASVTVEIFVLDVNDNSPQCSQLLYTGKVHEDVFPGHFILKVSATDLDTDTNAQITYSL---HGPGAHEFKLDPHTGELTTLTALDRERKDVFNLVAKATDGGGRSCQAD---ITLHVEDVNDNAPRF---------------FPSHCAVAVFDNTTVKTPVAVVFARDPDQGANAQVVYSLPDSA--EGHFSIDATTGVIRLEK-----PLQVRPQA-------PLELTVRASDLGTPIPLSTLGTVTVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEVLQLATLTRPGAEKTGYRVVSGNE--QGRFRLDART---GILYVNASLDFETSPKYFLSIECSRKSS--SSLSDVTTVMVNITDVNEHRPQFPQDPYSTRVLENALVGDVILTVSATDEDGPLNSDITYS-----------LIGGNQLGHFTIHPKKGELQVAKALDREQASSYSLKLRATDSGQPPLHEDTDIAIQVADVNDNPPRFFQLNYSTTVQENSPI----GSKVLQLILSDPDSPENGPPYSFRITKGNNGSAFRVTPDGWLVTAE-GLSRRAQE-WYQLQIQASDSGIPPLSSLTSVRVHVTEQSHY 3527          

HSP 7 Score: 78.1814 bits (191), Expect = 3.457e-13
Identity = 98/398 (24.62%), Postives = 166/398 (41.71%), Query Frame = 3
Query:  651 DKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTK--LLKNLF----YLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF--ATVSVVVLDINDNVPQYVGRMSFEMKENNIPS-YELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTY 1814
            D RT  ++  G     +E   +NP  F+      + +D  + GDV  Q+  T   L  N      + +       + Y   + +++  D + + N  +  +  +D G P L+S   + V V  +N+   LF    Y + + EN   ++     ++   A S     L   N    E   L +    +G + +  PLD E   ++ F++   +     T   SF  ATV V+V D+NDN P +   +        +P+   + QL+  D+D G N  +S        Y   E  S     F I      +   Q +DYE   +  + +   D+G P    +  ++VN+ D NDN PE+  P    NV  ++      G  + +V+AID DS  ++RL Y
Sbjct: 2044 DNRTPQRVAQGLVRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSATDEDLGTNGAVTYEFAEDYTYFRIDPYLGDISLKKPFDYQAL-NKYHLKVIARDGGTPSLQSEEEVLVTV--RNKSNPLFQSPYYKVRVPENITLYT----PILHTQARSPEGLRL-IYNIVEEEPLMLFTTDFKTGVLTVTGPLDYESKTKHVFTVRATD-----TALGSFSEATVEVLVEDVNDNPPTFSQLVYTTSISEGLPAQTPVIQLLASDQDSGRNRDVS--------YQIVEDGSDVSKFFQINGSTGEMSTVQELDYEAQQHFHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELA----TCGHLVLKVQAIDPDSRDTSRLEY 2416          

HSP 8 Score: 75.8702 bits (185), Expect = 2.023e-12
Identity = 119/480 (24.79%), Postives = 201/480 (41.88%), Query Frame = 3
Query:  588 THVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKS---TIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNP---LDREKSPRYQFSIFVVNEAQDNTKFTSFATVSV-VVLDINDNVP-----------------QYVGRMSFEMKE---NNIPSYELGQLI--FDDK-----DIGE----NSRISISSLTTTCYGPTEKL-----SGNEDLFWISELK--ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIE 1889
            T VVI I+D NNH P  +  S              Y   + EN P    V  +   D+D G+NG V   I   K L   F +D  + +        +   + +D E +     F +   D G P  +    +I LQ+  L+ N+   +F   N + SI ++     SI++ + ID D L   ++ + S N   +E F L+     SG I +  P   L   +   Y   I     A D   + S  T+++ VV D +  VP                  ++G  + E  +    ++ +Y++      F+D      D+ E    N+ ++  + T    G   KL      GNE+  +  EL+  +L V   +DYE  +   +++  +D G P+  +   + VN+ D NDN P +  P      + IS  + + GT +  +   DADS  + R+ Y L +  +  S+ P TGE+ +T  ++
Sbjct:  442 TVVVIDIVDCNNHAPLFNRSS--------------YDGTLDENIPPGTSVLAVTATDRDHGENGYVTYSIAGPKALP--FSIDPYLGI--------ISTSKPMDYELMKRIYTFRVRASDWGSPFRREKEVSIFLQLRNLNDNQ--PMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDELQNLKYEIVSGNE--LEYFDLNHF---SGVISLKRPFINLTAGQPTSYSLKI----TASDGKNYASPTTLNITVVKDPHFEVPVTCDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQSIDVLESVPINTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIELETGLLTVAAPLDYEATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFP-PGGYQ--LTISE-DTEVGTTIAELTTKDADSEDNGRVRYTLLSPTEKFSLHPLTGELVVTGHLD 882          

HSP 9 Score: 69.3218 bits (168), Expect = 2.164e-10
Identity = 121/585 (20.68%), Postives = 249/585 (42.56%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDII--DINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-KILQVKQSMDYEFIHNCKID--IHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLF 1910
            DYE   K V  + A D     L S  +  ++++  D+ND  P F    YT  + E L   + ++++ A D++SG    + Y+++++    + F  I+G++G +   + L ++  +   + V A D  +     + T VV+ + D+N++ P                  P Y   + E       V  +  +D D      ++  I +    ++ F       +N ++    +    ++ ++ + +  N  +   D    + ++T+ + ++  + N+Y   F +  Y   + EN      ++    ID+D+  +        N    E F ++     +G+I     LDRE S     +I V+  A+D     +F TV +++ D NDN PQ+     +  ++ N      + Q++  D D G+N+ ++ S        P + +   +D+  I+ +  +++VK S+    + N  +D  I   D G P  ++ + + + ++ +  + P++  P    S+ +++   S I I     +  V A D    S  R T     K    S+DP TG I + K ++     L+
Sbjct: 2232 DYESKTKHVFTVRATDTA---LGSFSEATVEVLVEDVNDNPPTFSQLVYTTSISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQINGSTGEMSTVQELDYEAQQHFHVKVRAMDKGDPPLTGE-TLVVVNVSDINDNPPEFR--------------QPQYEANVSELATCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHFF-------INSSSGIISMF---NLCKKHLDSSYNLRVGASDG---VFRATVPVYINTTNANKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDYTIINKLASEKFSINP----NGQIATLQKLDRENSTERVIAIKVM--ARDGGGRVAFCTVKIILTDENDNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQNADVTYS------VNPEDLV---KDVIEINPVTGVVKVKDSL--VGLENQTLDFFIKAQDGGPPHWNSLVPVRLQVVPKKVSLPKFSEPLYTFSAPEDLPEGSEIGI-----VKAVAAQDPVIYSLVRGTTPESNKDGVFSLDPDTGVIKVRKPMDHESTKLY 2763          

HSP 10 Score: 67.781 bits (164), Expect = 5.479e-10
Identity = 146/613 (23.82%), Postives = 245/613 (39.97%), Query Frame = 3
Query:  222 LQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRP----NISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQV--DVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNP----LDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLF-WISELKILQVKQ-SMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTK--DIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN--MFQS 1997
            L + A D G PQ      ++I +   +  AP F    Y   + E + VGS IL V A+        ++ Y+L   E       S++  SG I  +K L D +K++   L +   + A     F    VV+ IID N++ P    +  VG       Q+    P+Y + I + N   F    I+  D D+  N  +  +I   + LK  F +D  M          L I   +D E + +   F +   D G P+L +    QV   V D N+ P  F+   Y ++I+        +L     D+D  S   + + + N     + H       +G I + NP    L R+ + R    ++     QD       A V + +  + D   Q+   + +   + N+   +   +I   +    N  +S   L  T            D+F  +    +LQ +  + D E     ++ +   D   P+   +  + V+I D NDN P++ +         I     + G  L +V A D D  ++  +TYE    +    IDP+ G+ISL K  D +A  KY L +   D G P   S   + + +  ++  +FQS
Sbjct: 1628 LTVKAEDQGSPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSPS-----EVTYEL--REGNKDGVFSMNSYSGLISTQKKL-DHEKISSYQLKIRGSNMA---GAFTDVMVVVDIIDENDNAPMFLKSTFVG-------QISEAAPLYSM-IMDKNNNPF---VIHASDSDKEANSLLVYKILEPEALK-FFKIDPSMG--------TLTIVSEMDYESMPS-FQFCVYVHDQGSPVLFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDED--SEVNYSIKTGNADEAVTIH-----PVTGSISVLNPAFLGLSRKLTIRASDGLY-----QDT------ALVKISLTQVLDKSLQFDQDVYWAAVKENLQDRK-ALVILGAQGNHLNDTLSYFLLNGT------------DMFHMVQSAGVLQTRGVAFDREQQDTHELAVEVRDNRTPQRVAQGLVRVSIEDVNDNPPKFKHLP----YYTIIQDGTEPGDVLFQVSATDEDLGTNGAVTYEFAEDYTYFRIDPYLGDISLKKPFDYQALNKYHLKVIARDGGTPSLQSEEEVLVTVRNKSNPLFQS 2173          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9H251|CAD23_HUMAN (Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 1.154e-33
Identity = 156/618 (25.24%), Postives = 279/618 (45.15%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FD-IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNF-SINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES--FHLSSLTQ-----SSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSF-EMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMD-YEFIHNCKIDIHFHDEGFP--KNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI--NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSIS--IDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            DYE + ++   L A +   P      K+ I +I+ ND  P F    Y   + E++ VG+ +L V A D ++G FG++ Y    + D      S+D ++G I+L   L ++ I + TLT+ A D     +      V I ++DVN++ P     +              Y   + EN P   ++  +   D+D   N  +   I +     +  Y D  +          + + + +D E++SN L + ++   D G P L ST+ + ++V D+N+ P  F++  Y +S++EN     I++ A +    L  N   L+ S  +  ES  + L   TQ      SGEI   + LDRE    Y   +  V+    + + T  ATV++ +LDINDN P +     +  + E   P  ++  ++  D D+GEN      +L  +   P +  S N     I     +  +++ D +E     KI +   D G P  K  +  ++ VN+LD NDN+P      +  N+  ++ +   I +G  + +V AID D   +  ++Y +      +   I+  +G +  T +++     +Y L +  +D G P ++S++ LTI +   N
Sbjct:  420 DYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDDPDR----FSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGGEETT---GRVRINVLDVNDNVPTFQKDA--------------YVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIVSASAFGS--YFDISLYEGYGV----ISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVEN-----IMAGATV----LFLNATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGEN-----GTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDP------TFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVN 989          

HSP 2 Score: 118.242 bits (295), Expect = 1.932e-25
Identity = 140/598 (23.41%), Postives = 261/598 (43.65%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQ-PQLCSSQK--LVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVIL----KVHAIDRESGDFGKIIYKLIKNE----DFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNEFHL------NSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQD---NTKFTSFATVSVVVLDINDNVPQYVG-RMSFEMK---ENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFL 1913
            D E IP++ L +   D  + P++       L+I + D ND  P F    Y   V E+   G+ +      + A+D +   +  + Y+L+  +    D ++S   +   SG +I+ +  F    L L + A D    NS     H++I I+D N++RP  S  +                + + EN P  F V  +   D+D G NG++  +I+     + L +L + +    N          +IDRE+  +    ++   D G   L  T I+ + + D N+    F     ++S++E+ +  ++++    ID D     E+H+      + ++          ++  ++G + + +P++RE    Y+ ++ V++ A D    +     A ++V VLD+NDN PQ+    +++ M+   E   P   L  +   D D G N  ++ + L     G  +     ED    S    +   +++DYE +H     +   D G P    +I + + I+D NDN P +  PS  + V      ++  GT +  V A DADS +   + Y L       +I+P TG+I +   ++  K D ++
Sbjct: 1915 DRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSG-VIIDREAFSPPILELLLLAEDIGLLNST---AHLLITILDDNDNRPTFSPAT--------------LTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHLVTGVIRVGNA---------TIDREEQES-YRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQL----ED----SSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFE----DVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYI 2472          

HSP 3 Score: 115.161 bits (287), Expect = 1.967e-24
Identity = 151/625 (24.16%), Postives = 270/625 (43.20%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHN--SKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFIN----VVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNP-LNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMES-------FHLSSLTQSSGEIRIGNP-LDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGN-EDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISI-----IVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGK--------------YDLFLQVTDNGNPMRNS 1949
            D E I  + L + A D G P L S+  + I ++DIND  P  +       + E+  V S +  V A D +SG   ++ + +         F  I+  +G + + +PL    I +  LT+   D+ E+   ++ D+  ++IF+ D N++ P  +    K T          Y  E+ EN+P    ++ +N     +D D+     V  Q+   +    LF       +N +T    +R    IDRE  S P L   +  +D G  LL ST  L + +LD N+    F+ +  ++ ++EN    FS+L     D+D+       LN    + +E+        HL      +G IR+GN  +DRE+   Y+ ++   +        +  A V++++ DIND+ P+++  + +  + E+  P   +  +   D D+  N ++    +       T++L  N ED F ++     + VK  M+ E +   ++ +   D         +S+      VN+LD NDN P++  P  +   +         GT L  V A+D D   +  +TY L      + + P  G + L +D  AGK               +  ++ +DNG+P R +
Sbjct: 1810 DRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFF--INATTGIVTVNRPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFT----KST----------YQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQ--SGLF------DINSSTGVVTVRSGVIIDREAFSPPILELLLLAEDIG--LLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDS------GLNGELVYRIEAGAQDRFLIHL-----VTGVIRVGNATIDREEQESYRLTVVATDRG--TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDL--NPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQF-KPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTL------LDLVP-PGYVQL-EDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAA 2384          

HSP 4 Score: 114.775 bits (286), Expect = 2.197e-24
Identity = 154/608 (25.33%), Postives = 257/608 (42.27%), Query Frame = 3
Query:  255 QLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQT--TKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPL---NFSINCQ-----DNGQPLLKS-TIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSI-LSFAVIDQDA-LSFN---EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELK-----AKHDSISIDPFTGEISLTK-----DIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            Q   ++K+ I + D+ND AP F  + Y+  + E+  VG+ I  V+A D + G  G ++Y         + F +ID   G + + + L         LTV A D  +        ++ I I DV +  P             +    P Y   I+E++P    V  I  +D+D+G+   +   I +  T  +  L Y+   + LN             +DRE   NPL    F +  +     D+  P   + T    + V+D N+    F  S YS++I E  +  F++ L   V+D+D  L  N   E +L  +N+ +      S   ++   IR+  PLD E   RY F +F      D+     +A V + +++ NDN P +   + +  + EN      +  ++  D D G    +S               S + D F +  +  ++ +   +DYE I    + I   D G  +   ++ I  N+LD NDN P +      D  V     N  S T+L R+RA D DS  +N++TY +        +  IS+    G IS+++      I  G   L +   D GNP  NS+  +TI ++ +N
Sbjct:  111 QGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQP----PSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDP-------------IFINLP-YSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNG-----------LLDRE---NPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDH---VGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYF------------FSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGGEETTGRVRI--NVLDVNDNVPTF----QKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDEN 665          

HSP 5 Score: 112.079 bits (279), Expect = 1.486e-23
Identity = 151/597 (25.29%), Postives = 274/597 (45.90%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKV-VQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF--VSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPI-YFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD--NFSILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKS-PRYQFSIFVVNEAQD-NTKFTSFATVSVVVLDINDNVPQYVG--RMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQ--SMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDIEAGK---YDLFLQVTDN 1928
            + L ++A D G P++ S+ K+ I ++D ND +P+F   + + V + ED  VG  +  V A D ++G  G++++ L    + + +F  V+ + + G + + +PL   ++D   L V A D      K D  H++ + I+D+N++ P I                P  Y + + EN      V  +   D+D G N  +   I  T+  K++ +     R+++ + +   R     DRE+ S   +     +D G P L +T  + V ++D+N+   +F + +Y + + E  D  N S+++   +D D      +++     N  N F ++  H+       G I     LD E S  RY   +   ++    + + TS  TV V V DINDNVP +       FE+ E   P   +   +  D+D G N ++  S +     G           F IS ++ +L+V++   +D E I    + I   D G P   + + + + +LD NDN+P  +   +L   + IS  N    + +  V A DADS  + RLT+ + A  +  +  I+  TG +++ + ++  +   Y L + V DN
Sbjct: 1385 YTLTVVADD-GGPKVDSTVKVYITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRVATVKAWDPDAGSNGQVVFSLASG-NIAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVASDRGTPPRKKD--HILQVTILDINDNPPVIE--------------SPFGYNVSVNENVGGGTAVVQVRATDRDIGINSVLSYYI--TEGNKDMAF-----RMDRISGEIATRPAPP-DRERQSF-YHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIVNTFRIDR-HM-------GVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQ-PGPRVWTFLAHDRDSGPNGQVEYSIMDGDPLGE----------FVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLL---NLPMNITISE-NSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYKLTISVKDN 1931          

HSP 6 Score: 105.145 bits (261), Expect = 2.131e-21
Identity = 108/399 (27.07%), Postives = 177/399 (44.36%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDS---AEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-----FAVIDQDAL--SFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV 1355
            DYE +      + A D G P   +   + ++I+DIND  P F   +Y + V ED+ VG++IL V A D +SG+F  I Y L   E    S  +I+  +G I +   L     D   LT  A D+      N + +   VVI ++DVN+ RP  S               P +   ++EN P    V  +   D+DEG NG++   ++   +    F++D  M     T Q  L   QS ++       + ++   D G+P L  T +L V+V+D N+   +F R     +I+  ++   + S     +A    + L  +     L ++ N + E F +  +   SG I+    LDRE    Y   I V ++      + +   + V + DI+DN P +V
Sbjct: 2361 DYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGE----SKFAINPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFS--------------KPQFSTSVYENEPAGTSVITMMATDQDEGPNGELTYSLEGPGV--EAFHVD--MDSGLVTTQRPL---QSYEK------FSLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNG-TILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPI---SGLIQTAQRLDRESQAVYSL-ILVASDLGQPVPYETMQPLQVALEDIDDNEPLFV 2723          

HSP 7 Score: 101.679 bits (252), Expect = 2.331e-20
Identity = 141/635 (22.20%), Postives = 262/635 (41.26%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQ--PQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDIDK---LTLTVEA--HDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-----------QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMES-FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQD-NTKFTSFATVSVVVLDINDNVPQ--YVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSIS--IDPFTGEISLTKDIEAGK-----YDLFLQVTDNGNPMRNSSANLTIIIYQQN----MFQ 1994
            D E    ++L L A D G    +   +  + + ++D+ND  P F+  +Y   V ED+  G  IL++ A D + G+FG++ Y+++     +   + +   S  ++++ P   D ++     L VEA  HD     S      V++++ D+N+  P  +     R             L + E       V  +   D+D G  G V  +I           ++T L+  + YLD      K +Y                     +++  D   P  +    + + +L++ +    F+ ++Y  +I+EN      I+       D L+   +  N+  +   ++ F + ++T   G I +   +DREK   Y  ++     A D   K  S   V + VLD NDN P+  +    +  + E+      +  +   D D G N ++  S  +    G  E ++ N+ +  +       V + +D E + +  + +   D G P       + V ILD NDN P    P   +  VN    N+  GT + +VRA D D   ++ L+Y +   +  ++  +D  +GEI+ T+     +     Y L   V D G P  +++ ++ + I  +N    MFQ
Sbjct: 1059 DRETTAAYMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYRILHGNHGNNFRIHV---SNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSS---VRVIVYVEDINDEAPVFTQQQYSR-------------LGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDESTGLIITVNYLDYE---TKTSYM-------------------MNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAIT---GVITVQGLVDREKGDFYTLTVV----ADDGGPKVDSTVKVYITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRVATVKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVF------VARPLDREELDHYILQVVASDRGTPPRKKDHILQVTILDINDNPPVIESPFGYNVSVN---ENVGGGTAVVQVRATDRDIGINSVLSYYITEGNKDMAFRMDRISGEIA-TRPAPPDRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQ 1635          

HSP 8 Score: 88.5817 bits (218), Expect = 2.647e-16
Identity = 123/525 (23.43%), Postives = 222/525 (42.29%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-VSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSAEHNSKFDWT-HVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDV--LDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE---FHLNSSNNFNMESFHLSSLTQSSGEIRIGNP-LDREKSPRYQFSIF------VVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSF--EMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPS 1703
            DYE I +F L +IA D G  +  ++ ++ I+++D+ND  P F    Y   ++E+    + ++++ A D +S    +I Y ++    F + F +S+    G I + +PL D ++++     LTV A D+   N   + T  V I + D N++ P  S               P YF+ + EN      V F+N  D D  +    +  I         + L+   +   N    ++     +DRE  S  +   +   D G    + T I  V++  LD N+    +  + Y ++++E    +  + +   +D D L  N    + +   N F        SL  ++G+IR  +  LDRE    ++  +       V +  +   K TS ATV V +LD+NDN P +   + F  E+ E       + Q++  D D G N  +S                   D    S   ++     +D E I   ++ +   D G P   +  ++ +++LD ND  P + +P+
Sbjct:  522 DYELIQRFTLTIIARDGGGEE--TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPL-DYEQISNGLIYLTVMAMDAG--NPPLNSTVPVTIEVFDENDNPPTFS--------------KPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESII---------YSLEGSTQFRINARSGEITTTSLLDRETKSEYI-LIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPD-LGENGTLVYSIQPPNKF-------YSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTF-QNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMP---------RMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTF-FPA 998          

HSP 9 Score: 82.8037 bits (203), Expect = 1.592e-14
Identity = 145/622 (23.31%), Postives = 267/622 (42.93%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLI-KNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYS-LSIIENKD-NFSILSFAVIDQDA--LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIG-ENSRI---SISSLTTTCYGPTEKLSGN-EDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFT-----GEISLTKDIEAGKYDLF-LQV--TDNGNPMRNSSANLTIIIYQQN 1985
            D E I ++ L+++A D G P   S+  L I ++D+NDE P F    Y   V ED+     ++ ++  D + G   ++ Y +   N D   S    D    T++       +D+ T     L +EA D+     +   T  V + ++DVN++RP     S              Y   + E+ PE   +  +   D DEG+ G V  +I       N      R+ ++       +R  + +DRE+ S+ +   +   ++    ++S++ + V V D N+   +FT+  YS L + E      S++     D+D+       + + S      E      + +S+G I   N LD E    Y  ++   ++A    +   F +V + +L+  D   Q+              SYE    I ++  +G E  R+   SI +L    Y      S   + LF I  +  ++ V+  +D E      + +   D+G PK  + + + + +LDENDN P + + S  D+ V+I   +   G ++  V+A D D+ S+ ++ + L + + + + +  T     GE+ + + ++  + D + LQV  +D G P R     L + I   N
Sbjct:  954 DRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVV------GLDRETTAAYMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSS--------------YEASVPEDIPEGHSILQLKATDADEGEFGRVWYRILHGNHGNNF-----RIHVSNGLL---MRGPRPLDRERNSSHV-LIVEAYNHDLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFE------IDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQ--GFCSVYITLLNELDEAVQFSNA-----------SYEAA--ILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFYTLTV-VADDGGPKVDSTVKVYITVLDENDNSPRFDFTS--DSAVSIPE-DCPVGQRVATVKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVASDRGTPPRKKDHILQVTILDIN 1521          

HSP 10 Score: 79.7221 bits (195), Expect = 1.377e-13
Identity = 131/558 (23.48%), Postives = 233/558 (41.76%), Query Frame = 3
Query:  342 VVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINC--QDNGQPL--LKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK-DNFSILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFV------VNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIF----------DDKDIGENSRISISSLTTTCY----GPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNIS-HINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVT 1922
            ++ ED  VGS + ++ A D    D   +++ +   E  ++ F +++ ++G + L++PL    K   TVE   S   +       V I + DVN++ P               +  P Y + I EN P    +  +N  D D G  G V    Q        F +DS   +        + + + +D E  +     ++N   QD  +PL  L +  I+  DV D +    +F    YS +I E+     ++     IDQD      + +     N+++ F ++          SG + +   LDRE +P Y     +      +N+ +  +  T   T +++V+DINDN P+      F   E ++   EL Q+ F           D+++G NS   +  +    +     PT  + G  D+        ++V   +DYE +     D+ F +E  P +     + + +++ENDN P +  P     + NIS + N+  GT +  V A D D+ +   ++Y      D  S+D  TG I L   ++   Y+L  + T
Sbjct:   41 LISEDTPVGSSVTQLLAQDM---DNDPLVFGVSGEE--ASRFFAVEPDTGVVWLRQPLDRETKSEFTVEF--SVSDHQGVITRKVNIQVGDVNDNAPT-------------FHNQP-YSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPP---SQFFAIDSARGI--------VTVIRELDYET-TQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMD---PIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYI--------SGVLTLNGLLDRE-NPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPE------FNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPT-SVQGKADIR-------IRVAIPLDYETVDRYDFDL-FANESVPDHVGYAKVKITLINENDNRPIFSQP-----LYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLD---YELIQRFT 530          

HSP 11 Score: 74.3294 bits (181), Expect = 5.883e-12
Identity = 149/618 (24.11%), Postives = 256/618 (41.42%), Query Frame = 3
Query:  210 PKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKD-----EGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTII-----LQVDVLDQNE-YPAL--FTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQ----SSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVV--VLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS----ELKI--------LQVKQSMDYE----FIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH-DSISIDPFTGEISLTKDIEA-GKYDLFLQVTDNGNP 1937
            P   L L+A DIG   L S+  L+I I+D ND  P F     T  + E+   G  +L+V A D +SG  G+++Y++   E  +     I   +G I +     D ++     LTV A D          T +V I I D+N+ RP            + LN  PI  + + E+      ++ I  +D D     E     +  +  T +L+ N    +    +N NT    + ++  ++RE V+     +++  DN   L + ++      L V+VLD N+  P    F  + Y   I+E      ++++ A +D D        LN    + +         Q    S+G++     +D E+     F++     A DN      A + V   ++DINDN P +           + PSY+  + +F+D  +G         LT T    T+  SGN  L   S    E K         + V  S+D E    +I       +  D    +  N + +++ +LD ND  P++  P    +V    + N  +GT +  + A D D   +  LTY L+    ++  +D  +G ++  + +++  K+ L +  TD G P
Sbjct: 2035 PILELLLLAEDIGL--LNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRI---EAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRG--TVPLSGTAIVTILIDDINDSRP------------EFLN--PIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVPNQ---EDAFAVNINTG--SVMVKSPMNRELVAT-YEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDK------GLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTV----RASDNGSPPRAAEIPVYLEIVDINDNNPIF-----------DQPSYQ--EAVFEDVPVG------TIILTVTA---TDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSV----YENEPAGTSVITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGLVTTQRPLQSYEKFSLTVVATDGGEP 2589          
BLAST of Protocadherin vs. TrEMBL
Match: A0A210PLE4 (Protocadherin-9 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12673 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 7.976e-50
Identity = 182/606 (30.03%), Postives = 285/606 (47.03%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLI--KNEDFSTSFVSIDGNSGTIILKKPLFDI--DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPF--TGEISLTKDIE--AGK-YDLFLQVTDNGNPMRNSSANLTIII 1973
            D E   ++ L L+A D G P   +   + + + D+ND AP      Y   VQED+ VGS IL ++A D +SG  G++ Y+L   + E+    F  I+  SG +IL  PL  +      + VE  D  +       T+V+I ++D +N+ P I +G        L NG       I E  P    V+ + V+D+D G NG V C + +T     +F L     L+ N  +Y++ + Q++DRE+V+   + ++ CQD+G P+L S     VDVLD N+ P +F    YS S+ E NK    IL  +  D D     E  + L  SN+  ++      +   +G IR     DRE+   + F +  ++        T  ATVSV V D+ND  PQ++  +  F+ KEN      +G+L+  D D G++ R+  S    +    T         F +    I++    +D E        +   D G P   +  ++ + I DENDN P  I+PS  +N + IS +    G+ +  VRA D D   +  ++Y     + +     F  TG++ L K +E  AG  + L +  TD G+P R S   L III
Sbjct:  206 DRELRERYALTLVAKDGGVPAKTADLAVHVHVTDVNDNAPMLSRTTYNFTVQEDIPVGSTILTLYATDLDSGRNGEVRYRLSPHQTEEIKNLFF-INATSGELILINPLTYVRGSSYKIIVEVGDRGQQ-PMTTQTYVIITVLDSSNNPPEIVLG-------LLTNG----VARISEYAPFGTTVAHVAVLDQDSGHNGIVMCSLDST-----IFELQV---LDVN--EYRVLVSQALDREQVAR-HSITVTCQDSGTPMLVSNANFFVDVLDVNDNPPIFLMQTYSASVKENNKVGKEILQVSATDYDEGQNAEVKYRLLHSNDTVIQ------VDTYTGMIRANAVFDRERMSSFMFKVLAIDGGSPPKSGT--ATVSVTVEDVNDEKPQFLENLFIFKRKENRQAGTIVGRLMAMDDDEGDSGRVVFSLAEESPIFSTLP-------FVVYSDGIIKTTSELDRERKKFYDFKVMASDLGRPTLSSTANVKIFIEDENDNSPNIIFPSYTNNTIVIS-VGTPPGSVVGTVRAQDPDEGLNGEVSYSFDGDNQTSYFRMFSETGDVILQKSVELFAGSVFSLNIIATDQGDPPRRSRQTLKIII 771          

