Retinoic acid receptor beta

Overview
NameRetinoic acid receptor beta
Smed IDSMED30015041
Length (bp)2275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retinoic acid receptor beta (SMED30015041) t-SNE clustered cells

Violin plots show distribution of expression levels for Retinoic acid receptor beta (SMED30015041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retinoic acid receptor beta (SMED30015041) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retinoic acid receptor beta (SMED30015041) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30015041SMESG000054304.1 SMED30015041smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
gutSMED30015041SMESG000054304.1 SMED30015041smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30015041SMESG000054304.1 SMED30015041smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30015041SMESG000054304.1 SMED30015041smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
musculature systemSMED30015041SMESG000054304.1 SMED30015041smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30015041SMESG000054304.1 SMED30015041smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30015041SMESG000054304.1 dd_Smed_v4_8796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015041SMESG000054304.1 dd_Smed_v4_8796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015041SMESG000054304.1 dd_Smed_v4_8796_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retinoic acid receptor beta vs. Ensembl Human
Match: RARA (retinoic acid receptor alpha [Source:HGNC Symbol;Acc:HGNC:9864])

HSP 1 Score: 108.612 bits (270), Expect = 2.886e-24
Identity = 46/79 (58.23%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NC+INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   84 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 162          
BLAST of Retinoic acid receptor beta vs. Ensembl Human
Match: RARA (retinoic acid receptor alpha [Source:HGNC Symbol;Acc:HGNC:9864])

HSP 1 Score: 108.612 bits (270), Expect = 2.886e-24
Identity = 46/79 (58.23%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NC+INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   84 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 162          
BLAST of Retinoic acid receptor beta vs. Ensembl Human
Match: RARB (retinoic acid receptor beta [Source:HGNC Symbol;Acc:HGNC:9865])

HSP 1 Score: 107.457 bits (267), Expect = 3.266e-24
Identity = 46/79 (58.23%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NCVINK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   84 VYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 162          
BLAST of Retinoic acid receptor beta vs. Ensembl Human
Match: RARA (retinoic acid receptor alpha [Source:HGNC Symbol;Acc:HGNC:9864])

HSP 1 Score: 107.842 bits (268), Expect = 3.881e-24
Identity = 46/79 (58.23%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NC+INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   79 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 157          
BLAST of Retinoic acid receptor beta vs. Ensembl Human
Match: NR6A1 (nuclear receptor subfamily 6 group A member 1 [Source:HGNC Symbol;Acc:HGNC:7985])

HSP 1 Score: 102.834 bits (255), Expect = 4.821e-24
Identity = 40/80 (50.00%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C D+ATGLHY +++CEGCKGFFKRSI  ++ Y+C  + NCV++++ RN CQ CR+ +C + GM    +R+D  PG R
Sbjct:   18 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGR 97          
BLAST of Retinoic acid receptor beta vs. Ensembl Celegans
Match: nhr-91 (Nuclear hormone receptor family member nhr-91 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2R6])

HSP 1 Score: 114.39 bits (285), Expect = 1.523e-26
Identity = 48/80 (60.00%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C+VC DK+TGLHY   TCEGCKGFFKRS+Q +K Y C  +N C I+K+ RN CQ+CR R+C  KGM    VR+DR PG R
Sbjct:  100 CSVCGDKSTGLHYGAATCEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQNRNRCQSCRFRKCISKGMLTEAVREDRMPGGR 179          
BLAST of Retinoic acid receptor beta vs. Ensembl Celegans
Match: nhr-91 (Nuclear hormone receptor family member nhr-91 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2R6])

HSP 1 Score: 114.39 bits (285), Expect = 1.523e-26
Identity = 48/80 (60.00%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C+VC DK+TGLHY   TCEGCKGFFKRS+Q +K Y C  +N C I+K+ RN CQ+CR R+C  KGM    VR+DR PG R
Sbjct:  100 CSVCGDKSTGLHYGAATCEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQNRNRCQSCRFRKCISKGMLTEAVREDRMPGGR 179          
BLAST of Retinoic acid receptor beta vs. Ensembl Celegans
Match: nhr-91 (Nuclear hormone receptor family member nhr-91 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2R6])

HSP 1 Score: 114.39 bits (285), Expect = 1.523e-26
Identity = 48/80 (60.00%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C+VC DK+TGLHY   TCEGCKGFFKRS+Q +K Y C  +N C I+K+ RN CQ+CR R+C  KGM    VR+DR PG R
Sbjct:  100 CSVCGDKSTGLHYGAATCEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQNRNRCQSCRFRKCISKGMLTEAVREDRMPGGR 179          
BLAST of Retinoic acid receptor beta vs. Ensembl Celegans
Match: nhr-88 (Nuclear Hormone Receptor family [Source:UniProtKB/TrEMBL;Acc:H2KZA1])

HSP 1 Score: 95.9005 bits (237), Expect = 5.017e-22
Identity = 41/85 (48.24%), Postives = 56/85 (65.88%), Query Frame = 1
Query:  559 PGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            PG  NG   +C VC D++ G HY VM C GCKGFF+R+I++++ Y CR    C I+K+ RNAC+ CR +RC   GM+   +R DR
Sbjct:   27 PGMDNGD-GQCMVCGDRSAGKHYGVMACYGCKGFFRRTIRSQQTYTCRFTQKCAIDKDQRNACRYCRFQRCLTVGMEPEAIRPDR 110          
BLAST of Retinoic acid receptor beta vs. Ensembl Celegans
Match: nhr-88 (Nuclear Hormone Receptor family [Source:UniProtKB/TrEMBL;Acc:H2KZA1])

HSP 1 Score: 95.9005 bits (237), Expect = 5.017e-22
Identity = 41/85 (48.24%), Postives = 56/85 (65.88%), Query Frame = 1
Query:  559 PGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            PG  NG   +C VC D++ G HY VM C GCKGFF+R+I++++ Y CR    C I+K+ RNAC+ CR +RC   GM+   +R DR
Sbjct:   27 PGMDNGD-GQCMVCGDRSAGKHYGVMACYGCKGFFRRTIRSQQTYTCRFTQKCAIDKDQRNACRYCRFQRCLTVGMEPEAIRPDR 110          
BLAST of Retinoic acid receptor beta vs. Ensembl Fly
Match: Hr4 (gene:FBgn0264562 transcript:FBtr0333341)

HSP 1 Score: 112.079 bits (279), Expect = 6.607e-25
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C+DKATGLHY ++TCEGCKGFFKR++Q  + Y C  +  C I K  RN CQ CR ++C E+GM    VR+DR PG R
Sbjct:  921 CMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCVADGTCEITKAQRNRCQYCRFKKCIEQGMVLQAVREDRMPGGR 1000          
BLAST of Retinoic acid receptor beta vs. Ensembl Fly
Match: Hr4 (gene:FBgn0264562 transcript:FBtr0333342)

