DNA_pol_B_2 domain-containing protein

Overview
NameDNA_pol_B_2 domain-containing protein
Smed IDSMED30015036
Length (bp)1543
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA_pol_B_2 domain-containing protein (SMED30015036) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA_pol_B_2 domain-containing protein (SMED30015036) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA_pol_B_2 domain-containing protein (SMED30015036) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA_pol_B_2 domain-containing protein (SMED30015036) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015036

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015036SMESG000029316.1 SmedASXL_066978SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30015036SMESG000029316.1 dd_Smed_v4_11531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015036SMESG000029316.1 dd_Smed_v6_11531_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015036SMESG000029316.1 dd_Smed_v4_11531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30015036SMESG000029316.1 dd_Smed_v4_11531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Celegans
Match: ZC53.4 (pep chromosome:WBcel235:X:1925750:1937689:1 gene:WBGene00022511.1 transcript:ZC53.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC53.4)

HSP 1 Score: 77.411 bits (189), Expect = 1.329e-14
Identity = 50/150 (33.33%), Postives = 81/150 (54.00%), Query Frame = 3
Query:    3 LESLSYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQK 452
            L+ L  GC  EVDLE   E+  +  D P+  E +K +   ++KL  T + ++ YVIH+  L   L LG+K+  ++R + FK+S    +YI+ NT  R  + N  +K++YKL+   V         +R++  L   E K+   ASKP F++
Sbjct: 1255 LKKLDRGCIFEVDLEYPKEIHSRHNDSPLCPENVKIDNHVIKKLCNTLFDREKYVIHYENLLQCLQLGLKLKKIHRIITFKESNWLASYIEMNTNPRKNAKNDFEKDFYKLMNNSVFGKTMENVRERVDVRLVTDEDKIKKLASKPNFKR 1404          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A4Y2PKA1 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_114505_1 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.697e-26
Identity = 65/143 (45.45%), Postives = 89/143 (62.24%), Query Frame = 3
Query:   21 GCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQ 449
            G  LEVDLE   EL D   D P+A EK  P+GSK EKLL T Y K NYV+H+++LK YL +G+K+  V+R + F+QS   K YID NTE+R K+TN  +K++YKL+   V         KR++   C + K+   Y +KP F+
Sbjct:  396 GYILEVDLEYPKELHDYHTDLPLAPEKKIPDGSKQEKLLTTLYDKTNYVVHYKILKQYLEMGLKLKKVHRILEFEQSDWLKKYIDLNTEMRKKATNEFEKDFYKLMNNSVFGKAIENVRKRIDIKFCTSYKQAKRYIAKPNFK 538          

HSP 2 Score: 37.7354 bits (86), Expect = 1.697e-26
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = 2
Query:  473 LNSDSISLDRPSYIGQSVFDLSKLRICELQY 565
            +N   I LD+P Y+G S+ DLSK  +C+  Y
Sbjct:  552 MNKTEIKLDKPIYVGMSILDLSKHLMCDFHY 582          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: K7JBR6 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.324e-22
Identity = 51/103 (49.51%), Postives = 68/103 (66.02%), Query Frame = 3
Query:   15 SYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKN 323
            S+G   EVDL+  SEL +   D P   E  KP GSK EKLL T +PK+NYVIH+  LK  LS G+++  ++R ++FKQSP  K+YID N+ LRA + N  +KN
Sbjct:  300 SHGYIFEVDLDYPSELHNAHNDLPFCPEHAKPPGSKQEKLLATLHPKRNYVIHYVALKQALSNGLQLRKIHRVLKFKQSPWLKSYIDLNSSLRALAKNEFEKN 402          

HSP 2 Score: 33.8834 bits (76), Expect = 1.324e-22
Identity = 13/36 (36.11%), Postives = 22/36 (61.11%), Query Frame = 2
Query:  473 LNSDSISLDRPSYIGQSVFDLSKLRICELQYRDLEK 580
            +N   I +D+P Y+G +V DLSK  + +  Y  ++K
Sbjct:  461 MNKTDICIDKPIYVGLTVLDLSKTHMYDFHYNYMQK 496          

HSP 3 Score: 22.3274 bits (46), Expect = 1.324e-22
Identity = 8/14 (57.14%), Postives = 13/14 (92.86%), Query Frame = 1
Query:  340 NNRLYGKTVENLKK 381
            NN ++GKT+EN++K
Sbjct:  408 NNAVFGKTMENVRK 421          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: K7JCV3 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.081e-22
Identity = 51/103 (49.51%), Postives = 68/103 (66.02%), Query Frame = 3
Query:   15 SYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKN 323
            S+G  LEVDL+  SEL +   D P   E  KP GSK EKLL   +PK+NYVIH+  LK  LS G+++  ++R ++FKQSP  K+YID N+ LRA + N  +KN
Sbjct:   87 SHGYILEVDLDYPSELHNAHNDLPFCPEYAKPPGSKQEKLLAALHPKRNYVIHYVALKQALSNGLQLRKIHRVLKFKQSPWLKSYIDLNSSLRALAKNEFEKN 189          