HSP 2 Score: 102.064 bits (253), Expect = 3.709e-18
Identity = 150/596 (25.17%), Postives = 255/596 (42.79%), Query Frame = 3
Query:  276 LVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRE-SGDFGKIIYKLIKNE-DFSTSFV-SIDGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI--QTTKLLKNLFYLDSR----MRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYP---ALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI-NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFT----GEISLTKDIEAGK---YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            L++ I D+ND  P F   + T  + E +  G+      A D + S ++G   Y L   +  FS SFV ++DG S   I+     D +   +  LT+ A D        D   V + + DVN++ P +S     RT+         Y   + E+ P    +  +   D D G+NG+V+ ++    T+ +KNLF++++     + +N  TY     +R S             +   D GQ  + +   + + VLD +  P    L   +N    I E      ++   AV+DQD+   N   + S    +   F L  L  +   + +   LDRE+  R+  SI V  +        S A   V VLD+NDN P ++ +  S  +KENN    E+ Q+   D D G+N+ +               L  N+ +  + +   +++     D E + +    +   D G P      ++ V + D ND +P++     L+N+       N Q+GT + R+ A+D D   S R+ + L  +    S  PF     G I  T +++  +   YD  +  +D G P  +S+AN+ I I  +N
Sbjct:  122 LLVYIDDVNDNYPIFDRDSQTISIPESVLPGTSYTLDGAKDADRSANYGIHNYTLYPQDLPFSVSFVKNLDGTSVVRIIVDGALDRELRERYALTLVAKDGGVPAKTADLA-VHVHVTDVNDNAPMLS-----RTT---------YNFTVQEDIPVGSTILTLYATDLDSGRNGEVRYRLSPHQTEEIKNLFFINATSGELILINPLTY-----VRGS--------SYKIIVEVGDRGQQPMTTQTYVIITVLDSSNNPPEIVLGLLTNGVARISEYAPFGTTVAHVAVLDQDS-GHNGIVMCS---LDSTIFELQVLDVNEYRVLVSQALDREQVARH--SITVTCQDSGTPMLVSNANFFVDVLDVNDNPPIFLMQTYSASVKENNKVGKEILQVSATDYDEGQNAEVKY-----------RLLHSNDTVIQVDTYTGMIRANAVFDRERMSSFMFKVLAIDGGSPPKSGTATVSVTVEDVNDEKPQF-----LENLFIFKRKENRQAGTIVGRLMAMDDDEGDSGRVVFSLAEESPIFSTLPFVVYSDGIIKTTSELDRERKKFYDFKVMASDLGRPTLSSTANVKIFIEDEN 667          
BLAST of Protocadherin vs. TrEMBL
Match: A0A267GWV5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016424g1 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 8.137e-50
Identity = 167/602 (27.74%), Postives = 283/602 (47.01%), Query Frame = 3
Query:  222 LQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFS--TSFVSIDGNSGTI-ILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSI-IENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK-HDSISIDPFTGEISLTKDIEAGKYD----LFLQVTDNGNPMRNSSANLTIIIYQQNM 1988
            + L A D G P   +S  L + + D ND AP +V KN+   + E+   G +I+K+ A D ++G  G+IIY L  +   S       +  NSG + +    + D ++ +   + V A D      + + T ++I + D N++ P ISV    R       G P + L I EN P    + +I   D D G N  V+C + +    K  F L  + R +K    YKL    + D E     +  ++ C DNG P L ++ ++ V +LD+N+ P  F R  + L+   E +    I  F  +D+D      + L+       E   +++L  S+G +R     DRE   +Y+FS+ V +        ++ A V + + D+ND+ P++    + E+KEN+ PS ++G++   D+D   N ++                 G+   F I    +I     ++D E   + ++++  +D G P  H    + V +LDENDN P + +PS  +N +N+S  +      + +V A D+DS  + RLT+ L     D   I+P TGE+SL K +E G Y     L ++ TD G+P +   A L +    + +
Sbjct:  222 MLLTAFDGGSPPKSASLNLTVRVRDENDHAPVWVTKNFRFNLTENAEGGQLIVKLEATDEDAGPNGRIIY-LFNDPRPSREAQMFYLHPNSGELQVAHGAVLDYERTSVYRIPVVARDRGVVPKQIEQT-IIIELQDYNDNVPVISV----RGLPVKPGGGP-HALSIRENQPPGQTIGYIVARDDDSGNNSHVECNLGSPGEGKIRFRLQQQQR-HKPQVVYKLITDDTFDWEATPT-VQETVWCHDNGVPRLSASQLITVVILDENDSPPTFDRQVFELAFDEEQQPGIQIHRFEAVDRDQSPTLVYSLDD------EGQRIATLGSSTGVLRSAVRFDRESCDQYRFSVHVTDGVH-----SASAEVRLTIRDVNDHAPEWHPPFTLEIKENSPPSSQVGRVNATDRDADVNGQVKF-------------FVGHNPYFAIRPTGEIFTKSNNLDRERTPSIQLNVTAYDFGQPSRHRSTIVHVTLLDENDNAPVFYFPSPANNRLNVS-CDYGPDDVVAKVIANDSDSGENGRLTFNLTGSGQDHFRINPDTGELSLAKSLECGAYQHRFALTIRATDRGSPAQTRIATLLVATTPKRL 789          

HSP 2 Score: 70.4774 bits (171), Expect = 2.114e-8
Identity = 74/288 (25.69%), Postives = 121/288 (42.01%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIAC-DIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSI-------DREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALF 1025
            D+E  P  V + + C D G P+L +SQ + + I+D ND  P F  + +     E+   G  I +  A+DR+      ++Y L    D     ++  G+S  ++     FD    D+   +V   D     S      V + I DVN+H P                 +P + LEI EN+P + +V  +N  D+D   NG VK            F+      +  N Y + +R    I       DRE+  + +  ++   D GQP    + I+ V +LD+N+   +F
Sbjct:  445 DWEATPT-VQETVWCHDNGVPRLSASQLITVVILDENDSPPTFDRQVFELAFDEEQQPGIQIHRFEAVDRDQSP--TLVYSL----DDEGQRIATLGSSTGVLRSAVRFDRESCDQYRFSVHVTDGVHSAS----AEVRLTIRDVNDHAPEW---------------HPPFTLEIKENSPPSSQVGRVNATDRDADVNGQVK------------FF------VGHNPY-FAIRPTGEIFTKSNNLDRERTPS-IQLNVTAYDFGQPSRHRSTIVHVTLLDENDNAPVF 686          
BLAST of Protocadherin vs. TrEMBL
Match: A0A1I8G4U9 (CCHC-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 2.137e-49
Identity = 164/599 (27.38%), Postives = 279/599 (46.58%), Query Frame = 3
Query:  228 LIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFS--TSFVSIDGNSGTI-ILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPI------YFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK-HDSISIDPFTGEISLTKDIEAGKYD----LFLQVTDNGNPMRNSSANLTI 1967
            L A D G P   +S  L + + D ND AP +V KN+   + E+   G +I+K+ A D ++G  G+IIY L  +   S       +  NSG + +    + D ++ +   + V A D      + + T ++I + D N++ P ISV            G P+      + L I EN P    + ++   D D G N  V+C + +    K  F L  + R +K    +KL    + D E     +  ++ C DNG P L ++ ++ V +LD+N+ P  F R  + L+  E +     I  F  +D+D      + L+       E   +++L  S+G +R     DRE   +Y+FS+ V +        ++ A V + + D+ND+ P++    + E+KEN+ PS  +G++   D+D   N ++                 G+   F I    +I     ++D E   + ++++  +D G P  H    + V +LDENDN P + +PS  +N +N+S  +      + +V A D+DS  + RLT+ L     D   I+P TGE+SL K +E G Y     L ++ TD G+P +   A L +
Sbjct:  211 LTAFDGGSPPKSASLNLTVRVRDENDHAPVWVTKNFRFNLTENAEGGQLIVKLEATDEDAGPNGRIIY-LFNDPRPSREAQMFYLHPNSGELQVAHGAVLDYERTSVYRIPVVARDRGVVPKQIEQT-IIIELQDYNDNVPVISV-----------RGLPVKPGGGPHTLSIRENQPPGQTIGYVVARDDDSGNNSHVECNLGSPGEGKIRFRLQQQQR-HKPQVVFKLITDDTFDWEATPT-VQETVWCHDNGVPRLSASQLITVVILDENDSPPTFDRQVFELAFDEEQQPGIQIHRFEAVDRDQSPTLVYSLDD------EGQRIATLGSSTGVLRSAVRFDRESCDQYRFSVHVTDGVH-----SASAEVRLTIRDVNDHAPEWHPPFTLEIKENSPPSSHVGRVNATDRDADVNGQVKF-------------FVGHNPYFAIRPTGEIFTKSNNLDRERTPSIQLNVTAYDFGQPSRHRSTIVHVTLLDENDNAPVFYFPSPANNRLNVS-CDYGPDDVVAKVIANDSDSGENGRLTFNLTGSGQDHFRINPDTGELSLAKSLECGAYQHRFTLTIRATDRGSPAQTRIATLLV 769          

HSP 2 Score: 72.4034 bits (176), Expect = 6.350e-9
Identity = 70/281 (24.91%), Postives = 116/281 (41.28%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIAC-DIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALF 1025
            D+E  P  V + + C D G P+L +SQ + + I+D ND  P F  + +     E+   G  I +  A+DR+      ++Y L    D     ++  G+S  ++     FD    D+   +V   D     S      V + I DVN+H P                 +P + LEI EN+P +  V  +N  D+D   NG VK            F++                   ++DRE+  + +  ++   D GQP    + I+ V +LD+N+   +F
Sbjct:  432 DWEATPT-VQETVWCHDNGVPRLSASQLITVVILDENDSPPTFDRQVFELAFDEEQQPGIQIHRFEAVDRDQSP--TLVYSL----DDEGQRIATLGSSTGVLRSAVRFDRESCDQYRFSVHVTDGVHSAS----AEVRLTIRDVNDHAP---------------EWHPPFTLEIKENSPPSSHVGRVNATDRDADVNGQVK------------FFVGHNPYFAIRPTGEIFTKSNNLDRERTPS-IQLNVTAYDFGQPSRHRSTIVHVTLLDENDNAPVF 673          
BLAST of Protocadherin vs. TrEMBL
Match: A0A210PLD8 (Protocadherin-11 X-linked OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12667 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.033e-49
Identity = 179/612 (29.25%), Postives = 297/612 (48.53%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKN--EDFSTSFVSIDGNSGTIILKKPL-FDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQ-IQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNM 1988
            D E    + + +IA D G+P      +++I+++DIND  P+F  + Y   V ED+AV + I  V A D + G+ G++ YKL  N  E   T F +ID +SG +I+   L ++  K  T+ VEA D+A        + V I ++DV+N+ P IS+     T             EI EN   +  V+ I + D D GKNG V C  + + K     F +          ++YK+ + Q+++RE + +    +++C D G P L ++ +  V V+D N+    FT+  Y +S+ ENK    S++  A  D D     E  F L+S      E      ++++SG I + + LDRE   +  FS+F  ++   +   T  A V ++V D+NDN P+++     + ++ENN  +  +G L+ +DKD G NS+I+ S       G           F I     +   Q +D E        +   D G P   N   + V +LD NDN PE+++P++ +N V IS+      T ++ V   D D   ++R+TY +K K+ S    ++  +G I L K +   +A KY   +   D G P R +   ++I++  Q +
Sbjct:  217 DRETTSSYKVNVIARDGGEPPKTGVLEVIINVLDINDNRPRFNTQMYNVTVNEDVAVNTTITTVFADDPDQGENGRVTYKLSPNQAEKIPTLF-TIDESSGDVIIVGSLIYEPGKSYTIIVEASDNALQ-PLISQSKVFIHVLDVHNNPPEISIDPLSNTEDS----------EILENAILDTAVAHITIFDPDTGKNGIVNCSVVNSDKFTLQRFAV----------HEYKVVLSQALNRE-IKDRYEVTVHCHDIGTPQLNASAMFVVHVMDINDNTPKFTQQQYFVSVQENKSLTSSVMQVAANDFDNGKNAEVMFSLDS------EGQKYFRISETSGVITVNSVLDRETVSQISFSVFAADKG--SPSLTGSAQVRMIVTDVNDNKPEFMEDTFEYNLEENNHVNINIGVLVANDKDDGNNSQITYSIHPNYHAGIP---------FAIMPNGSILATQVIDREAKARYDFTVIAEDMGNPSLRNSAHVTVFVLDVNDNNPEFVFPNAHNNTVVISY-QTPVNTIVSTVETRDIDEGMNSRVTYFMKDKNFSHIFKLNNLSGRIVLDKALTVADAKKYTFGIIAQDKGTPPRINEIAMSIVVTTQKI 787          

HSP 2 Score: 98.2117 bits (243), Expect = 6.641e-17
Identity = 144/598 (24.08%), Postives = 258/598 (43.14%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIK--NEDFSTSFVS-IDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLK--NLFYLD--SRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNN-------FNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSF-EMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK-HDSISIDPFT----GEISLTK--DIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            K+ I ++DIND +P F   + T+ + E    G  I    A D ++G+F  I Y +++  +  F+  +   +DG     I+     D +  +   + V A D  E   K     V+I ++D+N++RP        R +TQ+ N      + + E+   N  ++ +   D D+G+NG V  ++   +  K   LF +D  S   +   +  Y+     +I  E   N L          QPL+  + +  + VLD +  P        S+  + N ++  IL  A++D        F  ++  N        N + F L        ++ +   L+RE   RY+ ++   +      +  + A   V V+DINDN P++  +  F  ++EN   +  + Q+  +D D G+N+ +  S             S  +  F ISE   ++ V   +D E +      +   D+G P       + + + D NDN+PE++  +   N+   +H+NI  G  +    A D D  +++++TY +    H  I   PF     G I  T+  D EA  +YD  +   D GNP   +SA++T+ +   N
Sbjct:  133 KVSITLLDINDNSPSFSVPSITRDISEGSLTGFYIPIEAAKDADTGNF-SIQYYILEPPSSPFTVGYQEFVDGTYSVRIVLDGQLDRETTSSYKVNVIARDGGEP-PKTGVLEVIINVLDINDNRP--------RFNTQMYN------VTVNEDVAVNTTITTVFADDPDQGENGRVTYKLSPNQAEKIPTLFTIDESSGDVIIVGSLIYEPGKSYTIIVEASDNAL----------QPLISQSKVF-IHVLDVHNNPP-----EISIDPLSNTEDSEILENAILDTAVAHITIFDPDTGKNGIVNCSVVNSDKFTLQRFAVHEYKVVLSQALNREIKDRYEVTVHCHDIG--TPQLNASAMFVVHVMDINDNTPKFTQQQYFVSVQENKSLTSSVMQVAANDFDNGKNAEVMFS-----------LDSEGQKYFRISETSGVITVNSVLDRETVSQISFSVFAADKGSPSLTGSAQVRMIVTDVNDNKPEFMEDTFEYNLEENNHVNINIGVLV----ANDKDDGNNSQITYSIHPNYHAGI---PFAIMPNGSILATQVIDREAKARYDFTVIAEDMGNPSLRNSAHVTVFVLDVN 678          
BLAST of Protocadherin vs. TrEMBL
Match: A0A074ZLL5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04911 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 8.797e-48
Identity = 182/665 (27.37%), Postives = 293/665 (44.06%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQL-CSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKN-EDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLE----IFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSN-PLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFT--RSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTS-FATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYE--LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKI-SIIVNILDENDNEPEW-----IYPS-----------------SLDNVVNISHIN----IQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISID------------------------PFTGEISLTKDI------EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    +  +++ACD GQP   C  Q L+I + D+ND  P F  + Y   V E +  GS +L VHA D +SG  G + Y++ +           +D +SG +  KKP+   D     +        N       VV I + DVN+H P I V   +    Q+ +G  + F E    ++EN P    +  I V D+D G N  V+C++Q  +     FYL+      K    Y L   QS DRE + +   +  I C D G P  K+   + + +LD NE+   F   R NY++ I E ++  S +      D DA     ++L      + E+  L  +   SG +     LDRE +P+ +F++   ++    +   S  A +++ + DINDN P  V      + EN  P +   +GQLI  DKD G N  +    L+      TE  +   D F ++ E   L   +S+D E     ++ +  +D G P++ N   +I+V++LDENDN+PEW     + P                   LD V  +  +N    +  G ++ ++ A DADS  +  LT+ L   + +  I+                          +GE+ +   +      E G  +++L+V+DNGNP    +A L + I
Sbjct:  243 DAERKANYTGEIVACDGGQPSPKCGVQPLLIHVTDVNDNKPVFEKQVYEVTVNETVLNGSTVLTVHASDADSGSHGSVRYQIGQPVSQVVLDHFGLDASSGRLYTKKPIDAKDTALFVIPVLAKDGGNVPLIGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSG--VKFSEGAMWVYENQPVGTNLGLIIVGDEDIGDNSLVECKLQEREY---RFYLE-HANSAKGREMYSLSTNQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQILDVNEFSPEFPADRRNYNIQIEEGQNPGSFVFQAEATDLDATPMIYYYL------SREAQSLFHIDPHSGRVTTRKLLDRESTPKIRFTVHATDKNLLESDVNSTLANITITLTDINDNEPTLVENEVLRIVENR-PGFSDLVGQLIAIDKDAGLNGTVRYKLLSVL----TENNNLVNDTFMVNQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIVVDVLDENDNKPEWRPMLPLLPDGQYSAQSAYSKYASRLLGLDKVFELGQLNTTAPLHRGQRVCKLAATDADSARNANLTFHLVTTYFTPEIEGDDTQRLMYHSGKATTMPNYFMVSSTSGELMIGAGLRGAGLSEPGLAEIYLRVSDNGNPPLEKTARLFVRI 890          

HSP 2 Score: 81.6481 bits (200), Expect = 7.259e-12
Identity = 114/468 (24.36%), Postives = 185/468 (39.53%), Query Frame = 3
Query:  585 WTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTI-ILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP-------QYVGRM---SFEMKENNIPSYE-------LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS--------ELKILQVKQSMDYEFIHN--CKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQ------SGTKLTRVRAIDADSVSSNRLTYELKAKHDSI-SIDPFTGEISLTK 1880
            W +V+I I D+N++RP   +GS + T   +        ++         EV  I   D D G N      ++  +L   LF +        N     L +   +D E+ +N     + C D GQP  K  +  L + V D N+   +F +  Y +++ E   N S +L+    D D+ S            +        L  SSG +    P+D + +    F I V+ +   N      + V + V D+ND+ P       Q  G+      +  E  +  YE       LG +I  D+DIG+NS +              KL   E  F++         E+  L   QS D E + +    + I   D+G P    + SI + ILD N+  PE  +P+   N       NIQ       G+ + +  A D D  ++  + Y L  +  S+  IDP +G ++  K
Sbjct:  150 WINVIIAIHDINDNRPYFPIGSGESTKPNVYVVSVSESVQ------PGHEVPLIGARDSDSGINAVQSYTLRGDELNPALFAVSYSPPFTLN-----LIVLDELDAERKANYTGEIVAC-DGGQPSPKCGVQPLLIHVTDVNDNKPVFEKQVYEVTVNETVLNGSTVLTVHASDADSGSHGSVRYQIGQPVSQVVLDHFGLDASSGRLYTKKPIDAKDT--ALFVIPVLAKDGGNVPLIGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSGVKFSEGAMWVYENQPVGTNLGLIIVGDEDIGDNSLVEC------------KLQEREYRFYLEHANSAKGREMYSLSTNQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQILDVNEFSPE--FPADRRN------YNIQIEEGQNPGSFVFQAEATDLD--ATPMIYYYLSREAQSLFHIDPHSGRVTTRK 581          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 179.104 bits (453), Expect = 1.955e-45
Identity = 177/615 (28.78%), Postives = 277/615 (45.04%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISV-GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPS-----------SLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L + A D G P   SS  L + I D ND AP+F   +Y   V E+  VG  +L+V A D + G  G+I Y + +  D     + I+ ++G I +K PL   +I      V A D    + K   T+V I + D N++ P + + G   RT +  +         I E+ P    V+ + V DKDEG+N  V C +      +     DS +    N  +Y L+    +D E++ +     I   D+G P L ST  L+V V D N+   +F+   + +   E N+    +L    +D D+ +  E  L  S   +  +  L  +  SSGE+R  +PLDRE   RY+F +   ++   + + T  ATV + VLD NDN P+++    SF + EN  P   +G +   D D GEN+++ +S          E   GN   F + +    +    S D E   +    +   D G P   + + + +N+LDENDN P    PS           + D+VV +             V A D D  S+  L Y +     H+   I P  GEI LTK++     G + L ++V+D G P R++ A + I +
Sbjct:  238 DRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGV-------ANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSV---DNKKKYFLQTTTPLDYERIRD-YRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAE--LVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLS---------VEPDVGN---FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEV-------------VEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 811          

HSP 2 Score: 105.531 bits (262), Expect = 1.346e-22
Identity = 135/607 (22.24%), Postives = 247/607 (40.69%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-VSIDGNSGT-----IILKKPLFDI-DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTR---------------------SNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI-LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I++ DIND  P+F +   T  VQE+  +G+      A DR++   G + Y L    + S  F + +  + G      I+L     ++ D   LT+ A D     S++    + + I D N++ P     S              Y  E+ EN+P  + V  +   D D G NG+++  I Q +  +  +  ++    +        + ++  +DRE++S+   F +  +D G     ST  + ++V DQN+  PA+  R                     +  +L  + +KD         +    + F       S+  N + + L + T          PLD E+   Y+  I  V+    N   +S  ++ V V D NDN P +   +   E  E N P  ++  +I  D D G N+ +  S +           S    LF I      ++ +  +D E     +  +   D+G P +    ++++ +LD NDN+P+++      S L+N+  +S + +        V  +D D   + ++   ++    +  +   TG I  S++ D E    Y   L+  D G P R+S   +TI +  +N
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTP-SRYSSALLRVVITDANDNAPQFEKSS--------------YEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGI--------ISVKGPLDREEISS-FKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTT----------PLDYERIRDYRVEIVAVDSG--NPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIAD---------SSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGM--------VTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDEN 708          

HSP 3 Score: 105.531 bits (262), Expect = 1.429e-22
Identity = 138/560 (24.64%), Postives = 238/560 (42.50%), Query Frame = 3
Query:  390 AIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIID-VNNHRPNISVGSDKRTSTQLLN------GYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFN---EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP----QYVGRMSFEMKENNIPS-YELGQLI----FDDKDIGENSRISISSLTTTCYG--PTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS---ISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            A D+   D G + YKL    +    ++ +DG +G I   +    ID+ TL            K  +    + + D + N  P +  G   R   Q +N        P+  L + EN       +     D+D  +NG +K  +        LF L  +M  ++     +L +  ++DRE + +  + +IN  D G P   S+ +L+V + D N+    F +S+Y   + EN    +S+L     D D L  N   E+ ++ +++   +   +    +S+G I +  PLDRE+   ++F +   ++       T++  VS+ V D NDN P    + +G  +      NI     +G  +      DKD GEN+ +     T    G  P +     +      +   LQ    +DYE I + +++I   D G P   +  S+ V + D NDN P  I+   L   V  +  N Q G K+  V A+DADS ++  L Y + A   +     IDP +GE+     ++     +Y+  +   D G P    +A + I +  +N
Sbjct:   79 AADQGLPDSGHL-YKL----EVGAPYLRVDGKTGEIFTTE--IPIDRETLK-----DCRIKGKPCFLEFEVSVTDLIQNQSPRLIEG---RIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSL--QMANDRGEKLPQLIVLGNLDRE-LKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSD-LGPNGEIEYTIHQASDPVPKMLQIE---RSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTY--VSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVV-----TCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP--IFSPPLFE-VEFAEEN-QPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRN 605          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 177.948 bits (450), Expect = 2.604e-45
Identity = 177/615 (28.78%), Postives = 277/615 (45.04%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISV-GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPS-----------SLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L + A D G P   SS  L + I D ND AP+F   +Y   V E+  VG  +L+V A D + G  G+I Y + +  D     + I+ ++G I +K PL   +I      V A D    + K   T+V I + D N++ P + + G   RT +  +         I E+ P    V+ + V DKDEG+N  V C +      +     DS +    N  +Y L+    +D E++ +     I   D+G P L ST  L+V V D N+   +F+   + +   E N+    +L    +D D+ +  E  L  S   +  +  L  +  SSGE+R  +PLDRE   RY+F +   ++   + + T  ATV + VLD NDN P+++    SF + EN  P   +G +   D D GEN+++ +S          E   GN   F + +    +    S D E   +    +   D G P   + + + +N+LDENDN P    PS           + D+VV +             V A D D  S+  L Y +     H+   I P  GEI LTK++     G + L ++V+D G P R++ A + I +
Sbjct:  202 DRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGV-------ANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSV---DNKKKYFLQTTTPLDYERIRD-YRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAE--LVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLS---------VEPDVGN---FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEV-------------VEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 775          

HSP 2 Score: 104.76 bits (260), Expect = 1.898e-22
Identity = 138/560 (24.64%), Postives = 238/560 (42.50%), Query Frame = 3
Query:  390 AIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIID-VNNHRPNISVGSDKRTSTQLLN------GYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFN---EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP----QYVGRMSFEMKENNIPS-YELGQLI----FDDKDIGENSRISISSLTTTCYG--PTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS---ISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            A D+   D G + YKL    +    ++ +DG +G I   +    ID+ TL            K  +    + + D + N  P +  G   R   Q +N        P+  L + EN       +     D+D  +NG +K  +        LF L  +M  ++     +L +  ++DRE + +  + +IN  D G P   S+ +L+V + D N+    F +S+Y   + EN    +S+L     D D L  N   E+ ++ +++   +   +    +S+G I +  PLDRE+   ++F +   ++       T++  VS+ V D NDN P    + +G  +      NI     +G  +      DKD GEN+ +     T    G  P +     +      +   LQ    +DYE I + +++I   D G P   +  S+ V + D NDN P  I+   L   V  +  N Q G K+  V A+DADS ++  L Y + A   +     IDP +GE+     ++     +Y+  +   D G P    +A + I +  +N
Sbjct:   43 AADQGLPDSGHL-YKL----EVGAPYLRVDGKTGEIFTTE--IPIDRETLK-----DCRIKGKPCFLEFEVSVTDLIQNQSPRLIEG---RIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSL--QMANDRGEKLPQLIVLGNLDRE-LKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSD-LGPNGEIEYTIHQASDPVPKMLQIE---RSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTY--VSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVV-----TCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP--IFSPPLFE-VEFAEEN-QPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRN 569          