HSP 1 Score: 112.079 bits (279), Expect = 8.123e-25
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C+DKATGLHY ++TCEGCKGFFKR++Q  + Y C  +  C I K  RN CQ CR ++C E+GM    VR+DR PG R
Sbjct:  921 CMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCVADGTCEITKAQRNRCQYCRFKKCIEQGMVLQAVREDRMPGGR 1000          
BLAST of Retinoic acid receptor beta vs. Ensembl Fly
Match: Hr4 (gene:FBgn0264562 transcript:FBtr0333338)

HSP 1 Score: 111.694 bits (278), Expect = 9.235e-25
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C+DKATGLHY ++TCEGCKGFFKR++Q  + Y C  +  C I K  RN CQ CR ++C E+GM    VR+DR PG R
Sbjct: 1014 CMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCVADGTCEITKAQRNRCQYCRFKKCIEQGMVLQAVREDRMPGGR 1093          
BLAST of Retinoic acid receptor beta vs. Ensembl Fly
Match: Hr4 (gene:FBgn0264562 transcript:FBtr0333339)

HSP 1 Score: 111.309 bits (277), Expect = 1.310e-24
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C+DKATGLHY ++TCEGCKGFFKR++Q  + Y C  +  C I K  RN CQ CR ++C E+GM    VR+DR PG R
Sbjct: 1245 CMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCVADGTCEITKAQRNRCQYCRFKKCIEQGMVLQAVREDRMPGGR 1324          
BLAST of Retinoic acid receptor beta vs. Ensembl Fly
Match: Hr4 (gene:FBgn0264562 transcript:FBtr0333344)

HSP 1 Score: 111.309 bits (277), Expect = 1.322e-24
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C+DKATGLHY ++TCEGCKGFFKR++Q  + Y C  +  C I K  RN CQ CR ++C E+GM    VR+DR PG R
Sbjct: 1245 CMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCVADGTCEITKAQRNRCQYCRFKKCIEQGMVLQAVREDRMPGGR 1324          
BLAST of Retinoic acid receptor beta vs. Ensembl Zebrafish
Match: rargb (retinoic acid receptor, gamma b [Source:NCBI gene;Acc:100034753])

HSP 1 Score: 105.531 bits (262), Expect = 8.363e-24
Identity = 45/75 (60.00%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            C VCQDK++G HY V +CEGCKGFF+RSIQ    Y C  + NC INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   37 CFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDR 111          
BLAST of Retinoic acid receptor beta vs. Ensembl Zebrafish
Match: nr2c2 (nuclear receptor subfamily 2, group C, member 2 [Source:ZFIN;Acc:ZDB-GENE-080403-8])

HSP 1 Score: 107.457 bits (267), Expect = 1.007e-23
Identity = 44/77 (57.14%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTP 819
            C VC DKA+G HY  ++CEGCKGFFKRS++    Y CR+N +CVINK  RN CQ CR+R+C E GMK   V+ +R P
Sbjct:  147 CVVCGDKASGRHYGAVSCEGCKGFFKRSVRKSLTYSCRSNQDCVINKHHRNRCQFCRLRKCLEMGMKMESVQSERKP 223          
BLAST of Retinoic acid receptor beta vs. Ensembl Zebrafish
Match: rxrba (retinoid x receptor, beta a [Source:NCBI gene;Acc:30530])

HSP 1 Score: 102.064 bits (253), Expect = 1.196e-23
Identity = 41/92 (44.57%), Postives = 63/92 (68.48%), Query Frame = 1
Query:  538 RPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +P   H PG +      CA+C D+++G HY V +CEGCKGFFKR+++ + +Y CR+N +C+++K  RN CQ CR ++C   GMK  +V+D+R
Sbjct:  117 KPLSSHSPGPMVSQKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLSYTCRDNKDCLVDKRQRNRCQYCRYQKCLAMGMKREVVQDER 208          
BLAST of Retinoic acid receptor beta vs. Ensembl Zebrafish
Match: raraa (retinoic acid receptor, alpha a [Source:NCBI gene;Acc:30680])

HSP 1 Score: 105.531 bits (262), Expect = 1.405e-23
Identity = 45/79 (56.96%), Postives = 54/79 (68.35%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C    NC+INK TRN CQ CR+++C E GM +  VR+DR
Sbjct:   74 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDR 152          
BLAST of Retinoic acid receptor beta vs. Ensembl Zebrafish
Match: raraa (retinoic acid receptor, alpha a [Source:NCBI gene;Acc:30680])

HSP 1 Score: 105.145 bits (261), Expect = 1.892e-23
Identity = 45/79 (56.96%), Postives = 54/79 (68.35%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C    NC+INK TRN CQ CR+++C E GM +  VR+DR
Sbjct:   71 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDR 149          
BLAST of Retinoic acid receptor beta vs. Ensembl Xenopus
Match: RARB (retinoic acid receptor beta [Source:NCBI gene;Acc:100488600])

HSP 1 Score: 108.997 bits (271), Expect = 1.422e-24
Identity = 48/79 (60.76%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C    NCVINK TRN CQ CR++RCFE GM +  VR+DR
Sbjct:   84 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDR 162          
BLAST of Retinoic acid receptor beta vs. Ensembl Xenopus
Match: RARB (retinoic acid receptor beta [Source:NCBI gene;Acc:100488600])

HSP 1 Score: 108.997 bits (271), Expect = 1.432e-24
Identity = 48/79 (60.76%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C    NCVINK TRN CQ CR++RCFE GM +  VR+DR
Sbjct:   82 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDR 160          
BLAST of Retinoic acid receptor beta vs. Ensembl Xenopus
Match: RARB (retinoic acid receptor beta [Source:NCBI gene;Acc:100488600])

HSP 1 Score: 108.997 bits (271), Expect = 1.526e-24
Identity = 48/79 (60.76%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C    NCVINK TRN CQ CR++RCFE GM +  VR+DR
Sbjct:   82 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDR 160          
BLAST of Retinoic acid receptor beta vs. Ensembl Xenopus
Match: RARB (retinoic acid receptor beta [Source:NCBI gene;Acc:100488600])

HSP 1 Score: 109.383 bits (272), Expect = 1.554e-24
Identity = 48/79 (60.76%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C    NCVINK TRN CQ CR++RCFE GM +  VR+DR
Sbjct:  102 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDR 180          
BLAST of Retinoic acid receptor beta vs. Ensembl Xenopus
Match: RARB (retinoic acid receptor beta [Source:NCBI gene;Acc:100488600])

HSP 1 Score: 108.227 bits (269), Expect = 2.096e-24
Identity = 48/79 (60.76%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C    NCVINK TRN CQ CR++RCFE GM +  VR+DR
Sbjct:   77 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDR 155          
BLAST of Retinoic acid receptor beta vs. Ensembl Mouse
Match: Rarg (retinoic acid receptor, gamma [Source:MGI Symbol;Acc:MGI:97858])

HSP 1 Score: 105.531 bits (262), Expect = 3.789e-25
Identity = 44/79 (55.70%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VC DK++G HY V +CEGCKGFF+RSIQ    Y C  + NC+INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   86 VYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDR 164          
BLAST of Retinoic acid receptor beta vs. Ensembl Mouse
Match: Rarb (retinoic acid receptor, beta [Source:MGI Symbol;Acc:MGI:97857])

HSP 1 Score: 107.071 bits (266), Expect = 2.798e-24
Identity = 46/75 (61.33%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NCVINK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   81 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 155          
BLAST of Retinoic acid receptor beta vs. Ensembl Mouse
Match: Rarb (retinoic acid receptor, beta [Source:MGI Symbol;Acc:MGI:97857])

HSP 1 Score: 107.457 bits (267), Expect = 3.940e-24
Identity = 46/75 (61.33%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NCVINK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   81 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 155          
BLAST of Retinoic acid receptor beta vs. Ensembl Mouse
Match: Nr6a1 (nuclear receptor subfamily 6, group A, member 1 [Source:MGI Symbol;Acc:MGI:1352459])

HSP 1 Score: 102.834 bits (255), Expect = 4.135e-24
Identity = 40/80 (50.00%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C D+ATGLHY +++CEGCKGFFKRSI  ++ Y+C  + NCV++++ RN CQ CR+ +C + GM    +R+D  PG R
Sbjct:   18 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGR 97          
BLAST of Retinoic acid receptor beta vs. Ensembl Mouse
Match: Rara (retinoic acid receptor, alpha [Source:MGI Symbol;Acc:MGI:97856])

HSP 1 Score: 107.071 bits (266), Expect = 4.919e-24
Identity = 45/79 (56.96%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            I   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NC+INK TRN CQ CR+++CF+ GM +  VR+DR
Sbjct:   84 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDR 162          
BLAST of Retinoic acid receptor beta vs. UniProt/SwissProt
Match: sp|Q9U2R6|NHR91_CAEEL (Nuclear hormone receptor family member nhr-91 OS=Caenorhabditis elegans OX=6239 GN=nhr-91 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 1.938e-25
Identity = 48/80 (60.00%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C+VC DK+TGLHY   TCEGCKGFFKRS+Q +K Y C  +N C I+K+ RN CQ+CR R+C  KGM    VR+DR PG R
Sbjct:  100 CSVCGDKSTGLHYGAATCEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQNRNRCQSCRFRKCISKGMLTEAVREDRMPGGR 179          
BLAST of Retinoic acid receptor beta vs. UniProt/SwissProt
Match: sp|P18515|RARB_NOTVI (Retinoic acid receptor beta (Fragment) OS=Notophthalmus viridescens OX=8316 GN=RARB PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.440e-25
Identity = 47/79 (59.49%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NCVINK TRN CQ CR++RCFE GM +  VR+DR
Sbjct:   30 VYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDR 108          
BLAST of Retinoic acid receptor beta vs. UniProt/SwissProt
Match: sp|Q9W539|HR4_DROME (Hormone receptor 4 OS=Drosophila melanogaster OX=7227 GN=Hr4 PE=1 SV=4)

HSP 1 Score: 112.079 bits (279), Expect = 6.623e-24
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C +C+DKATGLHY ++TCEGCKGFFKR++Q  + Y C  +  C I K  RN CQ CR ++C E+GM    VR+DR PG R
Sbjct:  921 CMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCVADGTCEITKAQRNRCQYCRFKKCIEQGMVLQAVREDRMPGGR 1000          
BLAST of Retinoic acid receptor beta vs. UniProt/SwissProt
Match: sp|P22448|RARB_CHICK (Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 9.918e-24
Identity = 46/79 (58.23%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NCVINK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   84 VYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 162          
BLAST of Retinoic acid receptor beta vs. UniProt/SwissProt
Match: sp|Q9W6B3|RARB_COTJA (Retinoic acid receptor beta OS=Coturnix japonica OX=93934 GN=RARB PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.001e-23
Identity = 46/79 (58.23%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NCVINK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   84 VYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDR 162          
BLAST of Retinoic acid receptor beta vs. TrEMBL
Match: A0A3M6TL04 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00001358 PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.541e-25
Identity = 54/112 (48.21%), Postives = 71/112 (63.39%), Query Frame = 1
Query:  493 SEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            +EP K  VS   + G   +  P    +G  +EC VC DKATG HY V TCEGCKGFFKR++Q +  Y C+ + NC +N+  RN CQ CR ++C  +GM +  VR+DRTPG R
Sbjct:   58 TEPSKPGVSVDNEEGGHSEGQPVAANSGATSECVVCNDKATGYHYGVFTCEGCKGFFKRTVQKQLEYTCKGDGNCEVNQLNRNRCQYCRFQKCMAQGMLKEAVREDRTPGGR 169          
BLAST of Retinoic acid receptor beta vs. TrEMBL
Match: A0A2B4SY17 (Estrogen-related receptor gamma OS=Stylophora pistillata OX=50429 GN=ESRRG PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 7.591e-25
Identity = 54/112 (48.21%), Postives = 69/112 (61.61%), Query Frame = 1
Query:  493 SEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            +EP K  VS   + G      P     G  +EC VC DKATG HY V TCEGCKGFFKR++Q +  Y C+ + NC +N+  RN CQ CR ++C  +GM +  VR+DRTPG R
Sbjct:   58 AEPSKLGVSVDNESGYKDS-QPVAANGGATSECVVCNDKATGYHYGVFTCEGCKGFFKRTVQKQLEYTCKGDGNCEVNQLNRNRCQYCRFQKCMAQGMLKEAVREDRTPGGR 168          
BLAST of Retinoic acid receptor beta vs. TrEMBL
Match: A7S8G8 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g108851 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.262e-24
Identity = 49/80 (61.25%), Postives = 57/80 (71.25%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C VC DKATG HY V TCEGCKGFFKR++Q +  Y CR N +C IN+ TRN CQ CR  +C + GM +  VRDDRTPG R
Sbjct:    4 CVVCNDKATGYHYGVFTCEGCKGFFKRTVQKQLEYTCRGNQDCDINQHTRNRCQYCRFEKCVKSGMLKQAVRDDRTPGGR 83          
BLAST of Retinoic acid receptor beta vs. TrEMBL
Match: A0A261BEI7 (Uncharacterized protein (Fragment) OS=Caenorhabditis remanei OX=31234 GN=FL82_02349 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.495e-24
Identity = 49/80 (61.25%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C+VC DK+TGLHY   TCEGCKGFFKRS+Q +K Y C  NN C I+K+ RN CQ+CR R+C  KGM    VR+DR PG R
Sbjct:  107 CSVCADKSTGLHYGASTCEGCKGFFKRSVQNKKIYHCNQNNLCEIDKQNRNRCQSCRFRKCISKGMLTEAVREDRMPGGR 186          
BLAST of Retinoic acid receptor beta vs. TrEMBL
Match: A0A261CNG3 (Uncharacterized protein (Fragment) OS=Caenorhabditis latens OX=1503980 GN=FL83_01766 PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.575e-23
Identity = 49/80 (61.25%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C+VC DK+TGLHY   TCEGCKGFFKRS+Q +K Y C  NN C I+K+ RN CQ+CR R+C  KGM    VR+DR PG R
Sbjct:  104 CSVCADKSTGLHYGASTCEGCKGFFKRSVQNKKIYHCNQNNLCEIDKQNRNRCQSCRFRKCISKGMLTEAVREDRMPGGR 183          
BLAST of Retinoic acid receptor beta vs. Ensembl Cavefish
Match: rarga (retinoic acid receptor gamma-A [Source:NCBI gene;Acc:103046242])