HSP 3 Score: 104.375 bits (259), Expect = 2.937e-22
Identity = 139/600 (23.17%), Postives = 252/600 (42.00%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-VSIDGNSGT-----IILKKPLFDI-DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPA-------LFTRSNYSLSIIENKDNFSILSFA-VIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI-LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I++ DIND  P+F +   T  VQE+  +G+      A DR++   G + Y L    + S  F + +  + G      I+L     ++ D   LT+ A D     S++    + + I D N++ P     S              Y  E+ EN+P  + V  +   D D G NG+++  I Q +  +  +  ++    +        + ++  +DRE++S+   F +  +D G     ST  + ++V DQN+  PA       L T S+   +I E+    + ++   V D+D     E  + +        F L     SS +      ++   PLD E+   Y+  I  V+    N   +S  ++ V V D NDN P +   +   E  E N P  ++  +I  D D G N+ +  S +           S    LF I      ++ +  +D E     +  +   D+G P +    ++++ +LD NDN+P+++      S L+N+  +S + +        V  +D D   + ++   ++    +  +   TG I  S++ D E    Y   L+  D G P R+S   +TI +  +N
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTP-SRYSSALLRVVITDANDNAPQFEKSS--------------YEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGI--------ISVKGPLDREEISS-FKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDE---GENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSG--NPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIAD---------SSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGM--------VTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDEN 672          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 164.851 bits (416), Expect = 3.782e-41
Identity = 173/602 (28.74%), Postives = 269/602 (44.68%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKL--LKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSII-ENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKL-TRVRAIDADSVSSN---RLTYELKA--KHDSISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIII 1973
            + L +   D G P   SS  L I I D ND  PKF   +Y   + E+  VG  +L+V A D + G  G++ Y   +        + ID N+G I +K  +   ++  L  +V+A D+    +K     V I + D N++ P+I      R     L  +      + E+ P    V+ + V DKDEG+N  V C +       L++    DS  +      +Y L+    +D E++       I   D+G P L ST  L+V V D N+   +F+ S Y +    EN+    +L   V+  DA S     L  S   +  +  L  +  ++GE+R+ N LDRE   RY+F +   ++   + K T  ATV V VLD NDN P+++    SF + EN  P   +G +   D D GEN+ + +S          E  +G    F I +    +    S D E        +   D G P   + + I +N+LDENDN P    PS      N S+  +Q  T   TRV  +DA+ + +     L Y +     H    I    GEI+L K+      G + L ++V+D G P R+++A + I +
Sbjct:  221 YDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQ-AKSSKAMVTITVKDRNDNAPSI------RIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSK-----RKYFLQTTTPLDYERIKE-YRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLD--VVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGT--ATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLS---------VEPENGK---FVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPS------NSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFV 787          

HSP 2 Score: 100.908 bits (250), Expect = 2.962e-21
Identity = 137/600 (22.83%), Postives = 253/600 (42.17%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-VSIDGNSGTIILKKPLFD------IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIENKDNFSILS--------FAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I+I D ND  P+F +      + E+  VG+      A+D+++G  G   YKL    D    F + +  N+   + +  +         D   L+++  D      ++    + I I D N++ P       +R+          Y  E+ EN P    V  +   D D G NG V     Q +  ++ L ++D    +        ++++ S+DRE+V   L FS+  +DNG     S  ++ + V D+N+  P++  R      ++ ++D  + +S         A+++       E  + +        F L S + S         ++   PLD E+   Y+  I  V+    N   +S  ++ V V D+NDN P +   +   +  E N P  ++  ++  D D G N+ +  S +T          S  + LF I+     ++V   +D E+    +  +   D+G P      +++V +LD NDN+P+++      S L+N+  +S + +        V  IDAD   +  +   ++ ++    I   TG I  S++ D E    Y   L+  D G+P R+S   +TI +  +N
Sbjct:  131 IEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTP-PRYSSALLRITITDTNDNVPKF-----ERSH---------YEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGI--------IQVKGSVDREEVPL-LKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRG---FGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSG--NPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITD---------SATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGM--------VTVIDADKGENAHVQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDEN 684          

HSP 3 Score: 88.1965 bits (217), Expect = 2.801e-17
Identity = 76/285 (26.67%), Postives = 128/285 (44.91%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFD--IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYS 1043
            DYE I ++ ++++A D G P L S+  L + + D+ND AP F    Y     E+   G  +L V A D +SG   +++Y +I  +  +     I+ N+G + +   L     ++    VEA D    + K   T VV+ ++D N++ P             +LNG   Y   + EN P    V  + V+D D+G+N  V+  ++           + +  +   T      I  S DREK S    F +   D G P   S + + ++VLD+N+     T+ + S
Sbjct:  440 DYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSII-TDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTAT-VVVRVLDRNDNDPKF-----------MLNG---YSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPE---------NGKFVIQNGTGTILSSI--SFDREKEST-YTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNS 696          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 157.918 bits (398), Expect = 6.848e-39
Identity = 158/592 (26.69%), Postives = 273/592 (46.11%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFST-SFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNL-FYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNT--KFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK---DIEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E   VG+ ++++ A D + G   +I Y        +T    +++  +G I +++PL   +     L+V A D +  +++     V I + DVN++ PNI    D R      NG  +    + E +P N +++ I V DKD   NG V C I+     K++ F+L       K  Y  QY L     +D E     + F I   D+G+P L  T +++V + D+N+ P +FT+    L++ E NK +  + +    D+D+    E  + L  + +F         L + +G +      DRE   R+ F++     A+DN      S A V V +LD NDN P++      F + E N+P Y  +G +   D D GEN+ +S+S            L+ NE+        +++   S D E   +   D+   D G P   +   + +N++D NDN P  IYP S +    +  ++   G+ +  V A+D D+  +  L Y +   ++     IDP TG I+L +   + ++G + L + ++D G P
Sbjct:  217 YVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSAR---ATVTINVTDVNDNAPNI----DLRYIISPTNGTVL----LSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----KDVPFHL-------KAVYDNQYLLETSALLDYEGTKEYI-FKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASF-------FDLDRKTGVLTASRVFDREDQERFLFTV----TARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVSLS-----------ILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPS-NTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          

HSP 2 Score: 68.5514 bits (166), Expect = 2.698e-11
Identity = 70/292 (23.97%), Postives = 125/292 (42.81%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYP--ALFTRSNYSLSII 1055
            DYE   +++ +++A D G+P L  +  + + + D ND  P F        V E+      +  + A D +SG   +I+Y+L  N     SF  +D  +G +   + +FD    ++   TV A D+     +     V++ I+D N++ P  +            N +  +   + EN P+   V  I V D D G+N  V   I           L+       + Y   ++   S DRE+ S+   F +   D+G P   S   + ++V+D N+ P   ++  SN S  ++
Sbjct:  427 DYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREDQERFLFTVTARDNGTRALQ-SQAAVIVTILDQNDNSPKFT-----------HNHFQFF---VSENLPKYSTVGVITVTDADAGENAVVSLSI-----------LNDNENFILDPYTGVIKSNVSFDREQQSS-YTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLV 686          

HSP 3 Score: 63.929 bits (154), Expect = 6.720e-10
Identity = 125/589 (21.22%), Postives = 239/589 (40.58%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFD---IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI--QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQN----EYPALFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTI 1967
            K+ I + D ND AP F +      + E+  + S      A D + G      Y+L+  +  F    V + +G     ++ +   D    D   + ++  D      K     + + + DVN++RP       K +  +         + I E++P    V  +   D D G N ++K     Q +   + LF L+S   L        + +++ +DRE+ +N    S+   D      ++T+ + V  ++ N    +   + + +N ++ ++  KD  N  I    V D+D       + F E  +          FHL ++  +   +     LD E +  Y F I   +  + +   T  A V V + D NDN P +    +   + ENN     L  +   D+D G N+ I              +L  N   F +  +  +L   +  D E        +   D G     ++ ++IV ILD+NDN P++ +    ++       N+   + +  +   DAD+  +  ++  +   +++  +DP+TG I  +++ D E    Y   ++  D+G+P  +S+A +TI
Sbjct:  126 KIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQ-KSSTAILQVTVTDVNDNRPVF-----KESQIE---------VHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGL--------ITVQRPLDREETAN-HKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTV-LLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDV---------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQT--ALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEI------------VYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTI 662          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 157.532 bits (397), Expect = 7.802e-39
Identity = 158/592 (26.69%), Postives = 273/592 (46.11%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFST-SFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNL-FYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNT--KFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK---DIEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E   VG+ ++++ A D + G   +I Y        +T    +++  +G I +++PL   +     L+V A D +  +++     V I + DVN++ PNI    D R      NG  +    + E +P N +++ I V DKD   NG V C I+     K++ F+L       K  Y  QY L     +D E     + F I   D+G+P L  T +++V + D+N+ P +FT+    L++ E NK +  + +    D+D+    E  + L  + +F         L + +G +      DRE   R+ F++     A+DN      S A V V +LD NDN P++      F + E N+P Y  +G +   D D GEN+ +S+S            L+ NE+        +++   S D E   +   D+   D G P   +   + +N++D NDN P  IYP S +    +  ++   G+ +  V A+D D+  +  L Y +   ++     IDP TG I+L +   + ++G + L + ++D G P
Sbjct:  217 YVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSAR---ATVTINVTDVNDNAPNI----DLRYIISPTNGTVL----LSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----KDVPFHL-------KAVYDNQYLLETSALLDYEGTKEYI-FKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASF-------FDLDRKTGVLTASRVFDREDQERFLFTV----TARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVSLS-----------ILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPS-NTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          

HSP 2 Score: 68.9366 bits (167), Expect = 2.464e-11
Identity = 70/292 (23.97%), Postives = 125/292 (42.81%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYP--ALFTRSNYSLSII 1055
            DYE   +++ +++A D G+P L  +  + + + D ND  P F        V E+      +  + A D +SG   +I+Y+L  N     SF  +D  +G +   + +FD    ++   TV A D+     +     V++ I+D N++ P  +            N +  +   + EN P+   V  I V D D G+N  V   I           L+       + Y   ++   S DRE+ S+   F +   D+G P   S   + ++V+D N+ P   ++  SN S  ++
Sbjct:  427 DYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREDQERFLFTVTARDNGTRALQ-SQAAVIVTILDQNDNSPKFT-----------HNHFQFF---VSENLPKYSTVGVITVTDADAGENAVVSLSI-----------LNDNENFILDPYTGVIKSNVSFDREQQSS-YTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLV 686          

HSP 3 Score: 64.3142 bits (155), Expect = 6.235e-10
Identity = 126/591 (21.32%), Postives = 243/591 (41.12%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI--QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQN----EYPALFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTI 1967
            K+ I + D ND AP F +      + E+  + S      A D + G      Y+L+  +  F    V + +G     ++ +   D ++     + + VE   S + +S      + + + DVN++RP       K +  +         + I E++P    V  +   D D G N ++K     Q +   + LF L+S   L        + +++ +DRE+ +N    S+   D      ++T+ + V  ++ N    +   + + +N ++ ++  KD  N  I    V D+D       + F E  +          FHL ++  +   +     LD E +  Y F I   +  + +   T  A V V + D NDN P +    +   + ENN     L  +   D+D G N+ I              +L  N   F +  +  +L   +  D E        +   D G     ++ ++IV ILD+NDN P++ +    ++       N+   + +  +   DAD+  +  ++  +   +++  +DP+TG I  +++ D E    Y   ++  D+G+P  +S+A +TI
Sbjct:  126 KIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSST---AILQVTVTDVNDNRPVF-----KESQIE---------VHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGL--------ITVQRPLDREETAN-HKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTV-LLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDV---------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQT--ALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEI------------VYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTI 662          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 146.362 bits (368), Expect = 4.569e-36
Identity = 185/682 (27.13%), Postives = 296/682 (43.40%), Query Frame = 3
Query:   33 SEAGKAFQ-NPRIRIDSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXX-----XXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS------FVSIDGNSGTIIL-------KKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEF-HLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNM 1988
            + AGK F   P    DS  NGV  Y L  S  +  + F L+ T +     +      KSLD E    + + L A D G P    S  L I++ D ND +P F        + E+  VG+ ++++HA DR++G   +++Y+L  +   + S         +D NSG + +       + P++ I      + A D            V + + DVN++ P I +    R     +NG  IY   I E +  N  V+ I V D D G NG V C I   ++           +L K TY  QY L  R+++D E   N     I   D G   L  T+ + + +LD N+   +FT   Y +S+ EN      +++ +  D+D     E  +    +   M  FH+   T   G I +   LDREK   Y F+I   +  Q        ATV V VLD+NDN P++ +    F + EN      +G +   D D GEN R+ +S L T           N  LF I  E  +++     D E  H   +++   D G P   + + ++++++D NDN P  + P S +            GT +T V A+D D+  +  L Y +     H+   IDP  G I+L + +     G + L ++V+D G  +++ +  L  +   + +
Sbjct:  166 APAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRI-----IILATDKGPEPVPAT-ATVTVTVTDVNDNSPTIEI----RDIVAPVNGV-IY---ISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEV---------PFQLKKLTYPNQYLLETRETLDYE-TKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTM--FHMDPET---GIISLTEQLDREKKANYSFTILAKD--QGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTD----------NRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPS-NTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETL 805          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 1.436e-32
Identity = 161/619 (26.01%), Postives = 268/619 (43.30%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKV-VQEDLAVGSVILKVHAIDRESGDFGKIIYKL-IKNEDFST-SFVSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGY-PIYFLEIFENNPENFEVSFINVVDKDEGKNG--DVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTR--------SNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESF-HLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMS--------FEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFW--ISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLD---NVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGN 1934
            D E +P + L L   D G P+L  S  L I ++D ND AP FV      V + E   VG+ ++++ A D ++G  G I Y    K    +T + + +DG +G + ++     +D+ T     L V A D  + +     T V + + D N++ P   V         L   Y P   ++I EN P    V  I+V D D G +G  DV+ +  T   L            + N  Q+ L+  + +D E+     N S+   D G P L   + L + V+D N+   +F          + Y +S+ EN    + +L+    D D+          S     ES   L SL   +G++ +  PLDREK  RY+ S+   +      K  + A V V VLD NDN P +VG  +        F  +E ++ +Y +G +   D D G+N+R++++ +     GP + + G  D     +  L +L  +  + YE      + +   D G P       + + + D NDN P    P++ D   +V   S   +  G  +T   A D D+  + R  YE+   +      ++  +G +SL + + +   G + L ++V D G 
Sbjct:  231 DREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRN-AEKLDRETMPVHRLVVVARDGGQLSRSASVT-VTVELNDDNDNAPVFEV-------IALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELA-----------SPNKVQFLLKTTRLLDYEEAQQ-YNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRK--ARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTY-VGTVSTSDLDEGDNARVALNLVREA--GP-DWIGGAGDTPGGVVRTLVVLDREDRVQYE------LSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVT---ANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG 813          

HSP 2 Score: 101.293 bits (251), Expect = 5.028e-22
Identity = 121/531 (22.79%), Postives = 227/531 (42.75%), Query Frame = 3
Query:  534 TLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKN-----------GDVKCQIQTTKLLKNLFYLDSRMRLNKNT----YQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVL--DINDNVP---------QYVGRMSFEMKENNIPSYELGQLI-FDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQ----SGTKLTRVRAIDADSVSSNRLTYELK--AKHDSI----SIDPFTGEISLTKDIEAGK---YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            T+ V A    + +S      V + + D+N+H P                  P   + I E+      V     +D D G N           GD   Q+    L+++    D             ++  L +R+ +DRE V +     +  +D G P L  +++L + V+D N+  P         + I E +K   S++     D DA     ++++ FH   ++     + H+   T     +R    LDRE  P ++  +     A+D  + +  A+V+V V   D NDN P         +Y+     ++ EN +PS     LI   D D+G +  + +     T     E  S N+  F      +L+  + +DYE      + +   D G PK    +++I++++D NDN P ++ P+S++  V +  ++++    +GT +  + A DADS  +  +T+ L   A  +S+    S++  TG+++L   ++  K   Y+L ++  D G+P R + A + + +  +N
Sbjct:  110 TVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRA--------------PHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGD-GLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPS-YELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYS-FHTKLTSLATQAALHVDGTTGLV-TVRNAEKLDRETMPVHRLVVV----ARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVEN-LPSGTPVVLISVSDPDLGSSGTVDVRLEFPTG---AELASPNKVQF------LLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDEN 608          

HSP 3 Score: 69.707 bits (169), Expect = 2.507e-12
Identity = 101/470 (21.49%), Postives = 194/470 (41.28%), Query Frame = 3
Query:  687 PIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLN-FSINCQDNGQPLLKSTIILQVDVLDQNEYPALF----TRSNY----SLSIIEN-KDNFSILSFAVIDQDALSFNEFHLNSSNNFNME-----SFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFE---------MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI----LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQS--GTKLTRVRAIDADSVSSNRLTYEL--KAKHDSISIDPFT-GEISLTKDI----EAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            P   + I E++     V  +   D D G NG +     T KL        + + ++  T    +R  + +DRE +  P++   +  +D GQ    +++ + V++ D N+   +F     +  Y     + I+EN      ++  +V D D        L SS   ++         L+S  +    ++    LD E++ +Y  S+   +  +   K +    + + V+DINDN P ++   S E         ++EN      +  L+  D D G N  I+ +           +L+G E +  +  L +    L +   +D E     ++ +   D G P+   +  + V +LDENDN P ++  S+  N +    +  ++  GT +  V   D D   + R+   L  +A  D I     T G +  T  +    +  +Y+L ++  D+G P  ++S  ++I +   N
Sbjct:  276 PTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHT-KLTS--LATQAALHVDGTTGLVTVRNAEKLDRETM--PVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPD--------LGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAAD--RGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFT---------LSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTN 721          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.552e-29
Identity = 144/598 (24.08%), Postives = 243/598 (40.64%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF---VSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPI-YFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFE--MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI---------SLTKDIEAGKYDLFLQVTDNGNP 1937
            D E     VL + A D G     +   L + ++D+NDE P F    Y     E+   G  ++ V A D + G+ G + Y    + D    +     +D  +G +   K L   ++++  L V+A D            V + + D+N++ P                 YP+ YF  I EN P    V+ +   D D G NG V+ Q+             +R ++N  T     R+  S+DRE+ +      +   D G    +S  I+ + V D  + P  F R +YS  + EN    +++         L+ N  +L  S +    SF   S+  S G I   N +DRE+   YQ  +       ++      A+VSV+V D+N++ P +  R S+E  + E+   +     +   DKD G+N  +         Y   E   G +  F I     L V+  +D E      + +   D G     + +++ V +LD NDN+P +   S + +      +    G+ +  V+A DAD+ S+  +TY  +    +  +D  TG I         +L +   A  +   +  TD G P
Sbjct:  405 DREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNF--DPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSP-PLGSTAKVTVVVGDLNDNHPVF---------------YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDA--------ARFQVNAVTGAVSTRV--SLDREERAV-YQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGD-QRGSF---SIEWSGGRIFTANAIDREEQAFYQLRVVA-----NSGGVAGEASVSVLVHDVNNHAPVF-DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVK--------YEIGEGNGGEK--FGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEV----GSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRP 949          

HSP 2 Score: 124.405 bits (311), Expect = 5.035e-29
Identity = 142/620 (22.90%), Postives = 272/620 (43.87%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRI--RQSIDREKVSNPLNFSINCQDNGQP-LLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIF----DDKDIGENS--RISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS---ISIDPFTGEISLTKDIE----AGKYDLFLQVTDNGNPM---RNSSANLTIIIYQQN 1985
            + L+++A   G   +     + + + D+N+ AP F   +Y   + ED  V S    V A D++SG  G++ Y++ +        +  DG    + ++   +++D+ T     LTV A D+         T V + ++DVN+++P  +  S              Y     E       V  +   D D G NG V    +  ++    F LDS     +      LR+  R+++ R+  +   +FS+   D G+P  L+    +QV V D N+ P  F +S Y  S+ E+  N + +L     D D     AL +     N    F +++        S+G+I +   LDRE++  Y   +   +     +   +  TV+V VLD NDN P++   +   +  + + S  +G+L+      D+D G +   R +I +  T      ++ +G+           + + + +D+E     ++++   D G P   +   ++V++ D NDN P ++      +++     NI  GT++  V A D D+  +  L Y +  +       +IDP +GEI    +I+     G +++ ++ TD   P+   R++  N+T+++  +N
Sbjct:  727 YQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQ---LYVR---YELDRETREEYSLTVSAMDTGVEPLSSSVT-VNVTVLDVNDNKPLFNSSS--------------YVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQV---NFELDS-----ETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDA--------STGQITLLGSLDREETASYTLVVSATDSG--TSPLAASCTVAVQVLDENDNPPRFTESL---LSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGS-----------VFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIME----NIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDEN 1286          

HSP 3 Score: 106.301 bits (264), Expect = 1.892e-23
Identity = 115/500 (23.00%), Postives = 209/500 (41.80%), Query Frame = 3
Query:  261 CSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLA-----VGSVILKVHAIDRESGDFGKIIYKLIKNED--FSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQ---PLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQD---------ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFE--MKENNIPSYELGQLIFDDKDIGENS--RISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW 1691
             +  +L + + D ND +P+F    Y+  V ED A       +VI  V A D +SG FG++ Y L  +ED  ++     +   +G + + +PL    +    + A  + +         + + ++D N++ P  SV +D   +            E+ E+ P    +  I+  D DEG N +++  I +          + R  +  +    +L + +++DRE+ S   N  +   D  +     L S + + + + D N+    FT    +L+  ++     + +   +D D         AL+ +              F L+++T   GE+R+   LDRE    Y  ++  V++ +     TS AT++V V D NDN P++  R  +E  + E+  P  E+ +L   D D G N   R  I+S   T            D      L  L V + +D E   + ++ +   D G P   +  S+ V + D ND  P +
Sbjct: 1598 ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRAR-ATDGGGLAATARLYVNVLDANDNAP--SVQNDSLAA------------EVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDP-------EGRFAVGNDG---QLSVARALDRERQSF-YNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVT---GEVRLVRELDREARQSYALTVLAVDKGR--PPLTSTATLAVTVGDANDNAPRFP-RREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTG-----------DFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAF 2054          

HSP 4 Score: 100.908 bits (250), Expect = 9.343e-22
Identity = 109/430 (25.35%), Postives = 186/430 (43.26%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQP-QLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQT--TKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSN-PLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVI---DQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGEN 1445
            D E IP + L ++A D G+P    ++  LV+ + D+ND AP+F    Y   + E    GS +  V A+D +SG   K+ Y ++   D    + S+D ++G +        +D+     + L + A D      K  +T + + ++DVN+  P  +    K  +T + N  P  F            V  ++  D D G+NG V+           + +F LDS           K+   +S+DRE++   PL   +  QD G P L ST  + V V D N+   +F    Y  SI+EN+   + ++       D+ A     + L +    +   F ++++T   G +     LDRE+   YQ  +  ++    + +  S A V++ V D  D  P +     SF + EN  P   +G +     D+  N
Sbjct:  299 DRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL--GWFSVDESTGLVTTDG---KVDREVASSVVLNISAQDQGAQ-PKTAYTSLTVTLLDVNDEPPLFT--QTKYVATAVENSLPGLF------------VVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDS--------LTGKVTTLKSLDREELEEYPL--VVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAG---DAARFQVNAVT---GAVSTRVSLDREERAVYQLQVTALDGG--HLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN 690          

HSP 5 Score: 99.3673 bits (246), Expect = 2.298e-21
Identity = 123/597 (20.60%), Postives = 247/597 (41.37%), Query Frame = 3
Query:  249 QPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT--LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEV--SFINVV---DKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQ-DNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI-LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWI---YPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            +P + S  ++ I + D+ND  P F        V+E+   G VI  + A D + G    + Y ++   +   +FV +D  SG +   + L   ++ +  LTV A D            + + + D N++ P  S  +              Y  ++ E+   + +   + I  V   D D G  G+V   +  ++   +  + D    L+  T    L + + +DRE  +  +       D G   L +T  L V+VLD N+        + +  + E+     S+L  +  D D     E   + S+      F + +     G++ +   LDRE+   Y   + V + A+    + +S   VS+++ D+NDN P +    S    E++     +  +   D D G NS +  + L T               F ++ +   +++ + +D E   +  + +   D+G P   +  ++ V + D NDN P +    Y +++         +   GT++ R+ A D D  ++  L Y++ +   +    +DP  G +++ + ++      Y+L ++  D G P R+ +A++ + +   N
Sbjct: 1493 RPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSE--GAFV-VDAASGVLRASRRLDREERASYLLTVRASDGTHATDA----RLSVAVRDANDNSPRFSRHA--------------YSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSE---DSDWADGAFGLHPVTG--ALNVTRPLDRESRACYV-LRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGN----DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYA-LATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAE-------DEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVN 2048          

HSP 6 Score: 95.9005 bits (237), Expect = 3.418e-20
Identity = 135/600 (22.50%), Postives = 245/600 (40.83%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKL---------TLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSIL-SFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFT-SFATVSVV-VLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNC--------------KIDIHFHDEGFPKNHNKIS---IIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSI--SIDPFTG--EISLTKDIEAG 1895
            D E   ++ L + A D G   L SS  + + ++D+ND  P F + +Y     E+  VGS++  V A D ++G  G + Y   K +    +F  +D  +G I   + +FD + L         + +V A D        D   V +F+ DVN++ P  +                +Y   + E+     ++  +   D DEG NG ++  I       N      +  ++ +T Q  L    S+DRE+ ++     ++  D+G   L ++  + V VLD+N+ P  FT S  S+  +E+     +L +    D+D     +            +F   ++ +S+G + +   LD E    Y+ ++     A+D  +   S AT+ VV V D NDN P ++    F     NIP                   I    +T T   P   ++G E  + I+         ++D E    C              ++ +   D+  P +  + +   + V + DENDN P ++ P++    + +  +   +G+ +  ++A D D   +  + Y +     +I   +D  TG  E S   D E+G
Sbjct:  821 DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQ---VNF-ELDSETGRIASLR-VFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA--------------KSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAI-------NEGNEGGKFTVDASTGQITL--LGSLDREETAS-YTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATF---AIDRSTGSVFLARRLDFETQRLYRLNV----SAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIP-------------------IGTRVITVTARDPDADVNG-ELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTA----ILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRESG 1360          

HSP 7 Score: 79.7221 bits (195), Expect = 2.793e-15
Identity = 149/619 (24.07%), Postives = 258/619 (41.68%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNIS---VGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEG-KNGDVKCQIQTTKLLKNLFYLDS----RMRLNKNTYQYKLRIRQSIDREKVSNPL-NFSINCQDNGQPLLKS-TIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMES---FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNE-AQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL--KILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI--NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS-ISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E  P + L + A D G P+     ++ + + D ND  P F    Y   V ED  VG+ +  +  + R  G                   V  D  +G +  ++PL F+  +  TL++ A D          T  VI ++DVN++ P I    +    R+++            + E+       + + V D D    NG++   I      +  F L +     +R+        L++   +DRE++  P+ N +I   DNG+P+ +S T  L V V D N++   F  S Y+ ++ E     S +     +D D+       LN+   +++ S       S+ +S+G +     +DRE +     +I   ++ AQ  T +TS    +V +LD+ND  P +   +      EN++P   +  +   D D+GEN  +  +      + P       E +F +  L  K+  +K S+D E +    + +   D G P   +   + V + D NDN P + YP     V   + I  N   GT +T V A D D  ++  + Y+L A   +   ++  TG +S    +   E   Y L +   D G+    S A +TI +
Sbjct:   95 DREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDL--LHRGRGPLA----------------VPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRAT-AVIQLLDVNDNDPAIRFVYLPPAARSAS------------VDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNE-RGHFVLHAPGVPGLRV--------LKVASQLDRERI--PMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADS------GLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSL---TVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYN------FDPDMPAQYRE-MFRLDSLTGKVTTLK-SLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YP-----VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITV 648          

HSP 8 Score: 70.0922 bits (170), Expect = 2.227e-12
Identity = 46/174 (26.44%), Postives = 82/174 (47.13%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEI 707
            D E    + L ++A D G+P L S+  L + + D ND AP+F  + Y   + ED   G+ +L++ A D + G  G++ Y +   +   T    +D   GT+ + +PL D ++     L V A D     ++ D   V + + DVN+  P   +      + +   G P+  L++
Sbjct: 1908 DREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGD--PTGDFRLDPVLGTLAVARPL-DRERTASYELAVRARDGG-GPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQV 2077          