HSP 1 Score: 105.531 bits (262), Expect = 1.181e-23
Identity = 45/75 (60.00%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            C VCQDK++G HY V +CEGCKGFF+RSIQ    Y C  + NC INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   77 CFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDR 151          
BLAST of Retinoic acid receptor beta vs. Ensembl Cavefish
Match: rarga (retinoic acid receptor gamma-A [Source:NCBI gene;Acc:103046242])

HSP 1 Score: 105.916 bits (263), Expect = 1.537e-23
Identity = 45/79 (56.96%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VCQDK++G HY V +CEGCKGFF+RSIQ    Y C  + NC INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   77 VYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDR 155          
BLAST of Retinoic acid receptor beta vs. Ensembl Cavefish
Match: RARB (retinoic acid receptor beta [Source:HGNC Symbol;Acc:HGNC:9865])

HSP 1 Score: 105.145 bits (261), Expect = 1.825e-23
Identity = 44/75 (58.67%), Postives = 54/75 (72.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NC+INK TRN CQ CR+++CF  GM +  VR+DR
Sbjct:   82 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFAVGMSKESVRNDR 156          
BLAST of Retinoic acid receptor beta vs. Ensembl Cavefish
Match: rarga (retinoic acid receptor gamma-A [Source:NCBI gene;Acc:103046242])

HSP 1 Score: 105.531 bits (262), Expect = 1.935e-23
Identity = 45/79 (56.96%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VCQDK++G HY V +CEGCKGFF+RSIQ    Y C  + NC INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   73 VYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDR 151          
BLAST of Retinoic acid receptor beta vs. Ensembl Cavefish
Match: hnf4g (hepatocyte nuclear factor 4 gamma [Source:NCBI gene;Acc:103037173])

HSP 1 Score: 103.99 bits (258), Expect = 3.055e-23
Identity = 41/81 (50.62%), Postives = 58/81 (71.60%), Query Frame = 1
Query:  571 NGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            NG+ + CA+C DKATG HY   +C+GCKGFF+RSI+    Y CR N  CV++K+ RN C+ CR+ +CF  GMK+  V+++R
Sbjct:   28 NGVNSNCAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNER 108          
BLAST of Retinoic acid receptor beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006803.1 (pep scaffold:Pmarinus_7.0:GL479639:153667:156574:-1 gene:ENSPMAG00000006138.1 transcript:ENSPMAT00000006803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 8.722e-22
Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMK 789
            C VC D+A+G HY  ++CEGCKGFFKRS++    Y CR + +CVINK  RN CQ CR+++CF  GMK
Sbjct:  127 CVVCGDRASGRHYGAVSCEGCKGFFKRSVRKNLKYTCRGSQDCVINKHHRNRCQYCRLQKCFNVGMK 193          
BLAST of Retinoic acid receptor beta vs. Ensembl Sea Lamprey
Match: nr1d2a (nuclear receptor subfamily 1, group D, member 2a [Source:ZFIN;Acc:ZDB-GENE-040504-1])

HSP 1 Score: 97.8265 bits (242), Expect = 2.273e-21
Identity = 47/96 (48.96%), Postives = 57/96 (59.38%), Query Frame = 1
Query:  541 PPKIHPPGT--INGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYK-CRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTP 819
            PP    PG+  ING++  C VC D A+G HY V  CEGCKGFF+RSIQ    YK C  N  C I +  RN CQ CR ++C   GM ++ VR  R P
Sbjct:  104 PPAGASPGSVAINGVVLLCKVCGDAASGFHYGVHACEGCKGFFRRSIQQNIKYKPCLKNETCPIVRANRNRCQHCRFKKCLSVGMSKDAVRFGRIP 199          
BLAST of Retinoic acid receptor beta vs. Ensembl Sea Lamprey
Match: RARA (retinoic acid receptor alpha [Source:HGNC Symbol;Acc:HGNC:9864])

HSP 1 Score: 95.1301 bits (235), Expect = 5.871e-21
Identity = 41/72 (56.94%), Postives = 52/72 (72.22%), Query Frame = 1
Query:  601 QDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRT 816
            QDK++G HY V +CEGCKGFF+RSIQ    Y C  +  C+INK TRN CQ CR++RC E GM +  VR+DR+
Sbjct:    1 QDKSSGYHYGVSSCEGCKGFFRRSIQNIMVYTCHRDKKCIINKITRNRCQYCRLQRCLEVGMSKESVRNDRS 72          
BLAST of Retinoic acid receptor beta vs. Ensembl Sea Lamprey
Match: ESR2 (estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3468])

HSP 1 Score: 91.6633 bits (226), Expect = 1.071e-20
Identity = 42/73 (57.53%), Postives = 49/73 (67.12%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRD 807
            CAVC D A+G HY V +CEGCK FFKRSIQ +  Y C   N C I+K  R +CQACR+R+C E GM    VRD
Sbjct:   35 CAVCSDLASGYHYGVWSCEGCKAFFKRSIQGKTNYICPATNQCTIDKNRRKSCQACRLRKCHEVGM----VRD 103          
BLAST of Retinoic acid receptor beta vs. Ensembl Sea Lamprey
Match: ESR2 (estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3468])

HSP 1 Score: 90.1225 bits (222), Expect = 2.012e-20
Identity = 36/70 (51.43%), Postives = 49/70 (70.00%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENL 798
            C+VC D ++G HY V TCEGCK FFKRS+Q +  + C   N+C I+K  R  CQACR+R+C+E GM  ++
Sbjct:   32 CSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATNHCTIDKTRRRRCQACRLRKCYEAGMIRDV 101          
BLAST of Retinoic acid receptor beta vs. Ensembl Nematostella
Match: EDO39982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8G8])

HSP 1 Score: 116.701 bits (291), Expect = 2.316e-28
Identity = 49/80 (61.25%), Postives = 57/80 (71.25%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            C VC DKATG HY V TCEGCKGFFKR++Q +  Y CR N +C IN+ TRN CQ CR  +C + GM +  VRDDRTPG R
Sbjct:    4 CVVCNDKATGYHYGVFTCEGCKGFFKRTVQKQLEYTCRGNQDCDINQHTRNRCQYCRFEKCVKSGMLKQAVRDDRTPGGR 83          
BLAST of Retinoic acid receptor beta vs. Ensembl Nematostella
Match: EDO42936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S012])

HSP 1 Score: 103.99 bits (258), Expect = 5.329e-24
Identity = 41/80 (51.25%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  580 LAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTP 819
            + +C VC D+A+G HY VMTC+GC+GFFKRS++   AY+C+  N+C I+   RN CQACR+R+CFE  M  + V+ +R P
Sbjct:    1 MVQCRVCGDRASGKHYGVMTCDGCRGFFKRSVRRNLAYQCKEKNDCPIDVARRNQCQACRLRKCFEMNMNRDAVQHERAP 80          
BLAST of Retinoic acid receptor beta vs. Ensembl Nematostella
Match: EDO46487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ27])

HSP 1 Score: 96.2857 bits (238), Expect = 1.011e-21
Identity = 38/73 (52.05%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  595 VCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +C D+ATG HY   +C+GCKGFF+RS++    Y CR   NCVINK+ RN C+ CR+R+CF  GMK+  V+++R
Sbjct:    3 ICADRATGKHYGASSCDGCKGFFRRSVRKNHVYSCRFQRNCVINKDKRNQCRFCRLRKCFRAGMKKEAVQNER 75          
BLAST of Retinoic acid receptor beta vs. Ensembl Nematostella
Match: EDO27017 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAF5])

HSP 1 Score: 94.3597 bits (233), Expect = 1.439e-21
Identity = 38/80 (47.50%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            CA+C D+++G HY V +CEGCK FFKR++Q +  Y C  + +C I+K  R  CQ CR ++C   GM +  VR+DR PG R
Sbjct:   14 CAICGDRSSGFHYGVQSCEGCKSFFKRTVQKQLQYACVESKSCQIDKNNRIRCQYCRFQKCLALGMLKEAVREDRAPGGR 93          
BLAST of Retinoic acid receptor beta vs. Ensembl Nematostella
Match: EDO42195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S286])

HSP 1 Score: 95.9005 bits (237), Expect = 2.335e-21
Identity = 38/80 (47.50%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNR 828
            CA+C D+++G HY V +CEGCK FFKR++Q +  Y C  + +C I+K  R  CQ CR ++C   GM +  VR+DR PG R
Sbjct:   14 CAICGDRSSGFHYGVQSCEGCKSFFKRTVQKQLQYACVESKSCQIDKNNRIRCQYCRFQKCLALGMLKEAVREDRAPGGR 93          

HSP 2 Score: 64.6994 bits (156), Expect = 4.378e-11
Identity = 45/185 (24.32%), Postives = 90/185 (48.65%), Query Frame = 1
Query: 1408 EQILECLADEIHLIIKFAKKTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVGPQDIPNMEILSPRFYQTMVQLIC---SFKSLNIDIYELCLIQYVVIEDEE--GDLELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQIDEASKLFMLDCV 1947
            E I+E    E+  +I +AK+ PGFC+ D   ++ ++ +  L +L +R+  RS + H   + +A +  + P ++ N+ +      Q   QL C     +SL +D+ E   +  +++ ++E  G L   D   F+        N + + L+ Y  + YP+ P R+  I+L L  + + +     +C+
Sbjct:  148 EAIMELTLQEVEHVINWAKRVPGFCDVDKEDQISLLSEGLLEVLILRICQRS-TPHQGAVMVAKDTLLSPDNVFNIVL-----EQWAGQLSCFAYKLQSLQLDMAEFACVNAIMLFEQETSGGLRNRDLVDFVL-------NRTLDALRDYIKSSYPEKPSRFAHILLKLPTLRDMATRMAEECL 319          
BLAST of Retinoic acid receptor beta vs. Ensembl Medaka
Match: RARB (retinoic acid receptor beta [Source:NCBI gene;Acc:101155959])

HSP 1 Score: 106.686 bits (265), Expect = 6.055e-24
Identity = 44/76 (57.89%), Postives = 55/76 (72.37%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRT 816
            C VCQDK++G HY V  CEGCKGFF+RS+Q    Y C  + NC+INK TRN CQ CR++RCF  GM +  VR+DR+
Sbjct:   90 CFVCQDKSSGYHYGVSACEGCKGFFRRSVQKNMVYTCHRDRNCIINKITRNRCQYCRLQRCFAVGMSKESVRNDRS 165          
BLAST of Retinoic acid receptor beta vs. Ensembl Medaka
Match: RARB (retinoic acid receptor beta [Source:NCBI gene;Acc:101155959])

HSP 1 Score: 105.916 bits (263), Expect = 7.491e-24
Identity = 44/76 (57.89%), Postives = 55/76 (72.37%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRT 816
            C VCQDK++G HY V  CEGCKGFF+RS+Q    Y C  + NC+INK TRN CQ CR++RCF  GM +  VR+DR+
Sbjct:   87 CFVCQDKSSGYHYGVSACEGCKGFFRRSVQKNMVYTCHRDRNCIINKITRNRCQYCRLQRCFAVGMSKESVRNDRS 162          
BLAST of Retinoic acid receptor beta vs. Ensembl Medaka
Match: ENSORLT00000010680.2 (retinoic acid receptor beta [Source:NCBI gene;Acc:100125515])

HSP 1 Score: 106.301 bits (264), Expect = 1.023e-23
Identity = 44/79 (55.70%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  577 ILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            +   C VCQDK++G HY V  CEGCKGFF+RSIQ    Y C  + NC+INK TRN CQ CR+++CF  GM +  VR+DR
Sbjct:   89 VYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFAVGMSKESVRNDR 167          
BLAST of Retinoic acid receptor beta vs. Ensembl Medaka
Match: rargb (retinoic acid receptor gamma-A [Source:NCBI gene;Acc:100125516])

HSP 1 Score: 105.916 bits (263), Expect = 1.256e-23
Identity = 45/75 (60.00%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            C VCQDK++G HY V +CEGCKGFF+RSIQ    Y C  + NC INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   85 CFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDR 159          
BLAST of Retinoic acid receptor beta vs. Ensembl Medaka
Match: rargb (retinoic acid receptor gamma-A [Source:NCBI gene;Acc:100125516])

HSP 1 Score: 105.531 bits (262), Expect = 1.530e-23
Identity = 45/75 (60.00%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDR 813
            C VCQDK++G HY V +CEGCKGFF+RSIQ    Y C  + NC INK TRN CQ CR+++CFE GM +  VR+DR
Sbjct:   77 CFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDR 151          
BLAST of Retinoic acid receptor beta vs. Planmine SMEST
Match: SMESG000054304.1 (SMESG000054304.1)