HSP 9 Score: 57.7658 bits (138), Expect = 1.367e-8
Identity = 62/242 (25.62%), Postives = 97/242 (40.08%), Query Frame = 3
Query: 1308 VSVVVLDINDNVPQY--VGRMSFEMKENNIPSYELG-QLIFD---DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI-------LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTK--DIEAGK-YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            V VVV D+NDN P +   G M    KE+      +G Q++ D   D+D+G N       +    Y   + +SGNE+   +    +       L     +D E   +  + +   D G P+ + ++ + V + D NDN P +  P+   +V   S +       L R R   A                  +  DP TG +S  +  D EA + Y L L+  D GNP  +  A   I +   N
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKED----AAVGRQVLLDTAVDRDVGPN------GVNHHAY---KIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHRGRGPLA------------------VPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVN 219          

HSP 10 Score: 52.7582 bits (125), Expect = 4.267e-7
Identity = 63/271 (23.25%), Postives = 117/271 (43.17%), Query Frame = 3
Query: 1212 NPLDREKSPRYQFSIFVVNEAQDNTKFTSFA--TVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPE----WIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSN-RLTYELKAKHDS---ISIDPFTGEISLTK-----DIEA-GKYDLFLQVTDNGNPM-RNSSANLTIII 1973
             PLDRE +P Y  ++    +A+D      +    V+V V D NDN P      +FE      P+Y     + +D  +G     ++  L     GP         + +  +  ++  +Q +D+E      + +   D G P    + + ++ +LD NDN+P     ++ P++    V+ S      GT    V   DADS ++N  L+  +   ++    +   P    + + K     D E    Y+L +  +DNG P+ R+++A+L + +
Sbjct:   92 GPLDREANPSYALAV----QAEDGGSPRRYGRLQVNVTVQDANDNPP------AFEK-----PAYRAS--VAEDSPVGA----ALRDLLHRGRGPLA-------VPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDES---AAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYV 331          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 5.714e-29
Identity = 136/587 (23.17%), Postives = 240/587 (40.89%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI--NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            G+P+L  +  + + + D ND  P+F A      V ED  +GS +  V+A D ++G    I Y+L   +       S++ ++G II    L     +   L V A D            +V+ + DVN+H P            + LN   + +     + P    V  +   D D G NGD++  +  +      F +D R  +          I  +   +   + L  ++   D G P   +   + V   D  E+P  F     S S  E++    +I   A           +HL S  N       + ++   SGE+ +   LD E    YQ    +V EA+D+    F+++  + V VLDINDN P++     +     N P   +  L   DKD G N ++  S +     G   +++ N       E++ +    ++D E + + ++ +   D G P  H  + +++++ DENDN P +    S       +H+  +   G  + RV  +DAD   +  +T+ L       SI P TGEI++++ +       +       +P    S ++TI++   N
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGD----GHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTP------------RFLNAPYVAYAP--SSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA--SAGFSVDPRRGV----------IHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPR-FAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLG----DVFAVDPQSGEVSVHRALDHE----YQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNI-GNVFRVNPNS-----GEIRSV---STLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFS-------AHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVN 533          

HSP 2 Score: 80.1073 bits (196), Expect = 2.102e-15
Identity = 134/624 (21.47%), Postives = 264/624 (42.31%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNE---FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSP----------RYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNED-LFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK--DIEAGK-YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D+E+   + L + A D G P   +  KL +D++DIND AP+F +  +   V E+    ++++ + A+D++SG  G++ Y +I + +    F  ++ NSG I     L   ++    LTV+A D            V+I + D N++ P           TQ+ + +      + E+    F V  ++ +D DEG N  +   +           LD  +  + +    ++ + + ++RE  S    +++  + +      ST +  V V D N+    F ++ Y +   E  +  ++++  +  D D  +  +   F  + + NF         + + SGEI    PL R + P          +Y F +  ++  +     +S ATV++ ++  N N P+++  R S  +      +   G  I D    D D   N +I+ S            + GN    F +     L ++ S+  +      + +   D G P   ++ + I+++ +EN   P + +P  L+  +  +H    +G+ L RV A D D+  +  + Y + +   S    I   +G++ L    D E  K Y+L +   D G   +   + ++I +   N
Sbjct:  295 DHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSII-DGNIGNVF-RVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCT-VKVLISVTDENDNSPRF---------TQIFSAH------VREDAAVGFPVLRVSTLDADEGPNAAITFSL-----------LDPSLPFSIHPSTGEITVSRRLNREDRS---GYAVKVRASDPAWTVSTDVTIV-VDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFR--------VGRDSGEIHSVRPL-RYRDPAGGGSGANLNKYSFVVTAMDRGR--PPLSSDATVTINIVVPNANAPRFLRERYSTPVA----ATVRAGTRILDMSAVDPDRDVNGQIAYSV-----------VGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHP-PLELSLPENH---PAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVN 854          

HSP 3 Score: 77.7962 bits (190), Expect = 1.050e-14
Identity = 116/519 (22.35%), Postives = 207/519 (39.88%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT--LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYL---DSRMR-LNKNTYQYKLRIRQSIDREK-VSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLS--------SLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVL-DINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGP-TEKLSGNE----DLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPE 1688
            DYE    + L + A D G         + I + D+ND  P   A +Y  V+ E+   G+ +L + A+D +S      +Y L   +D       ++  +G +  +  L    K T  LTV A +  +    +    V + I  VN + P       +R           Y   + E+ P    V  +   D+D G +G V             FY+   +SR +  + N +  ++ +   +DRE+  S  L        + +      +++ V + D N+ P +F+ + Y   + E          A +    +  +    +S   +   SF +         S+   +G I + +PLDRE  P Y  ++  V+  +     T   TV VV L D+NDN P ++   S ++ EN      +  L   D D+  N             GP T +L G++      F +S   +L+  + +D E      + +   D G P   + +++ +++LD+NDN  E
Sbjct:  819 DYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL---DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPD-TFHYSTAQVHVQITGVNEYFPRFV----QRE----------YNFVVSESAPVGAPVGSVFATDRDAGIDGTV-------------FYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEA---------ASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGT---TVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNK------------GPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSE 1280          

HSP 4 Score: 77.411 bits (189), Expect = 1.448e-14
Identity = 95/422 (22.51%), Postives = 169/422 (40.05%), Query Frame = 3
Query:  213 KFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-----------VSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIG 1439
            K+   + A D G+P L S   + I+I+  N  AP+F+ + Y+  V   +  G+ IL + A+D +    G+I Y ++   + S  F            S+ G++G+I            ++TVEA D          T  +I + + N + P  +              +P   L + EN+P    ++ +   D D G NG +   I +          D     + +     + +   +D E      N S+   D G         + + V D N+ P +   S+Y   I EN     ++L    +D D+ S N   + S ++   + F    L Q +G +     LD E    Y+ ++   N    +T   S A V V +  +N+  P++V R  +F + E+      +G +   D+D G
Sbjct:  616 KYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGG-NASRRFDVDAGGFLHLRASLAGDAGSI-----------FSVTVEARDRGRPPLSSRAT-AIISVTEENQYAPRFA--------------HPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASG---------DGSGLFDISRASGDVLLVGELDYE-TEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPS-NAVTMYSLDDGEADLF---VLNQKTGVLTTQGFLDYETKQTYELTVRAFNYP--DTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAG 994          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 5.725e-29
Identity = 136/587 (23.17%), Postives = 240/587 (40.89%), Query Frame = 3
Query:  246 GQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI--NIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            G+P+L  +  + + + D ND  P+F A      V ED  +GS +  V+A D ++G    I Y+L   +       S++ ++G II    L     +   L V A D            +V+ + DVN+H P            + LN   + +     + P    V  +   D D G NGD++  +  +      F +D R  +          I  +   +   + L  ++   D G P   +   + V   D  E+P  F     S S  E++    +I   A           +HL S  N       + ++   SGE+ +   LD E    YQ    +V EA+D+    F+++  + V VLDINDN P++     +     N P   +  L   DKD G N ++  S +     G   +++ N       E++ +    ++D E + + ++ +   D G P  H  + +++++ DENDN P +    S       +H+  +   G  + RV  +DAD   +  +T+ L       SI P TGEI++++ +       +       +P    S ++TI++   N
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGD----GHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTP------------RFLNAPYVAYAP--SSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA--SAGFSVDPRRGV----------IHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPR-FAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLG----DVFAVDPQSGEVSVHRALDHE----YQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNI-GNVFRVNPNS-----GEIRSV---STLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFS-------AHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVN 533          

HSP 2 Score: 80.1073 bits (196), Expect = 2.104e-15
Identity = 134/624 (21.47%), Postives = 264/624 (42.31%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNE---FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSP----------RYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNED-LFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK--DIEAGK-YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D+E+   + L + A D G P   +  KL +D++DIND AP+F +  +   V E+    ++++ + A+D++SG  G++ Y +I + +    F  ++ NSG I     L   ++    LTV+A D            V+I + D N++ P           TQ+ + +      + E+    F V  ++ +D DEG N  +   +           LD  +  + +    ++ + + ++RE  S    +++  + +      ST +  V V D N+    F ++ Y +   E  +  ++++  +  D D  +  +   F  + + NF         + + SGEI    PL R + P          +Y F +  ++  +     +S ATV++ ++  N N P+++  R S  +      +   G  I D    D D   N +I+ S            + GN    F +     L ++ S+  +      + +   D G P   ++ + I+++ +EN   P + +P  L+  +  +H    +G+ L RV A D D+  +  + Y + +   S    I   +G++ L    D E  K Y+L +   D G   +   + ++I +   N
Sbjct:  295 DHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSII-DGNIGNVF-RVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCT-VKVLISVTDENDNSPRF---------TQIFSAH------VREDAAVGFPVLRVSTLDADEGPNAAITFSL-----------LDPSLPFSIHPSTGEITVSRRLNREDRS---GYAVKVRASDPAWTVSTDVTIV-VDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFR--------VGRDSGEIHSVRPL-RYRDPAGGGSGANLNKYSFVVTAMDRGR--PPLSSDATVTINIVVPNANAPRFLRERYSTPVA----ATVRAGTRILDMSAVDPDRDVNGQIAYSV-----------VGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHP-PLELSLPENH---PAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVN 854          

HSP 3 Score: 77.7962 bits (190), Expect = 1.051e-14
Identity = 116/519 (22.35%), Postives = 207/519 (39.88%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT--LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYL---DSRMR-LNKNTYQYKLRIRQSIDREK-VSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLS--------SLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVL-DINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGP-TEKLSGNE----DLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPE 1688
            DYE    + L + A D G         + I + D+ND  P   A +Y  V+ E+   G+ +L + A+D +S      +Y L   +D       ++  +G +  +  L    K T  LTV A +  +    +    V + I  VN + P       +R           Y   + E+ P    V  +   D+D G +G V             FY+   +SR +  + N +  ++ +   +DRE+  S  L        + +      +++ V + D N+ P +F+ + Y   + E          A +    +  +    +S   +   SF +         S+   +G I + +PLDRE  P Y  ++  V+  +     T   TV VV L D+NDN P ++   S ++ EN      +  L   D D+  N             GP T +L G++      F +S   +L+  + +D E      + +   D G P   + +++ +++LD+NDN  E
Sbjct:  819 DYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL---DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPD-TFHYSTAQVHVQITGVNEYFPRFV----QRE----------YNFVVSESAPVGAPVGSVFATDRDAGIDGTV-------------FYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEA---------ASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGT---TVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNK------------GPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSE 1280          

HSP 4 Score: 77.411 bits (189), Expect = 1.449e-14
Identity = 95/422 (22.51%), Postives = 169/422 (40.05%), Query Frame = 3
Query:  213 KFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSF-----------VSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK-DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIG 1439
            K+   + A D G+P L S   + I+I+  N  AP+F+ + Y+  V   +  G+ IL + A+D +    G+I Y ++   + S  F            S+ G++G+I            ++TVEA D          T  +I + + N + P  +              +P   L + EN+P    ++ +   D D G NG +   I +          D     + +     + +   +D E      N S+   D G         + + V D N+ P +   S+Y   I EN     ++L    +D D+ S N   + S ++   + F    L Q +G +     LD E    Y+ ++   N    +T   S A V V +  +N+  P++V R  +F + E+      +G +   D+D G
Sbjct:  616 KYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGG-NASRRFDVDAGGFLHLRASLAGDAGSI-----------FSVTVEARDRGRPPLSSRAT-AIISVTEENQYAPRFA--------------HPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASG---------DGSGLFDISRASGDVLLVGELDYE-TEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPS-NAVTMYSLDDGEADLF---VLNQKTGVLTTQGFLDYETKQTYELTVRAFNYP--DTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAG 994          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 165.236 bits (417), Expect = 2.052e-41
Identity = 163/618 (26.38%), Postives = 279/618 (45.15%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNT--KFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNE-DLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW---IYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK-HDSISIDPFTGEISLTK-DIE-AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            DYE   ++ L + A D G P    + ++ I I D+ND +P F   NY+K + E   +GS ++ V A D +SG  G++ Y+LI   +   +F +ID NSG+I +   L   D+ T     L VEA D    +     T V I + D+N++ P             +  G   Y   + E++    ++  +   D D+  NGDV+  +            D+    + NT    + ++  +D EK +  +  ++  +D G P   S  +++V V D N+ P  F +S Y+ ++ EN     ++      D D+     +S++    N +  F M+ F        +GEI    PLDRE    Y  +I     A D +  +F +  TV++ + D NDN P + G   F + E++     +GQL   D+DIG N  ++ +            +SGN+ + F +     IL V+ ++D E I +  + +   D G P+     SI V++LD NDN P +   ++   +    ++    +Q       V+  D D  S+  +T  L  +  D+ +ID     +S T  D E    Y L +   D G+P ++++A + I I   N
Sbjct:  437 DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISG-NVKGAF-NIDANSGSIRVSSEL---DRETTPSYSLQVEARDGGSTSRSS-STRVTIALQDINDNSP-------------IFQGP--YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALS-----------DNTDVFSINTSTGLITLKTQLDYEKKTQYM-VTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRF--------TGEITTRVPLDRETIASYSLTI----NADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYA-----------IISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQ-------VKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVN 991          

HSP 2 Score: 149.828 bits (377), Expect = 1.289e-36
Identity = 143/578 (24.74%), Postives = 264/578 (45.67%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQD--NTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEW---IYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSI--SIDPFTGEIS 1871
            D E    + + L A D G P       + I+I+D+ND  P F +  YT  V ED+A+G+ ++ V A D+++G+   + Y        +    ++D  +G + + + L D ++     L L+V    S       D +H++I + D+N++ P  S  +              Y   + EN P   +VS     D+D   NG +   I        +F +D    +        + I +S D E  +   + ++  +D G P+   T  + + + D N++  +F+ SNYS  I E+     ++++    D D+     L +     N    FN+++        +SG IR+ + LDRE +P Y   +    EA+D  +T  +S   V++ + DINDN P + G   F + E++ P +++GQ+   D D   N  +  +            LS N D+F I +   ++ +K  +DYE      + +   D G P   +   + V + D NDN P++   +Y  ++         N+ +G  +  V A DADS ++ +++Y + + ++++  ++D FTGEI+
Sbjct:  230 DRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGN--TNHAFTLDAVTGVVTVSRSL-DFEQRSSYALGLSVTDRGSPPLT---DTSHLLINVNDINDNPPVFSPSA--------------YQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGN-DDGVFTIDGSTGI--------ISIAKSPDYENKTR-YDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDA--------NSGSIRVSSELDRETTPSYSLQV----EARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYA------------LSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGE-------NLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEIT 743          

HSP 3 Score: 148.673 bits (374), Expect = 3.348e-36
Identity = 158/608 (25.99%), Postives = 272/608 (44.74%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQD--ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E    + L++ A D G+P   +   + + I D+ND +P+F    YT  V E+ A GS IL+V A D ++G  G++ Y +I   +   +F  ID  +G I +   + D + L    LT+ A DS        W       I V +   N  + +   TS  +  G  I              V+ +   D+DEG N  V   I   +   + F +        N     L +++ I+RE V      +I   D G P++ S   L V V D N+ P +F   +Y  S+ EN   + S+L+ A  D D  A +   + + S N  + + F ++S   +SG I    PLD E+  +Y   +        ++K+T+   V++ V+++ND  P +  +  +  ++EN+  S  + ++   D+D       S  SL+ +  G       + D F I +   I+     +D E +    I +   D G P   N   + + ILDENDN P++   S   +++     N    +   ++ A DAD  ++ R+TY L +++D+  I   +G I+L + ++      YDL +Q  D+G P + SS  + + +   N
Sbjct: 1162 DREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISG-NHGNAF-RIDSTTGRITVVG-VVDREALASYNLTISAKDSGVP----PWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSI-----------GSRVAVVTATDRDEGSNAQVFYSI--VRGDTSAFAI--------NAMNGVLTVKKEINRETVPT-YTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGN--DEKRFKINS---TSGVIMTTTPLDFEEKSQYGLEVTAT-----DSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD-------SFGSLSYSIVG-----GKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILE----NSAPSSFSFKLAATDADEGTNARITYNL-SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDIN 1713          

HSP 4 Score: 133.65 bits (335), Expect = 1.270e-31
Identity = 152/613 (24.80%), Postives = 262/613 (42.74%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTR-SNYSLSIIENKDNFSILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSG-NEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E  P + LQ+ A D G     SS ++ I + DIND +P F    Y   V E  + G  I +V A D +    G + Y L  N D      SI+ ++G I LK  L D +K T   +TV A D     S+   T V + + DVN++ P  +                +Y   + EN      V ++   D D G NG         K+  ++   +  M    + +  ++  R  +DRE +++  + +IN  D       +   + + + D+N+    FT  S +++S  ++     +      D+D     A+++     N  N+F ++          SG + + + LDRE  P Y   +   +        T  A++ V VLD+NDN P++   + S E++E+      + Q+  +DKD G N  I++S            LSG   D F I     +  K  +DYE     ++ +   D G P       + + I++ NDN P ++ P+ + ++     IN    T + ++ A D+D      LT+++   +   S  ID  +G IS+ K ++      Y L ++ T+ G+   +   N TI +   N
Sbjct:  542 DRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP-YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV----FSINTSTGLITLKTQL-DYEKKTQYMVTVTAKDGGTP-SRSSLTVVKVMVDDVNDNPPQFA--------------KSLYTCTVGENLAAGVAVCYVTATDADSGANG---------KISYSILSGNENMAFAMDRFTGEITTRVPLDRETIAS-YSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISE-DSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLD--------PRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSIT--ASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLS------------LSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAIN----THVVKLNATDSDGTP---LTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVN 1093          

HSP 5 Score: 132.494 bits (332), Expect = 2.862e-31
Identity = 155/610 (25.41%), Postives = 272/610 (44.59%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK-DNFSILSFAVIDQDA---LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA-KHDSI-SIDPFTGEIS----LTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E +  + L + A D G P   S+  + I + D ND +P F +   +  + E +++GS +  V A DR+ G   ++ Y +++ +   TS  +I+  +G + +KK +    +   TLT+ A D        D   + + + DVN++ P  +  S              Y   + EN+ ++  V  +   D D G N  ++  I            +   R   N+    +     +D E+ S      +   D+ +   K+ + ++V  ++ N+    FT+ NY+ S+ EN   + S++  +  D+D+   LS++      S+ F        S+ Q SG I   + LDRE    Y   + V +    N   ++   V++ +LD NDN P++     S  + EN+ PS    +L   D D G N+RI            T  LS N+     +   ++ + Q +D E      + I   D G P   + I+I V ++D ND+ P  I  SSL   V     N    T + R+ A DAD+  +  LT+ L + +H S+ ++D  TG+IS    L ++ +A  Y L + V D GNP  +S A++ I +  ++
Sbjct: 1267 DREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD---TSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDK-ELTVVVNDVNDNPPVFNSQS--------------YIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI---------ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQ-YGLEVTATDS-KYTAKTNVTIRV--INLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKF--------SIDQRSGIISTADVLDRELVSLYAIQVRVTDAG--NPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARI------------TYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP-LINSSSLRGSV---RENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQA-VYTLRIGVADKGNPSLSSVADVIIDVIDED 1818          

HSP 6 Score: 128.642 bits (322), Expect = 5.012e-30
Identity = 156/617 (25.28%), Postives = 268/617 (43.44%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKL--TLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP-----QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENS--RISISSLTTTCYGPTEKLSGN-EDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWI---YPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E    + L + A + G           I ++D+ND AP F   +Y K + E+L +G  + KV A DR+ G+  K+ Y+L   +   TS   ++  +G +  K+PL   D+   +L V A D  +  S+     + + I D+N++ P  S                 Y L + EN      +  +   D D G NG V   I +     N F +DS           ++ +   +DRE +++  N +I+ +D+G P   ST  + + V D+N+   +F  +  S  I E     S +      D+D  S N     S    +  +F ++++   +G + +   ++RE  P Y  +I   +    +   TS   ++VVV D+NDN P      Y+G     ++EN+  S  +  +  DD D+G N+  R SI             +SGN E  F I S   ++     +D+E      +++   D  +     K ++ + +++ ND  P +    Y +S+         N  + T + +V A D DS  S  L+Y +    DS   SID  +G IS    ++      Y + ++VTD GNP  ++   +TI I  +N
Sbjct: 1058 DRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGD---TSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKP-SQSAVAAITLTINDLNDNSPQFSQSK--------------YTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGN-HGNAFRIDSTTG--------RITVVGVVDREALAS-YNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGS-NAQVFYSIVRGDTSAFAINAM---NGVLTVKKEINRETVPTYTLTIRASDRG--SPMMTSDKELTVVVNDVNDNPPVFNSQSYIG----SVRENSAQSTSVLTVAADDSDVGANAVLRYSI-------------ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTA---KTNVTIRVINLNDITPAFTQQNYTASV-------RENSPTSTSVVKVSASDRDSFGS--LSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDEN 1611          

HSP 7 Score: 126.331 bits (316), Expect = 2.086e-29
Identity = 145/597 (24.29%), Postives = 264/597 (44.22%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNT--KFTSFATVSVVVLDINDNVPQYVG-RMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-KILQVKQSMDYEFIHNCKIDIHFHDEGFP--KNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDI---EAGKYDLFLQVTDN 1928
            DYE    + L + A D G P   ++ ++ I II++ND  P FV+      + ED+A+ + ++K++A D    D   + + ++  E  + S   ID +SG I + K L        TL V A ++        + +  I ++DVN++ P  + GS              Y   + EN P    V+ +   D+DEG+N  V  ++      K  F ++    L        +  ++ +DRE  ++  +  +   D+G+P   +   + + + D N+    F++S Y+L++ EN  N S IL     D DA     ++++    N  N F ++S        ++G I +   +DRE    Y  +I     A+D+    + S A V++ V D NDN P +     S+ + E       +  +   D+D G N+++  S            + G+   F I+ +  +L VK+ ++ E +    + I   D G P   +  +++++VN  D NDN P +   S + +V      N    T +  V A D+D  ++  L Y + + +D     I+  +G I  T  +   E  +Y L +  TD+
Sbjct:  956 DYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDS---DGTPLTFDIV--EGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESV-YNNATIRVLDVNDNAPVFNPGS--------------YAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK--FEVNPATGL--------VTTKRPLDREDQAS-YSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDS--------TTGRITVVGVVDREALASYNLTI----SAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYS-----------IVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVN--DVNDNPPVFNSQSYIGSV----RENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS 1492          

HSP 8 Score: 108.997 bits (271), Expect = 5.244e-24
Identity = 146/580 (25.17%), Postives = 249/580 (42.93%), Query Frame = 3
Query:  279 VIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF--ATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGN-EDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGK---YDLFLQVTDNGNPMRNSSANLTII 1970
            +I + D+ND AP F    Y   V ED+AVGS++ ++ A+D + G   ++ Y L+  +   TS+ ++D  S  +I  K  FD +      + + A D     S+     V I I+DVN++RP  S       S Q       Y   + E+      +  +   DKD G N D++    T+    + F LD+   +        + + +S+D E+ S+     ++  D G P L  T  L ++V D N+ P +F+ S Y   + EN    + +S    D+D     AL F     N    F ++         S+G I I    D E   RY  ++    +A+D      +  A V++ + D+ND+ P +     S ++ E+ +    +  +   D D G   R+               +SGN +  F I +    ++V   +D E   +  + +   D G     +   + + + D NDN P +  P     V  +S  +   G ++ +V A DAD  S+  + Y L    D  SI+  TG I+L   ++  K   Y + +   D G P R+S   LT++
Sbjct:  155 LITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD---TSYFTVD--SQGVIRTKGAFDRETKASYQVALRAQDGGSP-SRSGQATVEIEILDVNDNRPVFS-------SAQ-------YTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF-TSGNTNHAFTLDAVTGV--------VTVSRSLDFEQRSS-YALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS--ATDRDSSTNGALVFGIIKGNDDGVFTIDG--------STGIISIAKSPDYENKTRYDLTV----QARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEY-----------RLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPY----VFRVSE-SSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSS---LTVV 671          

HSP 9 Score: 108.227 bits (269), Expect = 8.887e-24
Identity = 139/537 (25.88%), Postives = 240/537 (44.69%), Query Frame = 3
Query:  201 EFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK--DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKF--TSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI-LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDAD 1787
            E +P + L + A D G P + S ++L + + D+ND  P F +++Y   V+E+ A  + +L V A D + G    + Y +I   D       I+  SG I+   PL   +  +  L V A DS ++ +K   T+V I +I++N+  P  +  +              Y   + EN+P +  V  ++  D+D    G +   I   K   + F +D R  +        +     +DRE VS      +   D G P L +   + + +LD+N+    F  S+YS SI+EN    +FS    A  D D  +      N S N   ++F + +   SSG I +  PLDRE    Y  +I    +A+D+      S  T+ V V+DIND+ P      +   ++EN      + +++  D D G N+ ++ S L+            ++ +F +      +  K  +D E      + I   D+G P   +   +I++++DE+DN P +  P+  +  V IS  ++  G  + +V A D D
Sbjct: 1373 ETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND--EKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS-KYTAK---TNVTIRVINLNDITPAFTQQN--------------YTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKD-SDKFSIDQRSGI--------ISTADVLDRELVS-LYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFS-FKLAATDADEGTNARITYNLSRN---DAFMIGA---SSGVITLAQPLDRENKSTYDLAI----QARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNE----------HKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF-QPTEYN--VTISE-SLPRGASIVQVTARDID 1852          

HSP 10 Score: 97.8265 bits (242), Expect = 1.254e-20
Identity = 131/574 (22.82%), Postives = 244/574 (42.51%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHV----VIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED-LFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDIE 1889
            D E   ++ L ++A D           +VID+ D ND AP+F   +Y   ++E+     V + V A DR+SG    I Y L   E+    F+ ++  +G I    PL    K + T+         S FD  H     +I + DVN++ P  ++               +Y   ++E+      V  +  VD D G N  +   + +     + F +DS         Q  +R + + DRE  ++    ++  QD G P       +++++LD N+   +F+ + Y+ S+ E+     ++++    D+D  +  +   + ++     +F L ++T   G + +   LD E+   Y   + V +    +   T  + + + V DINDN P +         + N P+    Q+   D+D   N  +         +G    + GN+D +F I     I+ + +S DYE      + +   D G P  ++   + + I D ND+ P +  PS+    +  S +    G+ +  V A D DS    RL Y L + +   + +ID  +G I ++ +++
Sbjct:   29 DRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSLFSGEN---KFM-MNSKTGEIRTVTPLDHETKDSYTMRI-------SAFDGKHTTFVPLITVDDVNDNAPFFALS--------------VYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD--TSYFTVDS---------QGVIRTKGAFDRETKAS-YQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVT---GVVTVSRSLDFEQRSSYALGLSVTDRG--SPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT--QVSATDRDSSTNGAL--------VFG---IIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-SPSNYSKQIPESTV---IGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELD 542          