HSP 1 Score: 1068.53 bits (2762), Expect = 0.000e+0
Identity = 563/565 (99.65%), Postives = 563/565 (99.65%), Query Frame = 1
Query:  325 PSEV-KIQISTLAYLICGLIHHCQFGYNTIAMISEYSMKQGSSTTDFGVEKLLMREKSEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNRXXXXXXXXXXXXXXXXXXXXXAQIYKSNILDLQTSIKQESQCIEEFKDLSLDGYSVLCKKRFKNLNSEHPKEIHTLDYENLCISSNHINNELLSGNLSSPNDIDDWEXXXXXXXXXXXXXXXXXQQMVSVYDQSRVTTDDGFSTLINCSSNSEMQTKDCKQEPKCLMHLLTKLIKAKPAEPAFCKYFLKYPNSEQILECLADEIHLIIKFAKKTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVGPQDIPNMEILSPRFYQTMVQLICSFKSLNIDIYELCLIQYVVIEDEEGDLELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQIDEASKLFMLDCVELIKANRLPISNEIMKELFSPYL 2016
            PSEV KIQISTLAYLICGLIHHCQFGYNTIAMISEYSMKQGS TTDFGVEKLLMREKSEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNRKKKFNESSSSSNKSIISLENKAQIYKSNILDLQTSIKQESQCIEEFKDLSLDGYSVLCKKRFKNLNSEHPKEIHTLDYENLCISSNHINNELLSGNLSSPNDIDDWELSLLSDVLVDNNSSDVVQQMVSVYDQSRVTTDDGFSTLINCSSNSEMQTKDCKQEPKCLMHLLTKLIKAKPAEPAFCKYFLKYPNSEQILECLADEIHLIIKFAKKTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVGPQDIPNMEILSPRFYQTMVQLICSFKSLNIDIYELCLIQYVVIEDEEGDLELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQIDEASKLFMLDCVELIKANRLPISNEIMKELFSPYL
Sbjct:  123 PSEVVKIQISTLAYLICGLIHHCQFGYNTIAMISEYSMKQGSLTTDFGVEKLLMREKSEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNRKKKFNESSSSSNKSIISLENKAQIYKSNILDLQTSIKQESQCIEEFKDLSLDGYSVLCKKRFKNLNSEHPKEIHTLDYENLCISSNHINNELLSGNLSSPNDIDDWELSLLSDVLVDNNSSDVVQQMVSVYDQSRVTTDDGFSTLINCSSNSEMQTKDCKQEPKCLMHLLTKLIKAKPAEPAFCKYFLKYPNSEQILECLADEIHLIIKFAKKTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVGPQDIPNMEILSPRFYQTMVQLICSFKSLNIDIYELCLIQYVVIEDEEGDLELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQIDEASKLFMLDCVELIKANRLPISNEIMKELFSPYL 687          
BLAST of Retinoic acid receptor beta vs. Planmine SMEST
Match: SMESG000054304.1 (SMESG000054304.1)