HSP 11 Score: 88.5817 bits (218), Expect = 9.918e-18
Identity = 83/293 (28.33%), Postives = 138/293 (47.10%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT--LTVEAHDSAEHNSKFDWTHVVI--FIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN 1061
            D E +  + +Q+   D G P L +   + I I+D ND +PKF + +Y+  + E+ A  S   K+ A D + G   +I Y L +N+ F      I  +SG I L +PL   +K T  L ++A D   H +    + + I   +ID+N+HRP I+  S        L G       + EN P+   V  I   D D G N ++   + + +  K++F LD       NT    +  +  +DRE+ +      I   D G P L S   + +DV+D+++    F  + Y+++I E+
Sbjct: 1576 DRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAF-----MIGASSGVITLAQPLDRENKSTYDLAIQARD---HGTPPQASSITIRVTVIDINDHRPLINSSS--------LRG------SVRENQPKETHVMRILASDADTGLNAELTFSLLSNE-HKSVFTLD-------NTTG-DISTKVPLDREQQA-VYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISES 1836          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 164.851 bits (416), Expect = 3.544e-41
Identity = 160/607 (26.36%), Postives = 281/607 (46.29%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FD-IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVS----FINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN-KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHD---SISIDPFTGEISLTKDIEA---GKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E +P + LQ+ A D G P   ++  + I ++D+ND  P+F  K Y+  ++ED+ V  ++  V A D + G  G++ ++++   D +  F SI+  +G + +K+ L ++ I    L V A D  +    ++ T V I +IDVN++ P   V S  +T                   PEN+ V      +   DKD G NG++     T   ++N    D    +N+NT    + I++ +DREKV     F I  +D G P  + T  + + +LD N+ P  F++  Y  SI EN +   S+L    ID D+   N  +   S++ +   F ++      G I +   L+      Y FS+     +  +   +S A V V V D N + P++  R  S E+KE+      +  ++  D+D G N++IS S  T       ++ +G           +++   S+D E +   + ++   D G P+   K  + ++I D NDN+P ++ PS    V      +I+ G ++  V A DAD   + ++ Y   +  D   + +ID   G I   K ++     +Y+L +  TD G P   +S  + +I+
Sbjct:  193 DREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMN--FFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQP-FLYNQTTVDIALIDVNDNAPQF-VSSHFQTMI-----------------PENYAVGQEFYRVQAYDKDHGTNGEI-----TFSFMQN----DLPFSINENTG--GISIKEELDREKVPK-FTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINP----QGLITLSCTLNYNTKHVYVFSV-----SASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTG-----------VIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVRE----DIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVIL 742          

HSP 2 Score: 144.821 bits (364), Expect = 5.407e-35
Identity = 168/642 (26.17%), Postives = 282/642 (43.93%), Query Frame = 3
Query:   75 DSAQNGVYHYLLECSQK-SHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKL---TLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN----KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCY----GPTEKL------SGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLF---LQVTDNGNP 1937
            DS  NG+  Y +  SQ      YF  +       +   + LD EF+ +   ++ A D G+P L     L I+++D+ND  P F    Y   + ED ++G  +L V A D +SG  G++ Y  I N D   S  SI   SG + + K L D +K+   TL V+A D          T V I ++DVN+  P  S                +Y   I E+ P N  V+ +   D D+G NG+V  +I +   + N F ++   R+N      ++R++Q +D E +    N  +  QD GQP L +   + + ++D N+    F  S++   I EN    ++ + + ++   D+D  +  E   +      M++    S+ +++G I I   LDREK P++ F I   ++     + T  A +++ +LDINDN P+      F  +E +               I ENSR   S L         GPT  +      SG++  F I+   ++ +  +++Y   H     +   D       +   + VN+ D N + PE+   S    V   + +    GT +  V A D D+ S+ +++Y +       S+D  TG I     ++  K D +   +  TD+G P
Sbjct:   48 DSGSNGMIRYSMSPSQNLMSATYF--SIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKY-CILNSDGDNSAFSIGEVSGAVTVMKKL-DREKVPTYTLQVQAQDQGNPPRSATVT-VKITLLDVNDCTPQFS--------------KKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDM-NFFSIN---RING-----EVRVKQKLDYEMI-GVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAY---DKDHGTNGEITFSF-----MQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGT--AQITITLLDINDNPPK------FSQEEYH-------------TSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGML---SSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASL----GTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIP 624          

HSP 3 Score: 123.635 bits (309), Expect = 1.894e-28
Identity = 135/508 (26.57%), Postives = 224/508 (44.09%), Query Frame = 3
Query:  312 PKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDF-STSFVSIDGNSGTIILKKPLFD--IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSN 1802
            P+F        V ED  VG+V+  V A D +SG  G I Y +  +++  S ++ SID  +G I  K+ L    +D+    V+A D  E + +  +  + I ++DVN++ P                   IY  +I E+      V  +   D D G NG+VK  I  +    + F +              + + + +DREKV       +  QD G P   +T+ +++ +LD N+    F++  YS +I E+   N  + +    D D  S  E  F + S N+ N       S+ + +GE+R+   LD E      F++ V  + +      +  TV + ++D+NDN PQ+V      M   N   Y +GQ  +     DKD G N  I+ S +             N+  F I+E    + +K+ +D E +      I   D+G P       I + +LD NDN P++   S  +   +I+  N + GT + +V+AID DS  +N
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLE-GYMDLTINVLDVNDNGPIFERN--------------IYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGE--------VSGAVTVMKKLDREKVPT-YTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMN-----FFSINRINGEVRVKQKLDYEMIG--VFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPEN---YAVGQEFYRVQAYDKDHGTNGEITFSFMQ------------NDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKF---SQEEYHTSIAE-NSRWGTSVLQVKAIDPDSGPTN 475          

HSP 4 Score: 76.6406 bits (187), Expect = 4.822e-14
Identity = 94/406 (23.15%), Postives = 173/406 (42.61%), Query Frame = 3
Query:  258 LCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTI----ILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQD-----ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVG-RMSFEMKENNIPSYELGQLIFDDKDIGE 1442
            L S+  + +++ D N  AP+F  ++Y+  V+ED ++G+ +L V A DR++G   KI Y +         F S+D  +G I     L +   D  +  +T   H   +  +K   + V I I DVN++ P                  P Y  ++ E+      V  ++  D D GKN  +     +    +  F +DS         Q  +R  + +DRE +      ++   D G P  ++++ ++V + D  + P LF +  Y +++ E+    S +++     QD      + ++    NS   F+        +  ++G I+    LD E    Y+ ++     A  +  FT   TV V + DINDN P      M+  ++E  +P     ++   D D+ +
Sbjct:  523 LSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI---ATLVPEF-SVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAK---SFVYIHIADVNDNDPVFL--------------KPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDST--------QGIIRTLKPLDRETIPE-YELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFD--------INPNTGAIQTLMKLDYETQSEYRLTV----RATLSPFFTE-TTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSD 885          

HSP 5 Score: 62.7734 bits (151), Expect = 8.092e-10
Identity = 63/243 (25.93%), Postives = 103/243 (42.39%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI------QTTKLLKNLFYLDSRMRLNKNTY-QYKLRIRQSI 896
            D E +  +  ++ A D G PQL +   + I I D+ND  P F+  +Y   V+ED+  G  +++V A D + G   +IIY    N D   +F +ID   G I   KPL    I +  LTV A D      +     V + + DV +  P              L   P+Y + + E+ P    V  +    +D      +   I      Q   +  N   + + M+L+  T  +Y+L +R ++
Sbjct:  605 DREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTF-TIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQAS-VKVKVILEDVKDSPP--------------LFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATL 831          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 137.117 bits (344), Expect = 4.537e-33
Identity = 166/659 (25.19%), Postives = 290/659 (44.01%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSS--QKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKP----------------------LFDIDKLTLTVEAHDSAEHNSKF--DWTHVVI--------FIIDVNNHRPNISVGS-------DKRTSTQLL---------------NGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLS---SLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE--LKILQVKQSMDYEFIHNCKIDIHFHDEGFPK-NHNKISII-VNILDENDNEP---EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYE-LKAKHDS-ISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSS 1952
            D+E   ++ L +   D G P L S     +VI ++D ND  P+F  K YT  V E+  VG+V+L+V A D++SG    + Y  I + +   +FV I  +SG I L KP                      L  I ++ + V      EH  +F  ++ +  I         I+ V     ++SVG+       D  +S   L                    Y  E++EN     +V  +   D+DEG NG V   I T+  +K +F  +S   +        + +   +DRE V    N  +  QD G P   ++  ++V+VLD N+ P +FT   Y+L + E       IL  +  D+D     +  +N+   + ++   +S   S+  ++G+I I   +D E+   Y F +F  +  +   + T  ++V + ++D+NDN P ++  R   ++ EN      + Q+   D D   N ++  S            L GN D  ++ +    ++   +S+DYE +    + I   D G P  N ++  ++ V++++ NDN P   + +Y +S+D    + H+       + RV A D DS  + ++ +  L+   D    +D  TG ++  K +   +  +Y L +Q TD G+P  NSS
Sbjct:  173 DFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYS-IHSGNTDDAFVII-ADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSS-VKGVFTTNSTTGV--------VSLTAELDRESVYQ-YNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDD---KDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGE--ARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFS-----------ILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHV-------ILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSS 796          

HSP 2 Score: 110.923 bits (276), Expect = 8.237e-25
Identity = 163/669 (24.36%), Postives = 280/669 (41.85%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKL---TLTVEAHDSAEHN-SKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYL-DSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKST--IILQVDVLDQNEYPALFTRSNYSLSIIEN-------------KDNFSILS-FAVIDQDALSFNEFHLNSSNNFNM--------------ESF-HLSSLTQ----------------------------------SSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVG-RMSFEMKENNIPSYELGQLIF-------DDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH--DSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSS 1952
            DYE    +   + A D G P   +   + + I D ND  P F    Y   V E+  +G+++ +V A+D++S     +IY  I+N + + SF +ID ++G I+ +K  FD +K     LT+   D+     S  ++ +VVI ++D N++ P     + KR           Y   ++EN      V  +   DKD G N  +K  I +         + DS            + + + +D+E + N     +   D G P L+S   +++ V V   NE+   F    Y+ SI EN             +D+ S+ + F  + +DA S   F +N + +  +              E + +++S TQ                                  ++G + +   LDRE    YQ+++ VV +   +   T+ A V V VLD NDN P +     + ++ E    +  +G  I        DDKD G N+ I            ++K S N+    I+      +KQ++DYE   +   ++   D G  +     S+ + I+D NDN P ++       +V     N+  GT +T+V A D DS  + ++ + +   +      ID  TG ++  K +   +  +Y L +Q TD G+P  NSS
Sbjct:   68 DYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYS-IQNGNNNGSF-TIDNSTGEIMTRKE-FDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEF---AQKR-----------YTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSG----------DISLDKPLDKETIEN-YTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESV--YQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSE----ATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIV---SKKFSINDTTGQIT------IKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVE----NVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSS 689          

HSP 3 Score: 88.5817 bits (218), Expect = 6.513e-18
Identity = 97/400 (24.25%), Postives = 178/400 (44.50%), Query Frame = 3
Query:  720 PENFEV--SFINVV--DKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED--LFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNIS-HINIQSGTKLTRVRAIDADSVSSNRLTYELK-AKHDSISIDPFTGEISLTKDIE 1889
            PE+F V  + + V+  D+D   N  V   I +     + F +D+   + +++ ++    ++           +FS+  +D G P+  +   + V + D N+   +F    Y   + EN    +I++    +D+D+ S  +   +  N  N  SF   ++  S+GEI      D EK+ RY  +I V +         +FA V ++V+D NDN P++   R +  + EN      + ++   DKD G N+ +  S             SGN D     I++   + + + +D E I N  + +   D G P   +   ++VN++    NE     P  L+   N S   N+  GT + RVRA++ D     R  Y +K A    + +   TG+I+L ++++
Sbjct:   13 PEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESDYFVIDNITGVVRSSKEFDYETQRM---------YSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGSF---TIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYS-----------IHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHA---PRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELD 386          

HSP 4 Score: 80.8777 bits (198), Expect = 1.662e-15
Identity = 112/437 (25.63%), Postives = 188/437 (43.02%), Query Frame = 3
Query:   75 DSAQNG-VYHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFG--KIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVV-IFIIDVNNHRPNISVGSDKRTSTQLLNGYPI-YFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKST--IILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP 1346
            D   NG V++Y++  S K      +     +   + L   LD E + ++ + ++A D G P   +S  + ++++D ND  P F    YT  + E  ++G+ IL+V A DR+  D G    I   +K+   S  F SI+  +G I +K+ +   ++ + + E   S    ++   +  V I IIDVN++RP                  P  Y++++ EN      V+ +   D D   NG V   I    L  N    D +  +++NT    +   +S+D E V+      I   D G P L S+   +L V V++ N+   +F++  YS SI EN      IL     D D+     + F+    NS   F ++        Q++G +     LD E    Y   I   +        +    + V V++INDN P
Sbjct:  416 DEGINGQVFYYIVTSSVKG-----VFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKF-SINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYF---------------LPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSI----LGGN---SDGKFVIDQNT--GVVTTNKSLDYEDVTE-YTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVD--------QNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP 813          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 131.339 bits (329), Expect = 7.482e-31
Identity = 169/604 (27.98%), Postives = 278/604 (46.03%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL---FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIF--ENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRM-RLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEY---PALFTRSNYSLSIIENKDNFSILSFAVI------DQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLI--FDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE--LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK--HDSISIDPFTGEISLTKDIEA--GKYDLFLQVTDNGNP 1937
            D+E    + L + A D     L ++  ++I+I+D+NDEAP F    Y  V+ E+L  GS +++V A D +SG  G ++   I   +   +FV ID  SG I   +PL   F   +  LTV A D        D T  V  I D N+++P      +K+           Y + +F  +   ++F +  +   D+D G N D++  I T     N F +DSR   +  N           +D E      + +I  +DNG P L ++  + +DV+  N+      +F    YS  I E+K    I SF +I      D D +++N    N  N F ++ +         G I + + LDRE+   Y   +    EA D    T+   V++ +LD+NDN PQ   R   E + +   + ++G L+    D D G N  +        C   T K   +  LF I     +IL VK  +DYE +    + I   D G PK     S++V++ D ND++PE++ P   ++ V++S    ++GT + RV A D D  ++++L Y + +   + S+S+D  +G + +   +     +Y L +Q TD G P
Sbjct: 1063 DHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSG--GSLLRYTITKGNEQNNFV-IDPQSGLITTLRPLDREFK-SEYKLTVSASDGGTPPVSTDVTFTV-KITDENDNQPEFK---EKQ-----------YVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSI-TKGNRDNKFIIDSRSGEIFTNV--------SLVDGES----YDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDK---RINSFVLIIGAEDPDFDQITYNIASGNHGNKFTIDRY--------GGFITVAHSLDREEKSFYSLRV----EATDGYN-TASVPVTINILDVNDNSPQPARR---EYRAHVAENSDVGTLVTTVKDPDAGVNGEVEY------CIVQTAKAE-SASLFKIESHSGRILTVK-PLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSP-LFESEVDVS---AKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVKVAGRLSTLVHQYALKVQSTDGGEP 1603          

HSP 2 Score: 122.865 bits (307), Expect = 3.186e-28
Identity = 153/613 (24.96%), Postives = 267/613 (43.56%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYF-LEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLL---KSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSS--NNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVV--VLDINDNVPQYVGRMSFEMKENNIPS-YELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI--SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL-KAKHDS-ISIDPFTGEISLTKDIEAGK-YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E I  + L + A D G+ +  +   L + I D+ND +P F    Y   + E++ VG  +  VHA D++ G  G I Y+++   DF   F  ++  SG + +   L   + +   + ++A DS+  N K   THV++ ++D+N++ P +                P  F + + E+   N  V+ I+  D D G  G+++  +            +S  + N ++    +R+RQ +D E+ S   N ++   D G P L      ++  +DV + +  P          SI EN    S +   VI   A   + ++L  +  +   ++ F +   T   G IR    LD E +  Y  ++    +A+D   +  +  + V+  ++D+ND  P +     + +   N+PS   + Q+   D D G     S+   T T         GNE   ++   +  ++   + +D EF    K+ +   D G P     ++  V I DENDN+PE+     +  V      +   G  L +V A D D  S+  L Y + K   D+   ID  +GEI     +  G+ YDL +   DNG P  ++S N+ I + Q N
Sbjct:  750 DRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVN--DFGGKF-RVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVK---------------PKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLP-----------ESTRKFNIDSKSGVIRLRQRLDFEQKST-YNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINEN----SPVGTVVISPKATDQDSWYLKYAIIDGTGVDKFIIDPDT---GAIRTAGELDHEVADHYWLTV----QAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSGG----SLLRYTIT--------KGNEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFG--LYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGESYDLTIVAEDNGLPKLSTSTNVLIDVIQGN 1307          

HSP 3 Score: 118.627 bits (296), Expect = 6.630e-27
Identity = 142/610 (23.28%), Postives = 263/610 (43.11%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKF-DWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK--DIEAGK-YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            DYE   ++V+ ++  ++      +   +V+ ++DIND  PKFV+  Y   + E++ +GS +L+V A D +SG  G + Y L+  +        ID ++G I  +  L    + +   +   +    ++    T V   ++DVN+  P  S                 +   + E+      V+ I   D+D             T+L   +   D + R         + +  S+DRE V +  + +I+  D    L  S   +++D+ D N+ P + T+S Y   I EN     ++L+    D D      L+++ F          ++  +++L +          LDRE  P Y F +     A D      ++ +S+ + D+NDN P +     F     + P  + L Q+  DD D+G N +++  SL T   G     +G           I+ +++ ++ E   N  +++   D G P   +  ++ + +L+ ND  PE+ +     NV   + I    G ++ RVRA+  +S S++ +TY +    DS   SID   G I + +  D E  K Y L ++ +D G P+  S++ + I +   N
Sbjct: 2716 DYEIRNRYVM-IVEANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSE--------------FMASVKEDALIGQSVTTITATDED-----------LNTELYYFILSGDPQARFGIERKTGVIFVHGSLDRESVGS-YDLNISASDG---LFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKNGKMTNLVE----------LDRETRPFYNFMV----SAADIGGQACYSNISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTY-SLVTDAGGTFTIETGT---------GIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPI----GNEVVRVRAVSRES-SNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSN 3266          

HSP 4 Score: 104.76 bits (260), Expect = 1.171e-22
Identity = 147/593 (24.79%), Postives = 255/593 (43.00%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFD--IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKN----LFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENK--DNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFA--TVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE----LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL-KAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTD 1925
            D E  P +   + A DIG  Q C S  + I + D+ND  P F   +Y   V ED  +  V+L+V A D + G   K+ Y L+   D   +F +I+  +G I L+KPL     +  TL VE  D          T V I ++++N+  P  S              + IY   + E+ P   EV  +  V ++   +      + T  +L+     LF +D +           + + + +D E  +     ++   D G P+L+ST  +++ V D N+    F+   YS  + EN     F +  FA  D+D+ +  +   + +   + + F    + + +G I++   +DRE+   Y+  +     AQD       A   V + V D+NDN P++    ++  + E+++P+  +  L   D+D   N      +L          +SG+   F +       KI  V  S D ++    ++ +   D G P    ++SI V I  E+   P  ++P  L   VN+   N+  G  + RV+A D D    + L Y L  ++  S+ +    G +    +I  G Y+L + VTD
Sbjct: 3025 DRETRPFYNFMVSAADIGG-QACYSN-ISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVT--DAGGTF-TIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIAT-VQIKVLNINDVPPEFS--------------HSIYHGNVSEDAPIGNEVVRVRAVSRESSND------VITYAILRGADSGLFSIDRK--------NGTIHVNRKLDYE-TTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFAT-DRDSGTNAQIKYSIAEGNDAKKFK---IVEETGVIKVSGDIDREEVASYRLKV----RAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTL----------ISGDASRFKLHSNGLITKIGDVSHS-DGQY----RLRVLVADNGHPPQSTEVSITVKIA-ESKTHPPNVHP--LTVYVNLYGSNLNGGV-IGRVKATDKD---GDLLHYSLVSSEQSSLLMISDEGTVRARANISPGTYNLNVSVTD 3552          

HSP 5 Score: 103.219 bits (256), Expect = 3.053e-22
Identity = 140/596 (23.49%), Postives = 257/596 (43.12%), Query Frame = 3
Query:  201 EFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKL-TLTVEAHDSAEHNSKFDWTHVVIFIID---VNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDV-KCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRI--SISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDY-----EFIHNCKIDIHFHDEGFP-KNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDAD-SVSSNRLTYE--LKAKHDSISIDPFTGEISLTKDIEA--GKYDLFLQVTDN 1928
            E +  + L ++  D    +     K+ I + D ND  P F+ K Y K + ED+ + + I ++ A+D + G  G I Y     ++ +TSF +I+  SG + + + L +  ++  LTV A D A   SK   +     I++   VN   P  SV       TQL N                   + + ++DKD+G NGD+ + +I +         LD    +  +   Y +++ + +DRE      N ++   D G P+   + +L+V+VLD+N+    F +S Y  ++ E    +  +L     D+DA S        +    +  F ++S T   G+I     LD E   R+  ++  ++     ++  S   V V +LD ND+ P++       ++ E+  P   +  +  +D D G N ++  S+++L    +   E  +G           I++   ++D      EFI+   + +   D G P +   +  + + + + NDN P  +      N+  +   N   G  +T V AID D S     L Y+        + S+DP TGE+   + +     ++ L ++ TD 
Sbjct:   66 ESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSF---KEKTTSF-AINPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSV------KTQLQN---------VSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGN-------LDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKT---GQIYTKGDLDYESRQRFDLTVAALDGVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPF-EIEPDTG-----------IIRTTTNLDRDTGLPEFIN---LQVRASDFGTPLRRETETLVKMRVKEMNDNAP--VLKQFKCNI--LVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSLRGLQREFTLIIKATDG 613          

HSP 6 Score: 101.679 bits (252), Expect = 1.009e-21
Identity = 136/612 (22.22%), Postives = 248/612 (40.52%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIIL----KKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNN------FNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFW--ISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPF--TGEISLTKDIEA--GKYDLFLQVTDNGNPMRNSSANLTIIIYQ 1979
            D E +  + L + A D       S  ++ IDI D ND  P      Y + ++E+  +GS +L V A D + G   ++ Y +   + F T  V  +G    ++      +P ++       V A D         ++++ I + DVN++RP  S  S              YF  ++E+ P    +  +   D D G N          + L      D+       T    + + + ++RE   N    ++   D G P L S   +Q+ VL+ N+ P  F+ S Y  ++ E+         A I  + +        SSN+             L S+ + +G I +   LD E +  Y  ++   +      + TS+  +SV   D NDN P++   R S ++ EN+     + Q+   D+D G N++I  S              GN+   +  + E  +++V   +D E + + ++ +   D+G P       + + + D NDN PE+    S  N+  +   +      +  +R  D D++  N   Y+        S       G I+   D+    G+Y L + V DNG+P +++  ++T+ I +
Sbjct: 2925 DRESVGSYDLNISASD---GLFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVF-GQGFGTFAVDKNGKMTNLVELDRETRPFYN-----FMVSAADIGGQAC---YSNISIHLDDVNDNRPLFSQSS--------------YFTAVYEDAPLKKVLLQVKADDADVGVN----------RKLTYSLVTDAGGTFTIETGTGIISLEKPLNRELKEN-YTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSED---------APIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVT--DSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIA-----------EGNDAKKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEF----SSTNLTTVLSESSLPNAAVIHLRPHDRDALG-NGAPYQFTLISGDASRFKLHSNGLITKIGDVSHSDGQYRLRVLVADNGHPPQSTEVSITVKIAE 3472          

HSP 7 Score: 94.3597 bits (233), Expect = 1.817e-19
Identity = 149/599 (24.87%), Postives = 262/599 (43.74%), Query Frame = 3
Query:  222 LQLIACDIGQPQLCSSQKLVIDIIDINDE---APKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK--LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVK-CQIQTTKL-LKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSI-IENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINI----QSGTKLTRVRAIDADSVSSNRLTYEL--KAKHDSISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANLTI 1967
            L ++A D G P+L +S  ++ID+I  N     AP F  K Y+  +QED  + S +L + A   E  DF +I Y  I + +    F +ID   G I +   L   +K   +L VEA D     S      V I I+DVN++ P  +    +R           Y   + EN+     V+   V D D G NG+V+ C +QT K    +LF ++S        +  ++   + +D E +   +  +I   D G P  ++   + V V D N++   F    +   + +  K   +IL     D+D  + ++   +  +    +S    S+ Q+SG +++     R  +  +Q+++ V +         +   V V V  I  N      +    + EN+ P   +  ++++    G      I    + C+          D     +  ++  K+S D E + +CK++I  +       H+   +IV I D+NDN+P + +     +V   S          G++L  V A D D +S ++LTYE+   +  D  SI P TG I+  K ++     +Y   ++VTD+GNP  ++ A++ I
Sbjct: 1281 LTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGA---EDPDFDQITYN-IASGNHGNKF-TIDRYGGFITVAHSLDREEKSFYSLRVEATDGYNTAS----VPVTINILDVNDNSPQPA----RRE----------YRAHVAENSDVGTLVT--TVKDPDAGVNGEVEYCIVQTAKAESASLFKIES--------HSGRILTVKPLDYETMQEHV-LTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSL---SVDQNSGVVKVAG---RLSTLVHQYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNFAFEKPKYEVSLPENSPPDQAIATVVYN----GILPVYEIVPGRSPCW---------RDFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTD--GQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAV-ATDQD-ISGDKLTYEIVETSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKI 1822          

HSP 8 Score: 94.3597 bits (233), Expect = 1.977e-19
Identity = 140/616 (22.73%), Postives = 257/616 (41.72%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNP-LNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNF---NMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED----LFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAK----HDSISIDPFTGEISLTKDIEAGK---YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            DYE      + ++A D G+P L    ++ + ++D ND AP+F    Y   +    + G  + ++ A D + GD  K+ Y +   +        ID  SG I L + +  I +     L VE  DS   ++    + V + I D N+H P  S                +Y +   EN PE   V+ ++  D D G    +   I +   ++  F +D+   +        L  R   DRE  S   ++  I   D G        +++V ++D+N+   +F   NY  +I  +      +L  +  D DA S      N++  +     ++  + ++  ++G I++     RE   +  ++ FV+ +   N    S A+V + VL+ +  +  + G+  +++      + E+GQ++      G N  +   +     Y     + GN D     F +     ++V   +DYE I N  + I   +        +  ++V +LD ND  P+++    L ++      NI  G+K+ RV A D DS S+  +TY L +K     +   ID  TG I+    ++  K   ++  ++ TDNG     S   +  I+   N
Sbjct: 2301 DYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQ--GRQHFQIDSQSGVITLSR-VVGIKQGKVYGLDVEVSDSVHVST----SKVRVIIGDTNDHSPIFS--------------EDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRK-FRIDADSGM--------LYSRLMFDRENSSQAIMSVPIRATDGGGRF--GFCVVEVHLIDENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASS------NAALTYVIVGHQTPPVFTINAATGVIQV----SREPEVK-SYNFFVLVKDGGNPLLRSIASVKITVLERDARILHF-GKSKYDVTVGE--NAEMGQIV-----TGLNLVVPGGNPVDVDY---RIIKGNNDNNDRKFGVDSTGRVRVIGRLDYE-IRNRYVMIVEANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPE----NIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVN 2857          

HSP 9 Score: 72.4034 bits (176), Expect = 8.517e-13
Identity = 128/579 (22.11%), Postives = 235/579 (40.59%), Query Frame = 3
Query:  279 VIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDRE-KVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY---VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            V+ I  ++ E P F   +++KV+ ED  +GS +  V A    S +   I+Y  I   D    F SID  +G + L   L D +   K  L V A D+    S      V + + DVN+  P  +                +Y   I E+ P +  V  +  +D D G N ++   IQ    +   F +D +  +        + + +S+D E +V + +   I   D G+P L     ++V ++D N+    F +S Y+ SI+ +      ++     D D     +   + +     + F + S    SG I +   +  ++   Y   + V +         S + V V++ D ND+ P +   V ++SF   EN      +  +   D D G  + ++ S          + +         ++  +L  +   D E      + +               + V+++DENDN+P +     L N       ++  GT +    A D D+ S+  LTY +         +I+  TG I ++++ E   Y+ F+ V D GNP+  S A++ I + +++
Sbjct: 2122 VVKIKVVDKETPVFDQLSFSKVLAEDTPIGSEVTSVTA---RSPNGAGILYS-ITGGDPVNQF-SIDFKTGVVTLVSSL-DYETRTKYKLVVRATDA--RTSSHSDVAVDVTVTDVNDVAPAFN--------------RSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGV--------VFVAKSLDYESRVVHEM--IIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDS---QSGVITLSRVVGIKQGKVYGLDVEVSDSVH-----VSTSKVRVIIGDTNDHSPIFSEDVYKVSF--NENYPEGTFVTMVSATDLDSGNYAHLTYS---------IDSVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGGGRFGFCVVEVHLIDENDNQPIF----ELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPVFTINAATGVIQVSREPEVKSYNFFVLVKDGGNPLLRSIASVKITVLERD 2645          