HSP 1 Score: 1009.21 bits (2608), Expect = 0.000e+0
Identity = 533/534 (99.81%), Postives = 533/534 (99.81%), Query Frame = 1
Query:  415 MISEYSMKQGSSTTDFGVEKLLMREKSEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNRXXXXXXXXXXXXXXXXXXXXXAQIYKSNILDLQTSIKQESQCIEEFKDLSLDGYSVLCKKRFKNLNSEHPKEIHTLDYENLCISSNHINNELLSGNLSSPNDIDDWEXXXXXXXXXXXXXXXXXQQMVSVYDQSRVTTDDGFSTLINCSSNSEMQTKDCKQEPKCLMHLLTKLIKAKPAEPAFCKYFLKYPNSEQILECLADEIHLIIKFAKKTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVGPQDIPNMEILSPRFYQTMVQLICSFKSLNIDIYELCLIQYVVIEDEEGDLELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQIDEASKLFMLDCVELIKANRLPISNEIMKELFSPYL 2016
            MISEYSMKQGS TTDFGVEKLLMREKSEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNRKKKFNESSSSSNKSIISLENKAQIYKSNILDLQTSIKQESQCIEEFKDLSLDGYSVLCKKRFKNLNSEHPKEIHTLDYENLCISSNHINNELLSGNLSSPNDIDDWELSLLSDVLVDNNSSDVVQQMVSVYDQSRVTTDDGFSTLINCSSNSEMQTKDCKQEPKCLMHLLTKLIKAKPAEPAFCKYFLKYPNSEQILECLADEIHLIIKFAKKTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVGPQDIPNMEILSPRFYQTMVQLICSFKSLNIDIYELCLIQYVVIEDEEGDLELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQIDEASKLFMLDCVELIKANRLPISNEIMKELFSPYL
Sbjct:    1 MISEYSMKQGSLTTDFGVEKLLMREKSEPEKCEVSTRRKPGRPPKIHPPGTINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNRKKKFNESSSSSNKSIISLENKAQIYKSNILDLQTSIKQESQCIEEFKDLSLDGYSVLCKKRFKNLNSEHPKEIHTLDYENLCISSNHINNELLSGNLSSPNDIDDWELSLLSDVLVDNNSSDVVQQMVSVYDQSRVTTDDGFSTLINCSSNSEMQTKDCKQEPKCLMHLLTKLIKAKPAEPAFCKYFLKYPNSEQILECLADEIHLIIKFAKKTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVGPQDIPNMEILSPRFYQTMVQLICSFKSLNIDIYELCLIQYVVIEDEEGDLELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQIDEASKLFMLDCVELIKANRLPISNEIMKELFSPYL 534          
BLAST of Retinoic acid receptor beta vs. Planmine SMEST
Match: SMESG000017244.1 (SMESG000017244.1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.514e-21
Identity = 40/79 (50.63%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGN 825
            C VC D +TG HY V++CEGCKGFFKRSI+    Y+CR +N C+I K  RN CQ CR+++C  +GM+ + V+++R   N
Sbjct:   72 CVVCGDYSTGRHYGVLSCEGCKGFFKRSIRNGSRYRCRGSNGCIITKAFRNRCQHCRLQKCLNEGMRMDWVQNERKMNN 150          
BLAST of Retinoic acid receptor beta vs. Planmine SMEST
Match: SMESG000019911.1 (SMESG000019911.1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.097e-20
Identity = 40/76 (52.63%), Postives = 52/76 (68.42%), Query Frame = 1
Query:  589 CAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRT 816
            CA+C D ATG HY V+ CEGCKGFFKR+I+ E  Y CR  N C I +  RN CQ+CR  +C ++GMK   V+ +R+
Sbjct:  176 CAICTDLATGKHYGVLACEGCKGFFKRTIRKELHYTCREKNMCPITERLRNRCQSCRFNKCLDQGMKIEAVQRERS 251          
BLAST of Retinoic acid receptor beta vs. Planmine SMEST
Match: SMESG000056421.1 (SMESG000056421.1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.525e-20
Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = 1
Query:  586 ECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNNCVINKETRNACQACRIRRCFEKGMKENLVRDDRTP 819
            EC VC DK++G HY   TCEGCK FFKRS++    Y CR N+NC I+   RN CQ CR ++C + GM++  V+  R P
Sbjct:  111 ECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIP 188          
The following BLAST results are available for this feature:
BLAST of Retinoic acid receptor beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RARA2.886e-2458.23retinoic acid receptor alpha [Source:HGNC Symbol;A... [more]
RARA2.886e-2458.23retinoic acid receptor alpha [Source:HGNC Symbol;A... [more]
RARB3.266e-2458.23retinoic acid receptor beta [Source:HGNC Symbol;Ac... [more]
RARA3.881e-2458.23retinoic acid receptor alpha [Source:HGNC Symbol;A... [more]
NR6A14.821e-2450.00nuclear receptor subfamily 6 group A member 1 [Sou... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhr-911.523e-2660.00Nuclear hormone receptor family member nhr-91 [So... [more]
nhr-911.523e-2660.00Nuclear hormone receptor family member nhr-91 [So... [more]
nhr-911.523e-2660.00Nuclear hormone receptor family member nhr-91 [So... [more]
nhr-885.017e-2248.24Nuclear Hormone Receptor family [Source:UniProtKB... [more]
nhr-885.017e-2248.24Nuclear Hormone Receptor family [Source:UniProtKB... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hr46.607e-2555.00gene:FBgn0264562 transcript:FBtr0333341[more]
Hr48.123e-2555.00gene:FBgn0264562 transcript:FBtr0333342[more]
Hr49.235e-2555.00gene:FBgn0264562 transcript:FBtr0333338[more]
Hr41.310e-2455.00gene:FBgn0264562 transcript:FBtr0333339[more]
Hr41.322e-2455.00gene:FBgn0264562 transcript:FBtr0333344[more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rargb8.363e-2460.00retinoic acid receptor, gamma b [Source:NCBI gene;... [more]
nr2c21.007e-2357.14nuclear receptor subfamily 2, group C, member 2 [S... [more]
rxrba1.196e-2344.57retinoid x receptor, beta a [Source:NCBI gene;Acc:... [more]
raraa1.405e-2356.96retinoic acid receptor, alpha a [Source:NCBI gene;... [more]
raraa1.892e-2356.96retinoic acid receptor, alpha a [Source:NCBI gene;... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RARB1.422e-2460.76retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
RARB1.432e-2460.76retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
RARB1.526e-2460.76retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
RARB1.554e-2460.76retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
RARB2.096e-2460.76retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rarg3.789e-2555.70retinoic acid receptor, gamma [Source:MGI Symbol;A... [more]
Rarb2.798e-2461.33retinoic acid receptor, beta [Source:MGI Symbol;Ac... [more]
Rarb3.940e-2461.33retinoic acid receptor, beta [Source:MGI Symbol;Ac... [more]
Nr6a14.135e-2450.00nuclear receptor subfamily 6, group A, member 1 [S... [more]
Rara4.919e-2456.96retinoic acid receptor, alpha [Source:MGI Symbol;A... [more]
back to top
BLAST of Retinoic acid receptor beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U2R6|NHR91_CAEEL1.938e-2560.00Nuclear hormone receptor family member nhr-91 OS=C... [more]
sp|P18515|RARB_NOTVI3.440e-2559.49Retinoic acid receptor beta (Fragment) OS=Notophth... [more]
sp|Q9W539|HR4_DROME6.623e-2455.00Hormone receptor 4 OS=Drosophila melanogaster OX=7... [more]
sp|P22448|RARB_CHICK9.918e-2458.23Retinoic acid receptor beta OS=Gallus gallus OX=90... [more]
sp|Q9W6B3|RARB_COTJA1.001e-2358.23Retinoic acid receptor beta OS=Coturnix japonica O... [more]
back to top
BLAST of Retinoic acid receptor beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6TL041.541e-2548.21Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A2B4SY177.591e-2548.21Estrogen-related receptor gamma OS=Stylophora pist... [more]
A7S8G83.262e-2461.25Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A261BEI73.495e-2461.25Uncharacterized protein (Fragment) OS=Caenorhabdit... [more]
A0A261CNG31.575e-2361.25Uncharacterized protein (Fragment) OS=Caenorhabdit... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rarga1.181e-2360.00retinoic acid receptor gamma-A [Source:NCBI gene;A... [more]
rarga1.537e-2356.96retinoic acid receptor gamma-A [Source:NCBI gene;A... [more]
RARB1.825e-2358.67retinoic acid receptor beta [Source:HGNC Symbol;Ac... [more]
rarga1.935e-2356.96retinoic acid receptor gamma-A [Source:NCBI gene;A... [more]
hnf4g3.055e-2350.62hepatocyte nuclear factor 4 gamma [Source:NCBI gen... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006803.18.722e-2256.72pep scaffold:Pmarinus_7.0:GL479639:153667:156574:-... [more]
nr1d2a2.273e-2148.96nuclear receptor subfamily 1, group D, member 2a [... [more]
RARA5.871e-2156.94retinoic acid receptor alpha [Source:HGNC Symbol;A... [more]
ESR21.071e-2057.53estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
ESR22.012e-2051.43estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399822.316e-2861.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429365.329e-2451.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464871.011e-2152.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270171.439e-2147.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421952.335e-2147.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RARB6.055e-2457.89retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
RARB7.491e-2457.89retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
ENSORLT00000010680.21.023e-2355.70retinoic acid receptor beta [Source:NCBI gene;Acc:... [more]
rargb1.256e-2360.00retinoic acid receptor gamma-A [Source:NCBI gene;A... [more]
rargb1.530e-2360.00retinoic acid receptor gamma-A [Source:NCBI gene;A... [more]
back to top
BLAST of Retinoic acid receptor beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054304.10.000e+099.65SMESG000054304.1[more]
SMESG000054304.10.000e+099.81SMESG000054304.1[more]
SMESG000017244.13.514e-2150.63SMESG000017244.1[more]
SMESG000019911.13.097e-2052.63SMESG000019911.1[more]
SMESG000056421.17.525e-2050.00SMESG000056421.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015041 ID=SMED30015041|Name=Retinoic acid receptor beta|organism=Schmidtea mediterranea sexual|type=transcript|length=2275bp
ATAGAATACAAAAGAAATCAAAATAAATAGTTCAATTTTAAAACAATAAA
ATCTATAAAAAAATTGAAATTTGTAAAAATCGAAACAATAAAAAAATGTC
ATCTTTCCCTTTAATGCTCGAAGCTTTAGTGCACTAAGAAAAAATATTTT
AACGCCAAAACGAGTGTCTAAAACATGTGCAGACTTAAATATAGACCTTG
TATAAGTAAATGTATGAGTATGCATTCTCTTTTGACCACCATTTGTGTGT
ATCTGTGCAGATTGCATTGTTCGTAAGTGATATGATGTGTGCATGTTTGT
GTGTATTGTGTAAAGTATGTGTGTCCCAGCGAAGTGAAGATTCAGATAAG
TACATTGGCTTATTTAATATGTGGATTAATTCATCATTGTCAATTTGGAT
ATAACACTATTGCAATGATCTCAGAATATTCTATGAAACAAGGATCATCA
ACAACAGATTTCGGAGTTGAGAAATTGTTGATGAGGGAAAAAAGTGAACC
GGAAAAATGTGAAGTATCGACTCGACGGAAACCTGGTAGACCACCAAAAA
TTCATCCACCTGGAACAATTAATGGAATTCTTGCTGAATGTGCAGTTTGT
CAGGACAAGGCAACTGGTTTACACTATTCGGTTATGACTTGCGAAGGCTG
CAAGGGATTTTTCAAAAGAAGTATACAAGCAGAGAAAGCCTACAAATGCA
GAAACAATAACAATTGTGTCATTAATAAAGAAACAAGAAACGCATGTCAA
GCTTGCCGAATTCGTCGATGTTTTGAAAAAGGAATGAAAGAGAATTTGGT
CCGAGACGACAGGACGCCTGGCAACAGGAAGAAGAAGTTCAACGAATCCT
CGTCATCATCAAATAAATCTATAATCTCATTGGAAAATAAAGCACAAATC
TATAAATCAAACATTTTAGACCTTCAAACGTCAATAAAACAAGAGAGTCA
ATGTATTGAAGAATTTAAAGATTTATCATTGGACGGGTACTCAGTTCTTT
GCAAAAAGCGTTTCAAAAACCTTAATTCTGAGCATCCTAAAGAGATTCAT
ACTTTAGATTATGAAAATCTCTGTATTTCTTCCAATCATATCAATAATGA
GCTTTTATCTGGAAATTTGTCGAGCCCAAACGACATTGATGATTGGGAAC
TTTCGCTCCTGTCTGATGTATTAGTTGACAATAATTCATCCGATGTAGTT
CAGCAAATGGTGTCCGTTTATGATCAGTCAAGAGTTACAACCGATGACGG
TTTTTCAACATTGATCAATTGCTCAAGCAACTCAGAAATGCAAACCAAAG
ATTGCAAACAAGAACCAAAATGCCTCATGCACCTTCTTACCAAACTCATA
AAAGCTAAACCAGCTGAACCAGCATTTTGTAAATATTTTTTGAAATATCC
TAATTCAGAACAGATTCTTGAATGTTTAGCTGACGAAATTCATTTAATTA
TTAAATTTGCAAAAAAGACACCAGGATTTTGTGAACGGGACATGAACCGC
AAACTTGGAATCATCCATAAATATTCACTCAATATTTTATTTATCAGAAT
GATATATAGAAGCTTCTCTTGCCATTCAAATTATATCCAAATAGCCAGTA
ATCTATGTGTTGGGCCACAAGACATTCCTAACATGGAGATTTTATCGCCA
AGGTTTTATCAGACAATGGTTCAGTTGATTTGCTCATTTAAATCTCTGAA
CATTGACATTTATGAACTGTGTTTGATACAATATGTAGTTATTGAAGATG
AAGAAGGAGATTTGGAATTGCATGACAATTCTCCATTCATTCAAGCTCTG
AATAATCAGAAAAGGAATATCTCTCAAAACTATCTAAAGATTTACACATC
TACGCAGTATCCTGACTTACCACAACGATGGATTTTGATCATGCTTTGTT
TATCTCAAATAGATGAAGCCTCAAAGCTATTTATGCTCGACTGCGTCGAA
TTAATCAAAGCCAATAGATTGCCTATATCAAATGAAATTATGAAAGAACT
CTTTTCTCCTTATCTCTAATGCTAAATTTATTCCCAATTTTTTGCCTCAA
CAGATGGTTTGTGTGTTTGCGTGTGTTTGCGCGTTTGTGTACCTTTTCGG
CTATTGGTCTGTTATCATATCACTGTTTATTGTTATTATTTATTGATATT
ATAATAATTGTTATTGTTAGGGCTGATGACGATCAAGTACATGTATGACT
GTGAGATCTACGCGCTGTAAGCAAATATATGTATGAAGTTTGCTACTGTT
CAAATGCTATTTATTATGACAGATC
back to top

protein sequence of SMED30015041-orf-1

>SMED30015041-orf-1 ID=SMED30015041-orf-1|Name=SMED30015041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=535bp
MISEYSMKQGSSTTDFGVEKLLMREKSEPEKCEVSTRRKPGRPPKIHPPG
TINGILAECAVCQDKATGLHYSVMTCEGCKGFFKRSIQAEKAYKCRNNNN
CVINKETRNACQACRIRRCFEKGMKENLVRDDRTPGNRKKKFNESSSSSN
KSIISLENKAQIYKSNILDLQTSIKQESQCIEEFKDLSLDGYSVLCKKRF
KNLNSEHPKEIHTLDYENLCISSNHINNELLSGNLSSPNDIDDWELSLLS
DVLVDNNSSDVVQQMVSVYDQSRVTTDDGFSTLINCSSNSEMQTKDCKQE
PKCLMHLLTKLIKAKPAEPAFCKYFLKYPNSEQILECLADEIHLIIKFAK
KTPGFCERDMNRKLGIIHKYSLNILFIRMIYRSFSCHSNYIQIASNLCVG
PQDIPNMEILSPRFYQTMVQLICSFKSLNIDIYELCLIQYVVIEDEEGDL
ELHDNSPFIQALNNQKRNISQNYLKIYTSTQYPDLPQRWILIMLCLSQID
EASKLFMLDCVELIKANRLPISNEIMKELFSPYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004879RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
GO:0003707steroid hormone receptor activity
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0003708retinoic acid receptor activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000428musculature system
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035500NHR-like_dom_sf
IPR001723Nuclear_hrmn_rcpt
IPR001628Znf_hrmn_rcpt
IPR013088Znf_NHR/GATA
IPR000536Nucl_hrmn_rcpt_lig-bd
Vocabulary: biological process
TermDefinition
GO:0043401steroid hormone mediated signaling pathway
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0048384retinoic acid receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001628Zinc finger, nuclear hormone receptor-typePRINTSPR00047STROIDFINGERcoord: 75..90
score: 60.05
coord: 116..124
score: 40.68
coord: 59..75
score: 50.74
coord: 108..116
score: 57.73
IPR001628Zinc finger, nuclear hormone receptor-typeSMARTSM00399c4goldcoord: 56..127
e-value: 3.5E-34
score: 129.6
IPR001628Zinc finger, nuclear hormone receptor-typePFAMPF00105zf-C4coord: 58..125
e-value: 4.9E-29
score: 100.6
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS00031NUCLEAR_REC_DBD_1coord: 59..85
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS51030NUCLEAR_REC_DBD_2coord: 56..131
score: 19.432
IPR001723Nuclear hormone receptorPRINTSPR00398STRDHORMONERcoord: 120..130
score: 37.21
coord: 428..443
score: 25.56
coord: 337..358
score: 29.76
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 53..161
e-value: 3.4E-32
score: 112.6
IPR000536Nuclear hormone receptor, ligand-binding domainPFAMPF00104Hormone_recepcoord: 327..506
e-value: 7.2E-8
score: 32.3
IPR000536Nuclear hormone receptor, ligand-binding domainPROSITEPS51843NR_LBDcoord: 303..532
score: 18.485
IPR035500Nuclear hormone receptor-like domain superfamilyGENE3DG3DSA:1.10.565.10coord: 302..532
e-value: 1.2E-19
score: 72.6
IPR035500Nuclear hormone receptor-like domain superfamilySUPERFAMILYSSF48508Nuclear receptor ligand-binding domaincoord: 129..507
NoneNo IPR availablePANTHERPTHR24084FAMILY NOT NAMEDcoord: 25..196
coord: 335..516
NoneNo IPR availableCDDcd06916NR_DBD_likecoord: 59..130
e-value: 1.02775E-38
score: 133.841
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 57..141