HSP 10 Score: 69.707 bits (169), Expect = 6.693e-12
Identity = 140/613 (22.84%), Postives = 256/613 (41.76%), Query Frame = 3
Query:  264 SSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDF-STSFVSIDGNSGTIILKKPLFDIDKL---TLTVEAHDSA--EHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI---QTTKLL---KNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD----------NFSILSFAVIDQDALSFNEFHLNSSNN--FNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKD-----IGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKD--IEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQS 1997
            +S  + I+I+D+ND +P+   + Y   V E+  VG+++  V   D ++G  G++ Y +++     S S   I+ +SG I+  KPL D + +    LT++A D    +  + F     V     VN+H+P            + L+  P++  E+  +      +  +   DKD+G N  +K  I    T K L   +N   +    RL+   +QY L+++ +                 D G+P LK+ + ++V V    +  A F +  Y +S+ EN            N  +  + ++   +  + +F +   +    + +SF    +T    EIR  N  D + S     S  V+                V + D NDN P +   R++  + E +      G  + D K      +  +  IS   LT   Y   E  +   D+F I      +   + +DYE        I   D G P+      + +++ D ND  P +   +    V   S+    +GT++T V A D DS ++  LT+ L A+ D+   +++P TG ++++    +    Y + L V+D      N +A+  + I  +N+  S
Sbjct: 1397 ASVPVTINILDVNDNSPQPARREYRAHVAENSDVGTLVTTVK--DPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPL-DYETMQEHVLTIKASDRGIPKRETLFSVVVSVDD---VNDHKP------------EFLS--PLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVKVAGRLSTLVHQYALKVQST-----------------DGGEPPLKTQVDVKVKVRGIVKNFA-FEKPKYEVSLPENSPPDQAIATVVYNGILPVYEIVPGRSPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEIR-ANSTDGQHS-----STLVI----------------VTIQDKNDNQPIFEHARITGHVTEGS----PQGTAVLDHKGSQLVAVATDQDISGDKLT---YEIVE--TSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSY----AGTRVTMVTATDGDSAAN--LTFSL-ARQDTELFAVNPLTGVVTVSNAALLRRDTYTIKLTVSDG-----NHTAHARVRIRCENLPSS 1928          

HSP 11 Score: 62.3882 bits (150), Expect = 9.050e-10
Identity = 132/567 (23.28%), Postives = 228/567 (40.21%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRP-------------NISVGSDKRTST-QLLNGYPIYFLEIFENNPEN-FEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENS--RISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP---EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL 1820
            D E I  + + + A D   P   +   + + +ID ND  P F+   Y  V+Q  +A G++I +  A D + G    + Y LI  +     + SI   +G +++++ L D+      TL VEA D          T  V+ I  V+   P             +  +GS+  + T +  NG  I +  I   +P N F + F         K G V        L+ +L Y ++R +       YKL +R +  R                      S + + V V D N+    F RS Y  +I E+   + ++++   ID D+    E +    N   + +F    + + SG + +   LD E    ++  I   +E + +   T    V VV++D NDN P++   M +  +  +  P   + +++  D D G+    R SI+      +   +  SG      I+  +++ +KQ   Y         +H        + +K+ +I+   D ND+ P   E +Y  S +        N   GT +T V A D DS +   LTY +
Sbjct: 1994 DRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGD---PGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDG------LFRTEAVVKIKVVDKETPVFDQLSFSKVLAEDTPIGSEVTSVTARSPNGAGILY-SITGGDPVNQFSIDF---------KTGVV-------TLVSSLDY-ETRTK-------YKLVVRATDARTSS------------------HSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFF--KIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKPS--LTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSG-----VITLSRVVGIKQGKVYGLDVEVSDSVHV-------STSKVRVIIG--DTNDHSPIFSEDVYKVSFNE-------NYPEGTFVTMVSATDLDSGNYAHLTYSI 2483          

HSP 12 Score: 60.077 bits (144), Expect = 5.066e-9
Identity = 84/338 (24.85%), Postives = 150/338 (44.38%), Query Frame = 3
Query:  954 QPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILS-FAVIDQDALSFNEFHLNSSNNFNMES-FHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFE--MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKIS---IIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNP 1937
            QPL+ +T  L       N +  +F   + ++ I E+    +++S F   D+D   +N   L S    +++S F+++  T   GE+ +  PLDRE    Y  +I  V+  +   + +++  ++V + D+ND  P +  +  +E  + EN      +  +   DKD G N  I+        Y       G   +  IS   ++ V   +DYE     KI+I   D     ++ K+    +IV +LD NDN P  + P   +  V     ++     +T + A D DS     + + L       +ID  +G I L + +   +   Y+L ++VTD G+P
Sbjct:  669 QPLIFATAKLH------NRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDK-GYNGLVLYSIVEGDVDSVFNINMFT---GELTVAMPLDRETISSYTLNISAVDCGKH--RKSAYTILNVKITDVNDCSPVF-DKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFIT--------YQIVNDFGGKFRVNRIS--GVVSVGDYLDYEEQEMYKIEIQAMDSSV--DNQKVGSTHVIVTLLDINDNSP-IVKPKKFNVTV---QEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSP 977          

HSP 13 Score: 51.9878 bits (123), Expect = 1.601e-6
Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQP---QLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKL 437
            DYE   +F L + A D G P   +  S+  +V++I+D ND  P+F A  Y K + EDL  G+ +  V A D +SG  GK+ Y L
Sbjct:  383 DYESRQRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSL 465          

HSP 14 Score: 49.6766 bits (117), Expect = 7.496e-6
Identity = 97/386 (25.13%), Postives = 160/386 (41.45%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT--LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP 1346
            DYE   K+ L + A D  +    S   + + + D+ND AP F    Y   + E   V + ++ V AID +SG   K I   I+N     +F  ID  SG + + K L    ++   + + A D  +  S    T V + ++D N++ P      DK           +Y   I  +      V+ I   D DEG    ++  I T    +  F +DS+  +   T    + I+Q     KV       +   D+   +  ST  ++V + D N++  +F+   Y +S  EN    + ++  V   D  S N  HL  S + ++++     +   SG +      DRE S +   S+ +   A D      F  V V ++D NDN P
Sbjct: 2196 DYETRTKYKLVVRATD-ARTSSHSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSG-INKEINYFIQNVSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKP-SLTGETRVRVVLMDANDNAPRF----DKS----------MYAASILGSASPGQFVTRILATDPDEGDAKKLRYSI-TGGQGRQHFQIDSQSGV--ITLSRVVGIKQG----KV---YGLDVEVSDS---VHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTM-VSATDLDSGNYAHLTYSID-SVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPI--RATDGGGRFGFCVVEVHLIDENDNQP 2547          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 125.561 bits (314), Expect = 4.092e-29
Identity = 169/649 (26.04%), Postives = 279/649 (42.99%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDI-DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISV------GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPL-NFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKF--TSFATVSVVVLDINDNVPQYVGRMSFE--MKENNIPSYELGQLIFDDKDIGENSRIS--ISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP-----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHD--SISIDPFTGEI----SLTKDIEAGKYDLFLQVTDNGN-----------PMRNSSANLTIIIYQQNMFQSINSITRAVL 2024
            D E    + L + A D G P L     + I I+D ND AP F   +Y   + E+   G  IL+V A DR+SG  G I Y +  +   S S   +D ++G I  K+ L F++ +  T  V A D     SK D   V I ++D N++ P + +        DK   +              EN+  N  +++I V DKD   N   + +I T    +  F ++           Y +++++ +DRE V  P  N ++N  D G P   +   + +DV D N+    FT + Y+ +I E   N S +L     D D         + +   ++  F +      SG +    PLDRE+      +I     AQD+     T   TV+V ++D NDN P+++ + S++  + E       + Q+   D D G+N RI+  ISS      G          LF + ++  +L  K  +D E        +   D G P+  + + + + I D NDN P + YP     S ++N         +   KL +V A DAD  ++  ++Y++   ++  + SID  TG I    SL  ++E   + L +   D GN            + N + NL + +Y+   F    ++ +  L
Sbjct:  165 DRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVP-SKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS--------------ENSLINTNIAYILVTDKDSNTNSQTELKI-TNGDDEGCFKVEFLGF-------YFIQLQKPLDRELV--PFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDF---QSGLVTTAKPLDREQVSSVTITI----TAQDHGSAPKTGSTTVTVTIIDGNDNKPRFM-KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNG----------LFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEYFASIMEN---------EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEE-FFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTL 759          

HSP 2 Score: 121.709 bits (304), Expect = 6.342e-28
Identity = 139/543 (25.60%), Postives = 229/543 (42.17%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFST----SFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKN-LFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPAL------------FTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP-----QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS---ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKA 1826
            + + DIND  P+F    YT  ++E + V +      A D ++G+ G + Y +   ++ +T    +     G++  +I KKPL     D   L + A D     +   +  + I I+D N+H P  +  S              Y   I EN      +  ++  D+D G NGD+K  I    +  N +F LDS   +        +R +Q++D E V N   F++   D G P       + ++VLD N+  P L              RS  SL       N +I    V D+D+ + ++  L  +N  +   F +  L      I++  PLDRE  P Y  ++ V ++   +     F  + V   D+NDN P      Y   +S E+ +N   SY L QL   D D G+N  +S S            ++G  DL W     +  ++   + +D E + +  I I   D G        ++ V I+D NDN+P ++  S    +   + I    G  + +V A D DS  + R+TYE+ +
Sbjct:   83 VQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTP-ALMGYCLINITILDENDHAPVFTQNS--------------YLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGV--------IRTKQNLDFE-VKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLI------NTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFL--GFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVT--DVNDNSPAFTSNAYTANIS-ELAQNG--SYVL-QLNATDPDEGDNGTVSYS------------ITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASI----GATVLQVSATDVDSGDNGRITYEISS 571          

HSP 3 Score: 119.013 bits (297), Expect = 4.552e-27
Identity = 145/629 (23.05%), Postives = 264/629 (41.97%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK--LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPI-YFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN--------------KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTG-----EISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSI 2000
            D E +    + + A D G      S  + + IID ND  P+F+  +Y   + E  ++G+ +L+V A D +SGD G+I Y++  ++        ++  +G +  K  L    K   + TV A D  +         V + I D+N++ P                 YP+ YF  I EN P   ++  +   D DEG N  +   I       N F +DS   +        +    S+D E V    +  I+ +D G      T ++ V VL++ +   +F    Y+ ++ EN              KD    +S+A++  D    N F ++S                + G I+I   +DRE+  + Q+ + V+         ++ ATV++ VLD NDN PQ+         +    ++ +GQ++++    D D G+N  +             +  S  E L WI S   ++++ + +         + +   D G P  H+ ++I + +    ++ P++   S + +V+    ++ Q       V A+D DS  + +L Y +   ++      F G       SL + ++ G YDL ++ TD G P  ++S  +TI I   N  +S+
Sbjct:  489 DREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQ-LMSSVKVELTISDINDNAPVF---------------YPVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNNNGN-FSIDSSTGV--------ISTLASLDHE-VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPT--NLFLVDS----------------TGGIIKINGDMDREE--KAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDG---TWLVGQVVYNAAAVDLDAGKNGLVRY-----------QLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL--SINHPPKFTLSSYVTHVLASQPLSYQ----FFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALK-GSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSL 1049          

HSP 4 Score: 100.138 bits (248), Expect = 2.866e-21
Identity = 145/617 (23.50%), Postives = 267/617 (43.27%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLV-IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVE--AHDSAEHNSKFDWT-HVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAV---IDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQ----DNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYE-----LKAKHDSISIDPFTGEISLTK--DIEAGK-YDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            D E   +++L +IA  +G  +  S+Q  V I+++D ND AP+F   +    +     VG V+    A+D ++G  G + Y+L  N +     + I+  SG I L + L D D+   TV+  A DS         T H+ + I    NH P  ++ S              Y   +  + P +++  ++  VD+D GKNG +   I      + LF +             KL IR+S+  + +    +  +   D G P   +++ + + + D N++ +LF  + +  ++ EN    +++   V   +D        + L SS +      H  ++   SG+I     LDRE+  +   S   + +A+    D T     A V V V D+NDN P +   + +  + E ++P   + ++   D D G+N++   S ++ T         G +  F  S    L + +++D E   +  + +   D      ++   I + + D ND  P  ++P S D  VNI+  +   G+ +  + A D D   +  + Y      L A  D   ++  TG + + K  D E  + Y+L +   D+G    +S+ N+T+ +   N
Sbjct:  803 DREEKAQYLLAVIA-RVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAE---GLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI----NHPPKFTLSS--------------YVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNE-EGLFGIFPGG---------KLYIRKSL-LQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES------HF-AVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGT---------GMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPES-DYTVNITE-DALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFD---VESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVN 1363          

HSP 5 Score: 95.9005 bits (237), Expect = 5.567e-20
Identity = 145/594 (24.41%), Postives = 249/594 (41.92%), Query Frame = 3
Query:  276 LVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT-----LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSP--RYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI--SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDEN--DNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELK--AKHDSISIDPFTGEISLTKDIE----AGKYDLFLQVTDNGNP-MRNSSANLTIIIYQQN 1985
            +++ + D+ND AP F    Y   V E    GS + ++ A+D + GD  K  Y L+        F  I+ ++G + L K L   D+ T     L V+A D++  N  +    + I + D N+ RP +   SD             Y + I E+      V  +N  DKD G+NG +K  I    L   +F ++S           +L + +S+D E  +     +I  QD+G   L ST+ + V+VLD N+   LF     +L++ EN +  F +      D+D      ++F+ +    S  F++ S        ++ EI     +D E  P  R  F + V+   Q + K ++  +++V V D NDN P +V   +         S  +  +  +D D   N +++ S            +SGN   F +  S  ++  + Q  D   I+  ++ I   D G P    +   +V++  E      P +   SS D   +++  N  +GT +  V A    S  +  + Y L   +      +   TG +  T+ I+       ++L +   D   P  R SSA +TI +   N
Sbjct: 1145 VIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFF--INSSTGELHLSKTL---DRETTSSYNLVVKATDASNAN-LYSTAKIEITVGDSNDQRP-VFPESD-------------YTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAA-MFDVESATG--------RLIVAKSLDFE-TTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNS--------ATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGS----SLNVMTITAEDPDRNSNGKVTYS-----------IISGNNGYFNLHPSTGQLQMIHQIPDNPTIY--QLTIQASDGGQPSRQTQ--TVVSVFKEGPIGGGPTF---SSADYQGSVTE-NKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 64.3142 bits (155), Expect = 2.147e-10
Identity = 68/279 (24.37%), Postives = 120/279 (43.01%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDIDK---LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVS---NPLNFSINCQDNGQPLLKSTIILQVDVLDQNE 1010
            D E    + L + A D     L S+ K+ I + D ND+ P F   +YT  + ED  +GS+++ ++A D++ G  G I Y  I N + +  F  ++  +G +I+ K L F+  +   LT+T + H     +S     +V + ++DVN++ P             L    P+  L + EN    F V      D+D G N  +   + +    K           + N+   ++    +ID E +    +     +   D G P L +   + V V D+N+
Sbjct: 1223 DRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYS-ISNGNLAAMF-DVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTV---NVTVNVLDVNDNAP-------------LFPTQPVT-LTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKT---------FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDEND 1473          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 182.57 bits (462), Expect = 1.346e-46
Identity = 174/609 (28.57%), Postives = 278/609 (45.65%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISV-GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSII-ENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSS-----LDNVVNI-SHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L + A D G PQ  S   L + + D ND +PKF   +Y   V E+  VG  +L+V A D + G  G+I Y L +  D     + ID  +G I +K PL   +I+ L+  V A D      K   T V I + D N++ P + + G    T ++ +         I E+ P    V+ + V DKDEG+N  V C +      +     DS    + N  +Y L+    +D E+V       I   D+G P L ST  L+V V D N+   +F+ + + +    EN+   +IL     D D+ +  E   N   +  ++   L  +  ++GE++   PLDRE   RY+F +   ++     K T  ATV + VLD NDN P+++    SF + EN  P   +G +   D D GEN+ + +S           +  G + +       IL    S D E   +    +   D G P   + + + +N+LDENDN+P    PS+     L  V +  SH+++        V A D DS  +  L + +     +    I P +GEI+L K++     G + L ++V+D G P R+++A + I +
Sbjct:  280 DRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQ-PKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGI-------ANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS---TSDNKRKYFLQTTTPLDYERVKE-YRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKG--LFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGT--ATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSV----------EPDGGKFVVQNGTGTILS-SISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDV--------VEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 2 Score: 99.3673 bits (246), Expect = 9.359e-21
Identity = 133/607 (21.91%), Postives = 243/607 (40.03%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFV--SIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTR---------------------SNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I++ DIND  P+F     T  V E+  +G++     A DR+S   G   Y L    D +T F     D   G +     L ++D+       LT++A D   +  ++    + + + D N++ P                 +P Y  E+ EN+P    V  +   D D G NG+++  + Q    +  L  +D    +        + ++  +DRE++ N L+F +  +D G     S   + ++V DQN+  PA+  R                     +  +L  + +KD         +    + F     + S + N   + L + T          PLD E+   Y+  I  V+    N   +S  ++ V V D+NDN P +   +   +  E N P   +  +   D D G N+ +   ++    Y     + G   LF I      ++ +  +D E     +  +   D+G P +    ++++ +LD NDN+P+++      S L+N+  +S + +        V  +D D   +  +   ++       +   TG I  S++ D E    Y   L+  D G P R+S   +TI +  +N
Sbjct:  197 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGG-NPQRYSQALLRVVVTDANDNSPKFE--------------HPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGI--------IYVKGPLDREEI-NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTT----------PLDYERVKEYRVEIVAVDSG--NPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAEL-FYNIVGDSY-----IKG---LFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGM--------VTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDEN 750          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 181.03 bits (458), Expect = 2.797e-46
Identity = 174/609 (28.57%), Postives = 278/609 (45.65%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISV-GSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSII-ENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSS-----LDNVVNI-SHINIQSGTKLTRVRAIDADSVSSNRLTYELKA--KHDSISIDPFTGEISLTKDI---EAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            D E    + L + A D G PQ  S   L + + D ND +PKF   +Y   V E+  VG  +L+V A D + G  G+I Y L +  D     + ID  +G I +K PL   +I+ L+  V A D      K   T V I + D N++ P + + G    T ++ +         I E+ P    V+ + V DKDEG+N  V C +      +     DS    + N  +Y L+    +D E+V       I   D+G P L ST  L+V V D N+   +F+ + + +    EN+   +IL     D D+ +  E   N   +  ++   L  +  ++GE++   PLDRE   RY+F +   ++     K T  ATV + VLD NDN P+++    SF + EN  P   +G +   D D GEN+ + +S           +  G + +       IL    S D E   +    +   D G P   + + + +N+LDENDN+P    PS+     L  V +  SH+++        V A D DS  +  L + +     +    I P +GEI+L K++     G + L ++V+D G P R+++A + I +
Sbjct:  203 DRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQ-PKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGI-------ANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS---TSDNKRKYFLQTTTPLDYERVKE-YRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKG--LFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGT--ATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSV----------EPDGGKFVVQNGTGTILS-SISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDV--------VEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 2 Score: 98.5969 bits (244), Expect = 1.776e-20
Identity = 132/597 (22.11%), Postives = 246/597 (41.21%), Query Frame = 3
Query:  282 IDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFV--SIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQI-QTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YPALFTRS----NYSLSIIENKDNFSI-LSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGE------IRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYP----SSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN 1985
            I++ DIND  P+F     T  V E+  +G++     A DR+S   G   Y L    D +T F     D   G +     L ++D+       LT++A D   +  ++    + + + D N++ P                 +P Y  E+ EN+P    V  +   D D G NG+++  + Q    +  L  +D    +        + ++  +DRE++ N L+F +  +D G     S   + ++V DQN+  PA+  R      +S  I    ++  +  + A++        E  + +        F L   + S+ +      ++   PLD E+   Y+  I  V+    N   +S  ++ V V D+NDN P +   +   +  E N P   +  +   D D G N+ +   ++    Y     + G   LF I      ++ +  +D E     +  +   D+G P +    ++++ +LD NDN+P+++      S L+N+  +S + +        V  +D D   +  +   ++       +   TG I  S++ D E    Y   L+  D G P R+S   +TI +  +N
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGG-NPQRYSQALLRVVVTDANDNSPKFE--------------HPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGI--------IYVKGPLDREEI-NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSG--NPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAEL-FYNIVGDSY-----IKG---LFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGM--------VTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDEN 673          
BLAST of Protocadherin vs. Ensembl Medaka
Match: fat2 (FAT atypical cadherin 2 [Source:NCBI gene;Acc:101170600])

HSP 1 Score: 162.155 bits (409), Expect = 7.525e-40
Identity = 152/602 (25.25%), Postives = 274/602 (45.51%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSK-FDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPL-NFSINCQDNGQPL-LKSTIILQVDVLDQNE--YPALFTRSNYSLSIIENKD-NFSILSFAVIDQDAL--SFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSY-ELGQLIFDDKDIGENSRISISSLTT-TCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHI--NIQSGTK-LTRVRAIDADSVSSNRLTYELKAKHDS-ISIDPFTGEISLTKDIEAGKYDLF-LQVTDNGNPMRNSSANLTI 1967
            ++L + A D+G PQ    + + ++I+D+ND  P F    Y   V E+ AVGSV+    A D ++   GK+ Y L+     ST    +D  +G +I+   L D + +    L ++A D A+H  + F    ++I + D+N++ P                  P Y +++ E+ P    + ++  +D D G+ G V   +++T+    +F        N       L + + +D E+   P+ N ++   D+G P  L S+  +++ VLD NE  Y   F+   Y  ++IE+     S+++    D+D        +H++  +        + ++ + SG IR    LDRE  P Y  S+F  +   +     S+  V + VLD+NDN PQ    + F   + N+     + QL   D D+    ++S   L +   Y   +  +G           ++    ++D E      I++   D   P   +  ++++ +LD NDN P++      D + ++  +    QSG + + RV A D D  S+  +TY+L+   D    IDP TG ++   D   G Y +  ++ TD G+P R+S+  L I
Sbjct:  777 YILNITAYDLGMPQRSVWKLMAVNILDVNDNPPMFDQPRYVIRVPENTAVGSVVFTAQAADMDTDMSGKVQYLLLT----STDLFRVDELTGEVIVTGQL-DREAVASHNLWIQARDQAKHGPQLFSTISLLIILQDINDNPPRFVP--------------PGYRIKVAEDVPVGTILLWVESIDLDLGRAGLVSYNLKSTE--SGIF--------NIEPSTGALTLERELDFER--RPMYNLTVRAVDHGLPRSLSSSCFVEIQVLDVNENLYRPTFSEFVYEAAVIEDAAVGSSVVTLTASDKDLGRDGVVRYHIHDGSGLG-----VFTIDEESGVIRTSELLDRETVPHYWLSVFATDLGTE--PLVSWTHVFLEVLDVNDNAPQLSQPIYFASVQENVEKVNSVIQLSATDVDVSSEGKLSFQMLESHRVYFDIDPKTG-----------VISTLAALDREEKPEHSIEVVVSDNAAPALRSTATVVIKVLDSNDNRPKFT-----DKLFHVQLLERRWQSGKRDVCRVVASDEDEGSNAVVTYKLQDNSDERFQIDPLTGVVTSHGDFWPGNYSILTIKATDGGSPPRSSTTRLDI 1324          

HSP 2 Score: 104.375 bits (259), Expect = 3.824e-22
Identity = 135/612 (22.06%), Postives = 272/612 (44.44%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVE--AHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVV--DKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFS---INCQDNGQPLLKSTIILQVD---VLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVID--QDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRM-SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKH-DSI-SIDPFTGEISLTKDIEAGKYDLF---LQVTDNGNPMRNSSANLTIII 1973
            D E +P + L + A D+G   L S   + ++++D+ND AP+     Y   VQE++   + ++++ A D +    GK+ ++++++      +  ID  +G I     L   +K   ++E    D+A    +   T VVI ++D N++RP     +DK           ++ +++ E   ++ +     VV  D+DEG N  V  ++Q           D R +++  T          +       P N+S   I   D G P   ST  L ++   V   +  P  F   +++ +++E +   +++   +++  +  L F+    +   +F+++        ++SG I I   LD  +   Y  ++ V +  +  T         + VLDIN++ P ++  +    + E+  P  ++ Q+   D D       SI S       P +       LF +  +  +L + + +D+E      + +   D+  P   N   +++++ D ND+ P ++ P    ++ N       +G+++ RV+A+D D+ S+  ++Y L + + D+I SID  +G I ++K +     D F   ++ TD G P R+    L + I
Sbjct: 1087 DRETVPHYWLSVFATDLGTEPLVSWTHVFLEVLDVNDNAPQLSQPIYFASVQENVEKVNSVIQLSATDVDVSSEGKLSFQMLESHRV---YFDIDPKTGVISTLAALDREEKPEHSIEVVVSDNAAPALRSTAT-VVIKVLDSNDNRPKF---TDK-----------LFHVQLLERRWQSGKRDVCRVVASDEDEGSNAVVTYKLQDNS--------DERFQIDPLT--------GVVTSHGDFWPGNYSILTIKATDGGSPPRSSTTRLDIEWVAVPPPSADPITFEEPHFTFAVMETEPVTNMVGVIMMETQRQRLWFDITGGDEDKDFDIQ--------KNSGTITIARKLDAARHAIYNLTVQVTDGHRSAT-----TQAYIRVLDINEHRPVFLKPLYEVSIPEDTSPWKDILQISAQDLDSNSKLVFSIHSAV-----PPDSTG----LFHLDPKSGVLVMTEPLDFERTAVHTLVVMVRDQEIPMKRNFAKVVIHVEDCNDHSPAFLSPRYEASISN----QAPTGSEVIRVKALDKDTGSNADISYSLHSGNTDNIFSIDAESGSIRVSKPLGLQHQDHFHLSVKATDQGFPQRSDLCTLHLHI 1638          

HSP 3 Score: 103.219 bits (256), Expect = 9.554e-22
Identity = 98/364 (26.92%), Postives = 175/364 (48.08%), Query Frame = 3
Query:  210 PKFVLQLIACDIGQP-QLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIK-NEDFSTSFVSIDGNSGTIILKKPL-FDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFN---EFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQ 1277
            P FVL++ A D G P QL S+  + +D++ ++D  P F++ +YT  + E LAVGS +L V A+  + G    I+Y++I  NED    F+ +D ++G + L  PL F++ +   L+VE   S   +   D T ++I + DVN++ P +   SD+              ++I E+      V  +   D+D   N  ++  I +   L+  F +D R          ++ +R ++DRE+  +  + ++   D G P L S  ++ + V D N+ P +F++ N+ L + E +    +IL   V+D+D         FH+ S N      FH+       G + +  PL ++    +Q  I V +   
Sbjct: 3174 PTFVLKVKATDRGLPRQLYSTATVTVDVVSLDDYQPVFLSSDYTAQLPESLAVGSEVLSVSALTADGGGPDAIVYRIISGNED--GRFL-LDAHTGLLTLMAPLDFEVSREYFLSVEG--SRGKSPLKDITTIIINVTDVNDNAP-VFRQSDRS-------------VDISEDLTPGSLVMKVTATDQDGPINNLLRYSIVSGDPLQQ-FSIDHR--------SGEITVRTALDREQTPH-YSLTVQAADEGSPPLSSAALITITVSDVNDNPPVFSQVNHHLLLQEGEAVGSTILQLVVMDRDMPKNGPPFSFHIVSGN--EDRRFHV----DQGGLLSLSAPLRKKVKAHHQLKIQVTDSGH 3502          

HSP 4 Score: 101.293 bits (251), Expect = 3.646e-21
Identity = 151/609 (24.79%), Postives = 267/609 (43.84%), Query Frame = 3
Query:  276 LVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FDI-DKL-TLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNIS-VGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNG-QPLLKS--TII--LQVDVLDQNEYPALFTRSNYSLS---------------------IIENKD-NFSILSFAVIDQDALSFNE---FHLNSSNN---FNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFD----DKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKI-LQVKQSMDYEFI--HNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSI-SIDPFTGEISLTKDIEAGK---YDLFLQVTDNGNPMRNSSA 1955
            LV++I D ND +P F   +Y   + E+  VGS ++KV A D + G  G + Y +  ++       +ID  +G I+  + L F++ ++L  L V A DS    S+     V I + ++N++ P    VG +      L  G  +  L  F+++ E  ++ +I      E  N   + Q+   +      +L   +   + ++ +++ +     R + S      +  +D G +P L    T I   Q D L ++  P L  +   S S                     ++EN   N +IL F   D D+  FN    F L+S N    F +++F        SGE+R+   LDRE    Y  +I   +      + + +  ++V +LD+NDN P +   R    + EN      +G ++F     D D   + ++    LT+T            DLF + EL   + V   +D E +  HN  I      +  P+  + IS+++ + D NDN P ++ P     V      ++  GT L  V +ID D   +  ++Y LK+    I +I+P TG ++L ++++  +   Y+L ++  D+G P   SS+
Sbjct:  442 LVVEITDENDNSPLFTQTSYQATLDENTPVGSSVVKVTAWDSDKGKNGFVTYSIAHSDPLP---FTIDPFTGVILTSEHLDFELANRLYHLRVWASDSGSPFSQVSECPVTITLNNINDNFPVFERVGCNITVPLDLPVGREVAKLSAFDSD-ELEQLQYII-----ESGN---ELQVFGMETFSGALFLKKPIPPQEGSFTFRVVVSDGKHRSEAS---VVRVTVRDKGDKPTLHCLETGIQKQQTDKLIESMKPVLVNKKEESFSDQHITNRHTPKFVKSVPSSIDVVENHPLNSTILQFKAADGDS-GFNGQVVFALSSGNEDGCFCIDTF--------SGELRLVCSLDRESKEFYILNITAYDLGM--PQRSVWKLMAVNILDVNDNPPMFDQPRYVIRVPENT----AVGSVVFTAQAADMDTDMSGKVQYLLLTST------------DLFRVDELTGEVIVTGQLDREAVASHNLWIQARDQAKHGPQLFSTISLLIILQDINDNPPRFVPPGYRIKVAE----DVPVGTILLWVESIDLDLGRAGLVSYNLKSTESGIFNIEPSTGALTLERELDFERRPMYNLTVRAVDHGLPRSLSSS 1004          

HSP 5 Score: 89.7373 bits (221), Expect = 1.325e-17
Identity = 136/590 (23.05%), Postives = 251/590 (42.54%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLT--LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVG-RMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPT---EKLSGNEDL-FWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNV-VNISHINIQSGTK-LTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKDIEAGKYDLFLQVTDN 1928
            D E   +F L   A D G     +  +L++   D+ND  P F A +Y   V ++  V + +  ++A D ++G   ++ Y LI  +     + S+D  SG + L++PL      T  L V+A D       +    V + ++ +++++P + + SD             Y  ++ E+     EV  ++ +  D G    +  +I +       F LD+   L        L +   +D E VS     S+       PL   T I+ ++V D N+   +F +S+ S+ I E+    S ++     DQD    N    +  +   ++ F   S+   SGEI +   LDRE++P Y  ++   +E   +   +S A +++ V D+NDN P +        ++E       + QL+  D+D+ +N             GP      +SGNED  F + +  +L +   +  +   + ++ I   D G P   +   + +N+ +++       YP ++  + V I+    Q   + +  V A D D    + L Y+L    +    SID   G++     +E G Y L + V+D 
Sbjct: 3067 DRESDGEFNLVAKATDGGGRSCQADIQLMVQ--DMNDNQPLFSASHYMVTVFDNTTVRTPVAVIYAKDPDAGINSEVRYSLIAGD---AGYFSLDEFSGVLRLERPLTPDTPPTFVLKVKATDRGLPRQLYSTATVTVDVVSLDDYQP-VFLSSD-------------YTAQLPESLAVGSEVLSVSALTADGGGPDAIVYRIISGNE-DGRFLLDAHTGL--------LTLMAPLDFE-VSREYFLSVEGSRGKSPLKDITTII-INVTDVNDNAPVFRQSDRSVDISEDLTPGSLVMKVTATDQDGPINNLLRYSIVSGDPLQQF---SIDHRSGEITVRTALDREQTPHYSLTVQAADEG--SPPLSSAALITITVSDVNDNPPVFSQVNHHLLLQEGEAVGSTILQLVVMDRDMPKN-------------GPPFSFHIVSGNEDRRFHVDQGGLLSLSAPLRKKVKAHHQLKIQVTDSGHPPLSSICVVNINVTEQSK------YPPTVTPLEVFITTTGGQFPNRVIGWVHAADQDL--QDVLIYKLVTPDNGNKFSIDANNGKLCAEGTLEDGTYALNVSVSDG 3600          

HSP 6 Score: 88.9669 bits (219), Expect = 1.939e-17
Identity = 148/620 (23.87%), Postives = 245/620 (39.52%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKN--EDFSTSFVSIDGNSGTIILKKPLFDIDKL---TLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPI-YFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDA-----LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISEL-----KILQ-----VKQSMDYEFIHN--CKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWI---YPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL----KAKHDSISIDPFTGEISLTKDIEAGKYDLF---LQVTDNGNPMRNSS 1952
            D+E + K+VL ++A D G+P L +  +L I +   N   P F    Y   V E++   + IL V A + E        Y+LI N  E+ ++    +D  +G + +  PL D +     TLTV A D+      F    + + + DVN++ P  S               P+ Y   I E  P N  V+ ++  DKD G+N D+   I TT         D       N     +  R+ +D E+        +   DNG   L S   + +++ D N+ P  F  S +   + E  +    ++     D D+     L +     N    FN        + +SSG I   N   R   P Y  ++ V                       +D V Q    ++ +M  +N  S    Q ++ + ++ EN++     +      P E   G+ D   I++L      IL+       Q +D E        I +   D G       + II+   DENDN P++    Y  S+ + VN        G+ + +V A DAD   +  +TY +    +   D I I+PFTG +S+ + +   +  +F   ++  D   P  NS+
Sbjct: 2120 DFEALNKYVLTVLATDEGEPGLSTVSQLSIQV--RNQSNPIFQTLLYPLKVPENVPPFTTILHVQARNPEG-------YRLIYNLEEENASRHFHVDFKTGVLTVTNPL-DYESQTAHTLTVRATDAV--TGSFSEATIEVEVEDVNDNAPVFS---------------PLTYAANIAERLPVNTSVTRVSASDKDSGRNKDLTYAIVTTG-------EDDADSFEINQKTGLIVTRKVLDYEERKQ-FKLKVRATDNGSVPLSSEAFVTINITDVNDNPPDFISSEFKAKVDETANCGHLVVKIQASDPDSADTKNLKYKILTGNRDRYFN--------INESSGVISFSNVCKRNLDPFYNLTVAV-----------------------SDGVFQKTAPVTIDMINSNRYSPYFKQSVY-EAELAENAQAGTRVIRLAAIDPDEGPYGSVDYTIINKLADEKFAILKDGQIITTQPLDRENSTQKVVAIKVMAKDGGGRVAFCTVKIILT--DENDNVPQFKASEYQVSIQSTVN-------KGSPVIQVMAYDADDGKNADVTYTVDEAEEVTEDIIEINPFTGVVSVKESLVGMENRIFNFKVKARDGSLPFYNST 2663          

HSP 7 Score: 88.5817 bits (218), Expect = 2.910e-17
Identity = 137/578 (23.70%), Postives = 238/578 (41.18%), Query Frame = 3
Query:  312 PKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKN---EDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSK--FDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPL-LKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNF-SILSFAVIDQD-ALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFE-MKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGP-TEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS-ISIDPFTGEISLTKDIEAGKYDLF---LQVTDNGNPMR-NSSANLTIIIYQQNMFQSI 2000
            PKF    Y+    ED  +GS I  V    R   D   +IY L+     E       S+D  SGT++L+KP+         ++      HN         V I + DVN+++P             + +  P Y   + EN P    V  +   D D   NG V   ++    L +   LD     + +     +   + +D E+ S    F++   D+G  + L S++ ++V V D+N+ P  F+   Y  S++EN   F  I+S    D D AL         ++   +  F +    ++   + +   LDRE   R+   +        + KF +  TV + VLD+NDN P     +  E + EN+ P   L ++   D D+G N  IS      T +GP  +K   +     +  L +L  +   ++  +          D G       I ++V   D NDN+P  ++ +S   V    +  ++  T +  + A D D+  ++ + Y L A      S+D F+G + L + +       F   ++ TD G P +  S+A +T+ +   + +Q +
Sbjct: 2678 PKFSEPLYSFSAAEDFPIGSEIGSV----RADSDM-PLIYSLVNGNTVESNKDKVFSLDKESGTLLLQKPIDHERTKWYQIDVIAQGNHNGTDVASLVSVSIQVQDVNDNQP-------------VFDASP-YRAFLTENMPAGTTVIQVTANDPDTDTNGLVTYSLEP---LADGAQLDISQVFSIDGDSGWITTLREVDCER-SRMFRFNVVATDHGGEVKLSSSVRVEVMVTDENDNPPTFSEEVYRGSVVENITPFEPIVSMTTFDADVALQNRLVTCYITDGDPLGQFAIIQEDENQWGLIVKESLDRETKDRFTLRVTAT-----DGKFEAAVTVEIHVLDLNDNSPTCEQLLYTETVMENSSPRRFLLKVSASDPDVGANGEISY-----TLHGPDADKFHLDHRTGELLTLAVLDRESDGEFNLVAKAT------DGGGRSCQADIQLMVQ--DMNDNQP--LFSASHYMVTVFDNTTVR--TPVAVIYAKDPDAGINSEVRYSLIAGDAGYFSLDEFSGVLRLERPLTPDTPPTFVLKVKATDRGLPRQLYSTATVTVDVVSLDDYQPV 3210          

HSP 8 Score: 75.0998 bits (183), Expect = 3.328e-13
Identity = 114/510 (22.35%), Postives = 212/510 (41.57%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNF--SINCQDNGQPL-LKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVI-----DQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEP 1685
            D E   +F L++ A D    +  ++  + I ++D+ND +P      YT+ V E+ +    +LKV A D + G  G+I Y L   +        +D  +G  +L   + D +   +  L  +A D    + + D   + + + D+N+++P  S                 Y + +F+N      V+ I   D D G N +V+  +         F LD         +   LR+ + +  +    P  F   +   D G P  L ST  + VDV+  ++Y  +F  S+Y+  + E+    S +LS + +       DA+ +     N    F +++         +G + +  PLD E S  Y  S   V  ++  +      T+ + V D+NDN P +     S ++ E+  P   + ++   D+D   N+ +  S ++     P ++ S +     I+      V+ ++D E   +  + +   DEG P   +   I + + D NDN P
Sbjct: 2966 DRETKDRFTLRVTATD---GKFEAAVTVEIHVLDLNDNSPTCEQLLYTETVMENSSPRRFLLKVSASDPDVGANGEISYTLHGPD---ADKFHLDHRTGE-LLTLAVLDRESDGEFNLVAKATDGGGRSCQAD---IQLMVQDMNDNQPLFSASH--------------YMVTVFDNTTVRTPVAVIYAKDPDAGINSEVRYSLIAGD--AGYFSLDE--------FSGVLRLERPLTPD---TPPTFVLKVKATDRGLPRQLYSTATVTVDVVSLDDYQPVFLSSDYTAQLPESLAVGSEVLSVSALTADGGGPDAIVYRIISGNEDGRFLLDAH--------TGLLTLMAPLDFEVSREYFLS---VEGSRGKSPLKDITTIIINVTDVNDNAPVFRQSDRSVDISEDLTPGSLVMKVTATDQDGPINNLLRYSIVSGD---PLQQFSIDHRSGEIT------VRTALDREQTPHYSLTVQAADEGSPPLSSAALITITVSDVNDNPP 3418          

HSP 9 Score: 74.3294 bits (181), Expect = 6.769e-13
Identity = 97/424 (22.88%), Postives = 184/424 (43.40%), Query Frame = 3
Query:  588 THVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSF-INVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDA--LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVP-----QYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISE-LKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWI---YPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL 1820
            T V +FI DVN++ P            Q LN   + F  +   + E  +V +    +D D+G+NG +   I +     + F++D  +          + +++ +D E + N    ++   D G+P L +   L + V +Q+    +F    Y L + EN   F+ IL     + +   L +N    N+S +F+++          +G + + NPLD E    +  ++   +     T   S AT+ V V D+NDN P      Y   ++  +  N      + ++   DKD G N  ++ + +TT           + D F I++   ++  ++ +DYE     K+ +   D G     ++  + +NI D NDN P++I   + + +D   N  H+       + +++A D DS  +  L Y++
Sbjct: 2042 TQVKVFIDDVNDNSP------------QFLN---LPFSMMISEDSEPGDVLYQATAIDSDQGENGSI---IYSLVEDFDFFWIDPDVG--------DISLKKPLDFEAL-NKYVLTVLATDEGEPGLSTVSQLSIQVRNQSN--PIFQTLLYPLKVPENVPPFTTILHVQARNPEGYRLIYNLEEENASRHFHVDF--------KTGVLTVTNPLDYESQTAHTLTVRATDAV---TGSFSEATIEVEVEDVNDNAPVFSPLTYAANIAERLPVNT----SVTRVSASDKDSGRNKDLTYAIVTTG--------EDDADSFEINQKTGLIVTRKVLDYEERKQFKLKVRATDNGSVPLSSEAFVTINITDVNDNPPDFISSEFKAKVDETANCGHL-------VVKIQASDPDSADTKNLKYKI 2406          

HSP 10 Score: 72.7886 bits (177), Expect = 1.630e-12
Identity = 132/549 (24.04%), Postives = 230/549 (41.89%), Query Frame = 3
Query:  240 DIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL-FD-IDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDRE-KVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIF----DDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFW-ISELKILQVKQSMDYEFIHNCK--------IDIHFHDEGFPKNHNKISIIVNILDENDNEP---EWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL 1820
            D+  P   ++ ++ + I D+ND +P+F+   ++ ++ ED   G V+ +  AID + G+ G IIY L+  EDF   F  ID + G I LKKPL F+ ++K  LTV A D  E       + V    I V N    I          Q L    +Y L++ EN P    +  +   +  EG            +L+ NL   ++    + +     L +   +D E + ++ L         G     S   ++V+V D N+   +F+   Y+ +I E    N S+   +  D+D+    +  + + ++   + +SF ++   Q +G I     LD E+  R QF + V      +   +S A V++ + D+NDN P ++   S E K     +   G L+      D D  +   +    LT           GN D ++ I+E        S    F + CK        + +   D  F K      + +++++ N   P   + +Y + L         N Q+GT++ R+ AID D      + Y +
Sbjct: 2032 DMRDPPRTATTQVKVFIDDVNDNSPQFLNLPFSMMISEDSEPGDVLYQATAIDSDQGENGSIIYSLV--EDF--DFFWIDPDVGDISLKKPLDFEALNKYVLTVLATDEGEPG----LSTVSQLSIQVRNQSNPI---------FQTL----LYPLKVPENVPPFTTILHVQARNP-EGY-----------RLIYNLEEENASRHFHVDFKTGVLTVTNPLDYESQTAHTLTVRATDAVTGS---FSEATIEVEVEDVNDNAPVFSPLTYAANIAERLPVNTSVTRVSASDKDSGRNKDLTYAIVTTGEDDADSFEIN---QKTGLIVTRKVLDYEE--RKQFKLKVRATDNGSVPLSSEAFVTINITDVNDNPPDFI---SSEFKAKVDETANCGHLVVKIQASDPDSADTKNLKYKILT-----------GNRDRYFNINE-------SSGVISFSNVCKRNLDPFYNLTVAVSDGVFQKT---APVTIDMINSNRYSPYFKQSVYEAELAE-------NAQAGTRVIRLAAIDPDEGPYGSVDYTI 2508          

HSP 11 Score: 70.4774 bits (171), Expect = 1.028e-11
Identity = 125/561 (22.28%), Postives = 229/561 (40.82%), Query Frame = 3
Query:  222 LQLIACDIGQP-QLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDID-KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNI---SVGSDKRTSTQLLNGY-PIYF---------------------------LEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSIL---SFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIF----DDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWI-SELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISII-VNILDENDN--EP---EWIYPSSL--DNVVNISHINIQSGTK 1757
            L++ A D G P    S   + I + +IND  P F        V  DL VG  + K+ A D  S +  ++ Y +    +       ++  SG + LKKP+   +   T  V   D  +H S+     VV   +     +P +     G  K+ + +L+    P+                             +++ EN+P N  +      D D G NG V   + +       F +D        T+  +LR+  S+DRE     +  +I   D G P      ++ V++LD N+ P +F +  Y + + EN    S++     A +D D     ++ L +S +     F +  LT   GE+ +   LDRE    +   I   ++A+   +  S  ++ +++ DINDN P++V          ++P   +G ++      D D+G    +S  +L +T  G          +F I      L +++ +D+E      + +   D G P++ +    + + +LD N+N   P   E++Y +++  D  V  S + + +  K
Sbjct:  529 LRVWASDSGSPFSQVSECPVTITLNNINDNFPVFERVGCNITVPLDLPVGREVAKLSAFD--SDELEQLQYIIESGNELQV--FGMETFSGALFLKKPIPPQEGSFTFRVVVSD-GKHRSE---ASVVRVTVRDKGDKPTLHCLETGIQKQQTDKLIESMKPVLVNKKEESFSDQHITNRHTPKFVKSVPSSIDVVENHPLNSTILQFKAADGDSGFNGQVVFALSSGN-EDGCFCID--------TFSGELRLVCSLDRESKEFYI-LNITAYDLGMPQRSVWKLMAVNILDVNDNPPMFDQPRYVIRVPENTAVGSVVFTAQAADMDTDMSGKVQYLLLTSTDL----FRVDELT---GEVIVTGQLDREAVASHNLWIQARDQAKHGPQLFSTISLLIILQDINDNPPRFVPPGYRIKVAEDVP---VGTILLWVESIDLDLGRAGLVSY-NLKSTESG----------IFNIEPSTGALTLERELDFERRPMYNLTVRAVDHGLPRSLSSSCFVEIQVLDVNENLYRPTFSEFVYEAAVIEDAAVGSSVVTLTASDK 1050          

HSP 12 Score: 55.8398 bits (133), Expect = 2.983e-7
Identity = 148/621 (23.83%), Postives = 254/621 (40.90%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPL--FDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDV--LDQNEYPALFTRSNYSLSII--ENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSG---NEDLFW-----ISELKILQVKQ-------SMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTK--DIEA-GKYDLFLQVTDNGNPMRNSSANLTIIIYQQN--MFQSI 2000
            F L + A D G PQ      L + I   +   P F +  Y   + E  A G+ ++ V A    +  +G      I++ + + +F  ++  +G I ++K L   D +   L V A  +A   SK   T V I++ID N++ P             +     +  + + ++N        ++  D D G N  +  QI   + L+ +F +D  M          + +  ++D E  +   +F++  +D+G+  L++    +V V  LD N+    F       S+I    +D   +   A  D  A+S++    N    F        S+  ++G I + N  D +  P YQ  +     A D   +   A V V V ++ D+  Q+  R+           Y  G        + EN + ++ +L         K+SG   NE L +     + + KI Q          + D E      I +   D   P       + V I D NDN P+++   +L   + IS  + + G  L +  AID+D   +  + Y L    D   IDP  G+ISL K  D EA  KY L +  TD G P  ++ + L+I +  Q+  +FQ++
Sbjct: 1614 FHLSVKATDQGFPQRSDLCTLHLHIRLSDRTPPTFSSDEYLTEISELSAPGTPVVTVSASSPAAVHYG------IESGNTNGTFY-LNPYTGLISIQKHLDFEDHESYRLEVAASTTAGALSK---TFVSIYVIDENDNAPRFQ---QSEYQGHISESAHVNSMVMGQSNAP----LVVHASDADRGFNSLLTYQILEPEALR-VFQIDPSMG--------TISLVSAVDFEAKAE-YHFTVQVKDSGELSLRAAKPAKVTVRILDLNDCAPQFATPVLQSSVIWPAVRDAEVVRVTARDDDSAVSYSITEGNLHQAF--------SIHPNTGVISVSNVTDFQ--PFYQLLV----RASDGL-YKDSAVVKVNVTNLTDSDLQFQQRV-----------YSAG--------VSENLK-AVQTLAAL------KVSGCFLNEPLLYSIINPMGKFKISQTSGVLETTGVAFDREEQDVYDITVKVQDMRDPPRTATTQVKVFIDDVNDNSPQFL---NLPFSMMISE-DSEPGDVLYQATAIDSDQGENGSIIYSLVEDFDFFWIDPDVGDISLKKPLDFEALNKYVLTVLATDEGEPGLSTVSQLSIQVRNQSNPIFQTL 2162          

HSP 13 Score: 54.6842 bits (130), Expect = 6.820e-7
Identity = 112/519 (21.58%), Postives = 200/519 (38.54%), Query Frame = 3
Query:  588 THVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLK-STIILQVDVLDQNEYPALFTRSNYSLSI-IENKDNFSILSFAVIDQDALSFNEFHLNSSNN---FNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDIND-------------------------------------------NVPQYVGRM--SFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED-LFWISELKI-LQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIE---AGKYDLFLQVTDNG--NPMRNSSANLTIII 1973
            TH+V+ I D N++ P  +  S              Y   + EN P    V  +   D D+GKNG V   I  +  L   F +D         +   +   + +D E  +   +  +   D+G P  + S   + + + + N+   +F R   ++++ ++      +   +  D D L   ++ + S N    F ME+F        SG + +  P+  ++   + F + V     D    +  + V V V D  D                                           + P++V  +  S ++ EN+  +  + Q    D D G N ++ + +L+          SGNED  F I      L++  S+D E      ++I  +D G P+      + VNILD NDN P +  P  +  V      N   G+ +   +A D D+  S ++ Y L    D   +D  TGE+ +T  ++      ++L++Q  D     P   S+ +L II+
Sbjct:  440 THLVVEITDENDNSPLFTQTS--------------YQATLDENTPVGSSVVKVTAWDSDKGKNGFVTYSIAHSDPLP--FTIDP--------FTGVILTSEHLDFELANRLYHLRVWASDSGSPFSQVSECPVTITLNNINDNFPVFERVGCNITVPLDLPVGREVAKLSAFDSDELEQLQYIIESGNELQVFGMETF--------SGALFLKKPIPPQEG-SFTFRVVV----SDGKHRSEASVVRVTVRDKGDKPTLHCLETGIQKQQTDKLIESMKPVLVNKKEESFSDQHITNRHTPKFVKSVPSSIDVVENHPLNSTILQFKAADGDSGFNGQV-VFALS----------SGNEDGCFCIDTFSGELRLVCSLDRESKEFYILNITAYDLGMPQRSVWKLMAVNILDVNDNPPMFDQPRYVIRVPE----NTAVGSVVFTAQAADMDTDMSGKVQYLLLTSTDLFRVDELTGEVIVTGQLDREAVASHNLWIQARDQAKHGPQLFSTISLLIIL 906          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 160.614 bits (405), Expect = 9.309e-40
Identity = 166/595 (27.90%), Postives = 281/595 (47.23%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNL-FYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDN--VVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTKD---IEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  +G+ ++++ A D + G   +I Y        +T    +++  SG I +++PL D ++     L+V A D +   ++     V+I + DVN++ PNI    D R     +NG    FL   E +P N +++ I V DKD   NG V C I+     K++ F+L       K  Y  QY L     +D E      NF I   D+G+P L  T +++V + D+N+ P +FT+    L+++E NK +  + + +  D+D+    E  + L  + +F         L + +G +      DRE   R+ F++     A+DN      + A V V VLD NDN P++      F + E N+P Y  +G +   D D GEN+ IS+S            L+ NE+        +++   S D E   +   D+   D G P   +   + +N++D NDN P  IYP S  +  +V +S I    G+ +  V A+D+D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:  217 YVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPL-DREETAIHKLSVLASDGSSSPAR---ATVIINVTDVNDNPPNI----DLRYIISPING--TVFLS--EKDPINTKIALITVSDKDTDINGKVICFIE-----KDVPFHL-------KAVYDNQYLLETSALLDYEGTKE-YNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASF-------FDLDRKTGVLTASRVFDREDQDRFLFTV----TARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSE-NLPKYSTVGVITVTDSDAGENAAISLS-----------ILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSI---PGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 62.7734 bits (151), Expect = 1.830e-9
Identity = 131/593 (22.09%), Postives = 243/593 (40.98%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVK--CQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTI 1967
            K+ I + D ND AP F +      + E+  + S      A D ++G      Y+LI  +  F    V + +G     ++ +   D ++     + + VE   S + +S      + + + DVN+++P   V  + +             + I EN+P    V  +   D D G N ++      Q +   K LF L+S   L        + +++ +DRE+ +     S+   D      ++T+I  ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +     LD E +  Y F I   +  + +   T  A V V + D NDN P +    +   + ENN     L  L   D+D G+N+ I              +L  N   F +  +  +L   +  D E        +   D G P    + ++IV +LDENDN P++ +    ++       N+   + +  +   D+D+  +  ++  +   +++  +DPF+G I  +++ D E    Y   ++  D+G P  +S+A +TI
Sbjct:  126 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSST---AILQVTVTDVNDNKP---VFRENQIE-----------VHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGL--------ITVQRPLDREETAI-HKLSVLASDGSSSPARATVI--INVTDVNDNPPNIDLRYIISPINGTVFLSE-KDPINTKIALITVSDKDTDINGKVICFIEKDV---------PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQT--ALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEI------------VYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTH----NHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTI 662          

HSP 3 Score: 61.6178 bits (148), Expect = 4.104e-9
Identity = 68/292 (23.29%), Postives = 126/292 (43.15%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YP-ALFTRSNYSLSII 1055
            DYE   ++  +++A D G+P L  +  + + + D ND  P F        V E+      +  + A D +SG   +I+Y+L  N     SF  +D  +G +   + +FD    D+   TV A D+     +     V++ ++D N++ P            +  + +  +F+   EN P+   V  I V D D G+N  +   I           L+       + +   ++   S DRE+ S+   F +   D+G+P   S   + ++V+D N+  P  ++  SN S  ++
Sbjct:  427 DYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREDQDRFLFTVTARDNGTPPLQAQ-AAVIVTVLDENDNNP------------KFTHNHFQFFVS--ENLPKYSTVGVITVTDSDAGENAAISLSI-----------LNDNENFILDPFSGVIKSNVSFDREQQSS-YTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLV 686          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 160.229 bits (404), Expect = 1.569e-39
Identity = 166/595 (27.90%), Postives = 281/595 (47.23%), Query Frame = 3
Query:  216 FVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTS-FVSIDGNSGTIILKKPLFDIDKLT---LTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNL-FYLDSRMRLNKNTY--QYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIE-NKDNFSILSFAVIDQDALSFNE--FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDN--TKFTSFATVSVVVLDINDNVPQYV-GRMSFEMKENNIPSYE-LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDN--VVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDS--ISIDPFTGEISLTK---DIEAGKYDLFLQVTDNGNP 1937
            +V+++   D G PQ  S+  L + + D+ND  P F        + E+  +G+ ++++ A D + G   +I Y        +T    +++  SG I +++PL D ++     L+V A D +   ++     V+I + DVN++ PNI    D R     +NG    FL   E +P N +++ I V DKD   NG V C I+     K++ F+L       K  Y  QY L     +D E      NF I   D+G+P L  T +++V + D+N+ P +FT+    L+++E NK +  + + +  D+D+    E  + L  + +F         L + +G +      DRE   R+ F++     A+DN      + A V V VLD NDN P++      F + E N+P Y  +G +   D D GEN+ IS+S            L+ NE+        +++   S D E   +   D+   D G P   +   + +N++D NDN P  IYP S  +  +V +S I    G+ +  V A+D+D+  +  L Y + + ++     IDP TG I+L +     + G + L + ++D G P
Sbjct:  217 YVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPL-DREETAIHKLSVLASDGSSSPAR---ATVIINVTDVNDNPPNI----DLRYIISPING--TVFLS--EKDPINTKIALITVSDKDTDINGKVICFIE-----KDVPFHL-------KAVYDNQYLLETSALLDYEGTKE-YNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASF-------FDLDRKTGVLTASRVFDREDQDRFLFTV----TARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSE-NLPKYSTVGVITVTDSDAGENAAISLS-----------ILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSI---PGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 63.1586 bits (152), Expect = 1.184e-9
Identity = 131/593 (22.09%), Postives = 243/593 (40.98%), Query Frame = 3
Query:  273 KLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED-FSTSFV-SIDGNSGTIILKKPLFDIDK-----LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC--QIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPA------LFTRSNYSLSIIENKD--NFSILSFAVIDQDA------LSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGR-MSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEI--SLTKDIE-AGKYDLFLQVTDNGNPMRNSSANLTI 1967
            K+ I + D ND AP F +      + E+  + S      A D ++G      Y+LI  +  F    V + +G     ++ +   D ++     + + VE   S + +S      + + + DVN+++P   V  + +             + I EN+P    V  +   D D G N ++      Q +   K LF L+S   L        + +++ +DRE+ +     S+   D      ++T+I  ++V D N+ P       + +  N ++ + E KD  N  I    V D+D       + F E  +          FHL ++  +   +     LD E +  Y F I   +  + +   T  A V V + D NDN P +    +   + ENN     L  L   D+D G+N+ I              +L  N   F +  +  +L   +  D E        +   D G P    + ++IV +LDENDN P++ +    ++       N+   + +  +   D+D+  +  ++  +   +++  +DPF+G I  +++ D E    Y   ++  D+G P  +S+A +TI
Sbjct:  126 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSST---AILQVTVTDVNDNKP---VFRENQIE-----------VHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGL--------ITVQRPLDREETAI-HKLSVLASDGSSSPARATVI--INVTDVNDNPPNIDLRYIISPINGTVFLSE-KDPINTKIALITVSDKDTDINGKVICFIEKDV---------PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQT--ALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEI------------VYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTH----NHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTI 662          

HSP 3 Score: 62.3882 bits (150), Expect = 2.563e-9
Identity = 68/292 (23.29%), Postives = 125/292 (42.81%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDI---DKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNE-YP-ALFTRSNYSLSII 1055
            DYE   ++  +++A D G+P L  +  + + + D ND  P F        V E+      +  + A D +SG   +I+Y+L  N     SF  +D  +G +   + +FD    D+   TV A D+     +     V++ ++D N++ P  +            N +  +   + EN P+   V  I V D D G+N  +   I           L+       + +   ++   S DRE+ S+   F +   D+G+P   S   + ++V+D N+  P  ++  SN S  ++
Sbjct:  427 DYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPN----ASFFDLDRKTGVLTASR-VFDREDQDRFLFTVTARDNGTPPLQAQ-AAVIVTVLDENDNNPKFT-----------HNHFQFF---VSENLPKYSTVGVITVTDSDAGENAAISLSI-----------LNDNENFILDPFSGVIKSNVSFDREQQSS-YTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLV 686          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 1467.98 bits (3799), Expect = 0.000e+0
Identity = 760/767 (99.09%), Postives = 765/767 (99.74%), Query Frame = 3
Query:   66 IRIDSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINSITRAVLTXXXXXXXXXXXXXXXXXXXVLFLKRRHRSNTDFQFSKSSVVKKNQNFSTSPYRSAQRTSPNQYRNVSPELLMTSLQNPYYFETDLESELPNESEHISNNIAQLFLKVNETLAI 2366
            I +DSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHA+DRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC+IQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGT+LTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINSITRAVLTIIFIPSFIIIFSSGFFIFIVLFLKRRHRSNTDFQFSKSSVVKKN+NFSTSPYRSAQRTSPN YRNVSPELLMTSLQNPYYFETDLESELPNESEHISNNIAQLFLKVNETLAI
Sbjct:  159 IDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTRLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINSITRAVLTIIFIPSFIIIFSSGFFIFIVLFLKRRHRSNTDFQFSKSSVVKKNRNFSTSPYRSAQRTSPNHYRNVSPELLMTSLQNPYYFETDLESELPNESEHISNNIAQLFLKVNETLAI 925          

HSP 2 Score: 57.7658 bits (138), Expect = 3.616e-8
Identity = 38/84 (45.24%), Postives = 50/84 (59.52%), Query Frame = 1
Query:    1 ILDINDNSPKFQKLERHFKILESESI--VLKMEFIIIY*NVHRSLIGIILSSIAPCHCCRWFLS---SLLIMNLFRSLSYN*LP 237
            ILDINDNSPKFQKLERHFKILESES+   +K++  I   +    +   +L      H   + L+   SLL + L +SL Y  +P
Sbjct:  124 ILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIP 207          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 1454.5 bits (3764), Expect = 0.000e+0
Identity = 753/760 (99.08%), Postives = 758/760 (99.74%), Query Frame = 3
Query:   66 IRIDSAQNGVYHYLLECSQKSHRNYFIXXXXXXXXXXXXXXXXDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINSITRAVLTXXXXXXXXXXXXXXXXXXXVLFLKRRHRSNTDFQFSKSSVVKKNQNFSTSPYRSAQRTSPNQYRNVSPELLMTSLQNPYYFETDLESELPNESEHISNNIAQLFLK 2345
            I +DSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHA+DRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKC+IQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGT+LTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINSITRAVLTIIFIPSFIIIFSSGFFIFIVLFLKRRHRSNTDFQFSKSSVVKKN+NFSTSPYRSAQRTSPN YRNVSPELLMTSLQNPYYFETDLESELPNESEHISNNIAQLFLK
Sbjct:  159 IDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTRLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINSITRAVLTIIFIPSFIIIFSSGFFIFIVLFLKRRHRSNTDFQFSKSSVVKKNRNFSTSPYRSAQRTSPNHYRNVSPELLMTSLQNPYYFETDLESELPNESEHISNNIAQLFLK 918          

HSP 2 Score: 284.263 bits (726), Expect = 8.509e-81
Identity = 138/145 (95.17%), Postives = 140/145 (96.55%), Query Frame = 1
Query: 2368 NHVKHL*RVKSMKPDCEVCSSADSGQGASEEEILLYNYKSMKPEKLPSQQLSNYIFPPLMEEDGNSYFYANSNKANKLPDGSESEICNCYNQFVNQYAESECAVNILALLQCPVHNQLLPLINSQTNINDDNLITSAIITSDIIR 2802
            N++  L   KSMKPDCEVCSSADSGQGASEEEILLYNYKSMKPEKLPSQQLSNYIFPPLMEEDGNSYFYANSNKANKLPDGSESEICNCYNQFVNQYAESECAVNILALLQCPVHNQLLPLINSQTNINDDNLITSAIITSDIIR
Sbjct:  910 NNIAQLFLKKSMKPDCEVCSSADSGQGASEEEILLYNYKSMKPEKLPSQQLSNYIFPPLMEEDGNSYFYANSNKANKLPDGSESEICNCYNQFVNQYAESECAVNILALLQCPVHNQLLPLINSQTNINDDNLITSAIITSDIIR 1054          

HSP 3 Score: 57.7658 bits (138), Expect = 4.309e-8
Identity = 38/84 (45.24%), Postives = 50/84 (59.52%), Query Frame = 1
Query:    1 ILDINDNSPKFQKLERHFKILESESI--VLKMEFIIIY*NVHRSLIGIILSSIAPCHCCRWFLS---SLLIMNLFRSLSYN*LP 237
            ILDINDNSPKFQKLERHFKILESES+   +K++  I   +    +   +L      H   + L+   SLL + L +SL Y  +P
Sbjct:  124 ILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIP 207          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000030992.1 (SMESG000030992.1)

HSP 1 Score: 388.267 bits (996), Expect = 4.812e-118
Identity = 226/595 (37.98%), Postives = 362/595 (60.84%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPT-EKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIY 1976
            D+E +  + L L  CD G   LCS QKL+I+IIDIND APKF+ KNY+ VV E L VGS+ILKVHA D E GDFGKI+Y+L  + ++ + F+ ID  +G I L KPL  ++K+ +T+EA D      KF WT ++I IIDVN++RP +     +  +++ ++    Y ++IFEN P +  ++ + V DKD G NG V CQ+ +TK LK+   L + ++  ++ + YKL    S D+E  ++  ++ +NC DNG P L + + + +++LD NEYP  F    YS +  E   + +++ FA+ D DA S NEF +N ++      F +  + + +G++ + +P+DREK+ R    I ++N   DN  FTS ++V + V+DINDN P+ VGR +FE+ EN++    LG++   D D   N++ SISS+ + C+  + +K++ +  +  I E++   V   +DYE    C I +   D+G P   + +++ + ILDENDN P+W++PSS DN +N+S     S +KLTR+RAID D  ++  +TY+L ++     +D FTG+++    ++ G Y L +   D G P + + +NLTI I+
Sbjct:  217 DFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSV-PKFAWTKLLIHIIDVNDNRPEVRFNPSQNVTSKYISDN-FYQIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIK-GRHKF-YKLVTNVSYDKENDNHVSSYFLNCTDNGSPRLSTVVSININILDCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHG---GWFKIHIIDKKNGKLMLMHPIDREKTDRIDLLIIIINIGLDNKNFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV---LDYEKFQQCIISVIATDQGIPSLTSTLTVHLQILDENDNYPQWVFPSSKDNYLNLSVSVTGSSSKLTRIRAIDLDKGANENITYKLHSQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIH 799          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000042292.1 (SMESG000042292.1)

HSP 1 Score: 244.202 bits (622), Expect = 7.503e-67
Identity = 194/603 (32.17%), Postives = 304/603 (50.41%), Query Frame = 3
Query:  195 DYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQT--TKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSIN--CQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLN--SSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTK-DIEAGKYDLFLQVTDNGNPMRNSSANLTIII 1973
            DYE    + + LIACD G+P LC +Q ++I+I + NDE+P F   NYT ++ ED  +G ++L   A D++ G FG++ Y      D    + SID  +G I + K      K   +++A D A  N     T + + ++DVNNH P I V             + +  +E+ ENN   F+++FI V D D+G+N    C IQ+   K   N F + + +  N+ +  YKL   +S D E+      FS+N  C D+G+P   +   +++ + D+NEY   F ++ Y + I EN     ++ +  V D+D        L    S  F+++          SG I     LD EK  +  F++  +N    +  FTS A VSV V+D+NDN P++ +    FE++EN    YE+G++   D+D   NS+++   L TT        S NE LF ++    I+    ++DYE      I +   D G P   N     ++++D NDN P W YP+  DNV+NIS  NI+    LTRVRA+D DS   N + Y L   +D   I+  TGEI+  + +I+ G+  L LQ  D  +   ++S +L + I
Sbjct:  209 DYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAP-NPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTV--IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSI-YKLLADKSFDAEETK---YFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID---------DSGTISTKIVLDYEKIKKLSFNVLAINRGIKS--FTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTT--SENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV-LTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYI 790          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000045211.1 (SMESG000045211.1)

HSP 1 Score: 236.113 bits (601), Expect = 9.953e-66
Identity = 183/566 (32.33%), Postives = 284/566 (50.18%), Query Frame = 3
Query:  228 LIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED--FSTSFVSIDGNSGTIILKKPLFDID---KLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLE-----IFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLN-----KNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIEN--KDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEIS 1871
            L  CD G  +LC++Q L I I+D ND  PK V  +Y   + ED   G++IL V A D + G FG + Y  + N +  F   + SID   G I L K L D+    ++ L VE  D   ++S      V I IID NNHRP+I +             +P+Y L+     + EN P    +  + V D D  +NG+V C++     ++N    D R+ LN     KNT  Y L+ +Q  DRE +       + C DNG P L S I L + + D NE+   FT +N ++S+ EN  +D F IL    IDQDA S  +F L+ S     + F+++S   +SG I      DRE   +YQF +FV++      +FT    +SV++ D NDN P      SF++KEN  P   +G L+  D D+ EN  +    +T T     +K++ N   F+I ++K  +  ++ +D E     K+ I   D G P      ++ V I+D NDN P+W + +S   +++I+   + S T +  ++ +D D + SN  +Y L+  +    ++  TG++S
Sbjct:  215 LEVCDNGPKRLCANQFLNIKILDYNDNKPKCVESHYKVRIAEDTEPGTIILTVSATDDDQGAFGNLSYVFLMNRNLKFINKYFSIDKYRGEISLLKQL-DVKMSTQIDLIVEVRDGYGYDSHMVQCSVTINIIDKNNHRPDIKI-------------HPVYLLKNNKLTLMENEPIGTTICMLIVTDNDLDENGEVTCKLT----MQN----DERVALNFATNLKNTRIYSLKSKQIFDRETMEG-FAIQVRCTDNGLPSLTSDINLDILLTDDNEFSPKFTNANLTVSLSENSPRDLF-ILQVKAIDQDADSVLKFQLSRSVR---DLFYVNS---TSGAIYTKKSFDRETKEKYQFEVFVIDHGVKQ-QFTGVCLISVIITDQNDNAPSLTNPKSFKIKENEKPYSIVGTLMSIDPDLKENGTVHFQLITIT--SRYQKINNNT--FFIDQVKGTIFTQKKLDREAFFEYKLHILLKDNGTPTLSRIETVTVEIVDVNDNAPKWAFQNSFQKLISITQAQLLSSTDIFTLKVVDED-LDSN-CSYFLEVPNKYFLLNHITGQVS 743          

HSP 2 Score: 61.6178 bits (148), Expect = 2.504e-9
Identity = 128/546 (23.44%), Postives = 234/546 (42.86%), Query Frame = 3
Query:  465 FVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFD-------WTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYF--LEIFENNPENFEVSFINVVDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVS-NPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFS-ILSFAVIDQDALSFNE----FHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSF---ATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYE-------LGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNED----LFWISELK-----ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSNRLTYEL-KAKHDSISIDPFTGEISLTKDIE---AGKYDLFLQVTDNGNPMRNSSANL-TIIIYQQN 1985
             +++D  SG + ++KP   ID+ T+  E+        +F        W +V IFI DVN++ P                 +P  F  +EI EN P  ++V  ++V   ++ ++  ++      KLL       +   L+       L +   +D EK      N ++   DNG   L +   L + +LD N+       S+Y + I E+ +  + IL+ +  D D  +F      F +N +  F  + F   S+ +  GEI +   LD + S +    I ++ E +D   + S     +V++ ++D N++ P       + +K N +   E       +  LI  D D+ EN  +       TC     KL+   D    L + + LK      L+ KQ  D E +    I +   D G P   + I++ + + D+N+  P++   ++ +  V++S  N      + +V+AID D+ S   L ++L ++  D   ++  +G I   K  +     KY   + V D+G   + +   L ++II  QN
Sbjct:   76 LINLDKQSGKLTIRKP---IDRETVCPESEKGHLCKLEFTVLVPKDTWINVEIFIQDVNDNPPT----------------FPSKFKYIEISENVPIGYKV-LLDVPKDNDAQDSVLENYNLYGKLL-------THFSLSILPKPLSLVVISKLDHEKEDYRHFNGTLEVCDNGPKRLCANQFLNIKILDYNDNKPKCVESHYKVRIAEDTEPGTIILTVSATDDDQGAFGNLSYVFLMNRNLKFINKYF---SIDKYRGEISLLKQLDVKMSTQ----IDLIVEVRDGYGYDSHMVQCSVTINIIDKNNHRPDIKIHPVYLLKNNKLTLMENEPIGTTICMLIVTDNDLDENGEV-------TC-----KLTMQNDERVALNFATNLKNTRIYSLKSKQIFDRETMEGFAIQVRCTDNGLPSLTSDINLDILLTDDNEFSPKF---TNANLTVSLSE-NSPRDLFILQVKAIDQDADSV--LKFQLSRSVRDLFYVNSTSGAIYTKKSFDRETKEKYQFEVFVIDHGVKQQFTGVCLISVIITDQN 569          
The following BLAST results are available for this feature:
BLAST of Protocadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH16.582e-4326.59protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH18.593e-4326.59protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH97.066e-3626.18protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.044e-3526.18protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.170e-3526.18protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.169e-2724.59FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-12.780e-2224.05FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-46.470e-2124.11Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-17.442e-1922.20CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-11.546e-1522.80Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds4.626e-3425.12gene:FBgn0284247 transcript:FBtr0078045[more]
ds4.626e-3425.12gene:FBgn0284247 transcript:FBtr0343249[more]
ft8.944e-2924.64gene:FBgn0001075 transcript:FBtr0077478[more]
Cad87A1.068e-2424.69gene:FBgn0037963 transcript:FBtr0082513[more]
Cad74A3.126e-2425.45gene:FBgn0036715 transcript:FBtr0075240[more]
back to top
BLAST of Protocadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.204e-4729.68protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.590e-4729.68protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b1.850e-3928.43protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1b2.252e-3928.43protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
CT030123.12.633e-3928.43protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh171.230e-4128.60protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.377e-4128.60protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.393e-4128.60protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.434e-4128.60protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.534e-4128.60protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh15.052e-4427.06protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh15.052e-4427.06protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh16.451e-4427.06protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh98.603e-3626.18protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.269e-3526.18protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN3.161e-4226.59Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9HC56|PCDH9_HUMAN6.192e-3526.18Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|O35161|CELR1_MOUSE2.213e-3425.08Cadherin EGF LAG seven-pass G-type receptor 1 OS=M... [more]
sp|Q9NYQ8|FAT2_HUMAN4.127e-3425.25Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT... [more]
sp|Q9H251|CAD23_HUMAN1.154e-3325.24Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 ... [more]
back to top
BLAST of Protocadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PLE47.976e-5030.03Protocadherin-9 OS=Mizuhopecten yessoensis OX=6573... [more]
A0A267GWV58.137e-5027.74Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G4U92.137e-4927.38CCHC-type domain-containing protein OS=Macrostomum... [more]
A0A210PLD86.033e-4929.25Protocadherin-11 X-linked OS=Mizuhopecten yessoens... [more]
A0A074ZLL58.797e-4827.37Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Protocadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.955e-4528.78protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.604e-4528.78protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b3.782e-4128.74protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh96.848e-3926.69protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh97.802e-3926.69protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh114.569e-3627.13protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.11.436e-3226.01pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.11.552e-2924.08pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004043.15.714e-2923.17pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.15.725e-2923.17pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.052e-4126.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482373.544e-4126.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333594.537e-3325.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417677.482e-3127.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354124.092e-2926.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.346e-4628.57protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.797e-4628.57protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
fat27.525e-4025.25FAT atypical cadherin 2 [Source:NCBI gene;Acc:1011... [more]
pcdh99.309e-4027.90protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.569e-3927.90protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
back to top
BLAST of Protocadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043597.13.616e-899.09SMESG000043597.1[more]
SMESG000043597.18.509e-8199.08SMESG000043597.1[more]
SMESG000030992.14.812e-11837.98SMESG000030992.1[more]
SMESG000042292.17.503e-6732.17SMESG000042292.1[more]
SMESG000045211.19.953e-6632.33SMESG000045211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015050 ID=SMED30015050|Name=Protocadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=2871bp
ATTTTAGACATCAACGACAACAGTCCAAAGTTTCAGAAGCTGGAAAGGCA
TTTCAAAATCCTCGAATCAGAATCGATAGTGCTCAAAATGGAGTTTATCA
TTATTTATTAGAATGTTCACAGAAGTCTCATAGGAATTATTTTATCCTCA
ATCGCACCTTGTCATTGTTGTCGTTGGTTCTTATCAAGTCTCTTGATTAT
GAATTTATTCCGAAGTTTGTCTTACAATTAATTGCCTGTGATATAGGTCA
GCCTCAGTTGTGTTCTTCTCAAAAGCTTGTCATAGACATAATCGATATTA
ACGATGAAGCACCAAAGTTTGTTGCAAAGAACTACACGAAAGTTGTCCAA
GAAGACCTAGCGGTTGGAAGTGTCATATTAAAAGTACATGCCATTGATAG
AGAAAGTGGAGATTTCGGTAAGATCATATATAAACTAATAAAGAATGAAG
ATTTTTCTACGAGTTTTGTTTCGATAGACGGAAATAGTGGAACTATAATT
CTGAAGAAGCCTTTGTTTGACATCGACAAGTTGACATTGACAGTAGAGGC
CCATGATTCCGCTGAACATAATTCCAAATTCGACTGGACTCATGTGGTGA
TTTTTATTATTGATGTTAATAACCACCGGCCGAACATTTCTGTCGGTAGT
GACAAAAGAACCTCGACCCAACTCCTAAATGGATATCCAATTTACTTTCT
TGAAATCTTTGAAAACAATCCAGAGAATTTCGAGGTTTCCTTCATCAATG
TCGTTGATAAAGACGAGGGTAAAAACGGTGATGTCAAATGTCAAATTCAA
ACAACGAAATTGTTAAAGAATCTCTTTTATCTCGATAGTCGAATGAGGTT
AAACAAAAATACTTACCAATACAAATTGAGAATTCGTCAGTCGATTGATA
GGGAGAAAGTCTCGAATCCTTTGAATTTCTCCATCAATTGTCAAGATAAT
GGTCAGCCTCTCCTTAAATCGACCATAATTCTTCAAGTAGACGTTTTGGA
TCAAAACGAATATCCGGCTTTATTTACTAGATCAAATTATTCTCTCTCAA
TCATTGAGAACAAGGATAACTTTTCAATTTTATCATTTGCCGTTATCGAC
CAAGACGCTTTGAGTTTCAATGAATTCCATCTCAATTCTTCAAATAACTT
TAATATGGAAAGTTTCCACTTGAGTTCCCTTACTCAGTCAAGTGGAGAAA
TCCGAATAGGTAATCCACTTGATAGGGAGAAATCTCCCAGATATCAATTC
TCCATTTTTGTCGTCAACGAAGCTCAGGATAATACTAAATTCACTTCATT
TGCCACTGTATCAGTGGTTGTGTTGGACATCAACGATAATGTACCGCAAT
ATGTCGGTCGAATGAGTTTCGAAATGAAAGAGAATAATATACCTTCGTAT
GAACTCGGACAACTGATTTTTGACGATAAGGATATCGGAGAGAACTCAAG
GATTTCAATTTCCTCTTTAACCACCACATGTTATGGACCGACGGAAAAGT
TGTCCGGTAATGAAGATCTGTTTTGGATTTCCGAATTGAAAATCCTTCAA
GTTAAACAGTCAATGGATTATGAGTTCATTCATAACTGCAAGATTGATAT
TCATTTTCATGATGAAGGATTTCCGAAAAATCACAACAAAATCAGCATCA
TTGTAAATATTCTCGATGAAAATGACAATGAACCCGAATGGATCTATCCC
TCGAGTTTAGATAATGTTGTCAACATCAGTCATATCAATATTCAATCCGG
AACAAAACTAACAAGAGTTAGGGCCATTGATGCAGATTCCGTAAGCAGTA
ACCGGCTGACCTACGAGTTGAAAGCCAAACATGATTCTATATCCATAGAC
CCGTTTACCGGGGAGATATCGTTAACAAAAGACATCGAAGCTGGAAAATA
CGATTTATTCCTCCAAGTTACAGACAATGGCAACCCGATGAGGAATTCAT
CAGCGAATCTTACGATTATCATCTATCAGCAGAATATGTTCCAGTCTATC
AACAGCATTACTCGAGCAGTGTTGACGATAATTTTCATACCGTCTTTTAT
CATAATTTTCTCCAGTGGGTTTTTCATCTTCATTGTACTGTTTCTCAAAC
GACGCCACCGGTCAAATACAGATTTTCAATTCTCGAAATCATCAGTGGTG
AAAAAGAATCAAAACTTCTCAACCAGTCCCTATAGATCCGCTCAAAGAAC
CTCACCAAATCAGTACCGAAACGTGTCGCCGGAATTACTCATGACCAGCC
TACAGAATCCCTACTACTTTGAGACAGACCTAGAATCTGAGCTGCCTAAT
GAAAGCGAACATATTTCTAATAATATTGCTCAGTTATTTCTGAAGGTGAA
TGAGACCTTAGCAATTTAATCATGTAAAACATTTATGACGAGTGAAATCA
ATGAAACCTGATTGTGAAGTGTGCAGCAGTGCAGATTCCGGTCAAGGAGC
AAGCGAGGAAGAGATTCTTCTTTACAATTACAAATCAATGAAACCGGAAA
AATTACCTTCACAACAATTGTCCAACTATATTTTTCCCCCGCTAATGGAA
GAAGATGGCAACTCCTACTTTTATGCGAACTCCAACAAAGCGAACAAATT
ACCAGACGGCAGCGAATCAGAGATCTGCAATTGTTATAATCAATTCGTCA
ATCAGTATGCCGAATCCGAATGTGCAGTGAACATTCTCGCCCTCCTCCAG
TGCCCGGTCCATAATCAACTGTTACCCCTTATCAATTCTCAAACGAACAT
TAACGACGATAACCTCATTACCTCTGCCATTATCACATCAGATATAATCC
GATAGTTTTTTTTGTTGCTATTTTGATCTTTATTTTTTCAACATTTCTGA
TTCAGTGAAAATTACCCCAGA
back to top

protein sequence of SMED30015050-orf-1

>SMED30015050-orf-1 ID=SMED30015050-orf-1|Name=SMED30015050-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
MKPDCEVCSSADSGQGASEEEILLYNYKSMKPEKLPSQQLSNYIFPPLME
EDGNSYFYANSNKANKLPDGSESEICNCYNQFVNQYAESECAVNILALLQ
CPVHNQLLPLINSQTNINDDNLITSAIITSDIIR*
back to top

protein sequence of SMED30015050-orf-2

>SMED30015050-orf-2 ID=SMED30015050-orf-2|Name=SMED30015050-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=789bp
FRHQRQQSKVSEAGKAFQNPRIRIDSAQNGVYHYLLECSQKSHRNYFILN
RTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDIN
DEAPKFVAKNYTKVVQEDLAVGSVILKVHAIDRESGDFGKIIYKLIKNED
FSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVI
FIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINV
VDKDEGKNGDVKCQIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDR
EKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSI
IENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEI
RIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY
VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKL
SGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISII
VNILDENDNEPEWIYPSSLDNVVNISHINIQSGTKLTRVRAIDADSVSSN
RLTYELKAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSS
ANLTIIIYQQNMFQSINSITRAVLTIIFIPSFIIIFSSGFFIFIVLFLKR
RHRSNTDFQFSKSSVVKKNQNFSTSPYRSAQRTSPNQYRNVSPELLMTSL
QNPYYFETDLESELPNESEHISNNIAQLFLKVNETLAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 432..449
score: 48.56
coord: 191..210
score: 28.24
coord: 176..188
score: 26.68
coord: 106..135
score: 28.36
coord: 339..352
score: 28.85
coord: 396..422
score: 23.92
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 362..448
e-value: 7.9E-11
score: 52.0
coord: 589..665
e-value: 3.4E-5
score: 33.3
coord: 471..561
e-value: 0.16
score: 12.0
coord: 248..339
e-value: 4.9E-5
score: 32.7
coord: 128..210
e-value: 5.1E-10
score: 49.3
coord: 21..104
e-value: 1.3E-5
score: 34.6
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 580..657
e-value: 1.4E-9
score: 38.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 338..445
e-value: 3.7E-15
score: 58.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 6..103
e-value: 5.3E-12
score: 48.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 104..212
e-value: 4.9E-20
score: 74.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 446..558
e-value: 8.2E-13
score: 50.8
coord: 559..662
e-value: 2.3E-13
score: 52.6
coord: 223..337
e-value: 1.9E-15
score: 59.3
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 15..487
coord: 283..658
coord: 517..673
NoneNo IPR availablePANTHERPTHR24028:SF249CADHERIN-3coord: 15..487
coord: 283..658
coord: 517..673
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 450..563
score: 12.128
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 342..450
score: 18.771
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 579..682
score: 13.926
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 107..212
score: 15.241
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 25..106
score: 15.0
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 227..341
score: 15.263
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 111..208
e-value: 2.77067E-18
score: 78.5093
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 455..559
e-value: 1.84095E-7
score: 47.6934
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 25..101
e-value: 1.96208E-9
score: 53.4714
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 346..446
e-value: 4.53453E-14
score: 66.5681
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 579..657
e-value: 1.10528E-14
score: 68.1089
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 230..336
e-value: 4.46956E-13
score: 63.8717
NoneNo IPR availableTMHMMTMhelixcoord: 676..698
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 551..561
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 438..448
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 229..353
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 335..450
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 94..216
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 551..662
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 438..567
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 23..106