HSP 2 Score: 33.8834 bits (76), Expect = 3.081e-22
Identity = 13/36 (36.11%), Postives = 22/36 (61.11%), Query Frame = 2
Query:  473 LNSDSISLDRPSYIGQSVFDLSKLRICELQYRDLEK 580
            +N   I +D+P Y+G +V DLSK  + +  Y  ++K
Sbjct:  248 MNKTDICIDKPIYVGLTVLDLSKTHMYDFHYNYMQK 283          

HSP 3 Score: 22.3274 bits (46), Expect = 3.081e-22
Identity = 8/14 (57.14%), Postives = 13/14 (92.86%), Query Frame = 1
Query:  340 NNRLYGKTVENLKK 381
            NN ++GKT+EN++K
Sbjct:  195 NNAVFGKTMENVRK 208          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A3S4Q410 (Uncharacterized protein (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_01333 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.147e-22
Identity = 59/145 (40.69%), Postives = 86/145 (59.31%), Query Frame = 3
Query:   15 SYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQ 449
            +YG  L VDLE   EL D   D P+A EK+ P G+K EKLL     ++ Y IH+++LKLY+ LG+KVT + + ++FKQS   K+YID NT LRAK+TN  +K+++KL+   V          R N      E +++   SK  ++
Sbjct:  116 NYGFILMVDLEYPEELHDYHNDLPLAPEKILPPGNKTEKLLCHFGKRERYTIHYKILKLYMKLGIKVTRLYKILQFKQSAFMKSYIDMNTALRAKATNDFEKDFFKLMNNSVFGKTMENIRNRQNIFFESNENRILNRVSKFNYK 260          

HSP 2 Score: 30.8018 bits (68), Expect = 8.147e-22
Identity = 12/28 (42.86%), Postives = 18/28 (64.29%), Query Frame = 2
Query:  485 SISLDRPSYIGQSVFDLSKLRICELQYR 568
             I  D+P Y+G SV DLSK+ + +  Y+
Sbjct:  278 EIVFDKPIYVGFSVLDLSKILMYKFHYK 305          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: K7J8D7 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.035e-21
Identity = 50/103 (48.54%), Postives = 67/103 (65.05%), Query Frame = 3
Query:   15 SYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKN 323
            S+G  LEVDL+  SEL +   D P   E  KP GSK EKLL   +PK+NYVIH+  LK  LS G+++  ++R ++FKQSP  K+Y D N+ LRA + N  +KN
Sbjct:  698 SHGYILEVDLDYPSELHNAHNDLPFCPEHAKPPGSKQEKLLAALHPKRNYVIHYVALKQALSNGLQLRKIHRVLKFKQSPWLKSYTDLNSSLRALAKNEFEKN 800          

HSP 2 Score: 33.8834 bits (76), Expect = 1.035e-21
Identity = 13/36 (36.11%), Postives = 22/36 (61.11%), Query Frame = 2
Query:  473 LNSDSISLDRPSYIGQSVFDLSKLRICELQYRDLEK 580
            +N   I +D+P Y+G +V DLSK  + +  Y  ++K
Sbjct:  859 MNKTDICIDKPIYVGLTVLDLSKTHMYDFHYNYMQK 894          

HSP 3 Score: 22.3274 bits (46), Expect = 1.035e-21
Identity = 8/14 (57.14%), Postives = 13/14 (92.86%), Query Frame = 1
Query:  340 NNRLYGKTVENLKK 381
            NN ++GKT+EN++K
Sbjct:  806 NNAVFGKTMENVRK 819          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 85.8853 bits (211), Expect = 5.403e-18
Identity = 56/142 (39.44%), Postives = 80/142 (56.34%), Query Frame = 3
Query:   24 CTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQ 449
            C +EVD+     L D   D+P+A E +K   +KV KL+     K  YV+H   LKLY SLG+KVT V+R + F++S   K YID NT LRAK+TN  +K+++KL+   V          R++  L   EK+     SKP ++
Sbjct: 1258 CVVEVDMAYPRHLHDSHDDYPLAPESIKI--NKVGKLIPNLNDKTKYVVHHETLKLYESLGLKVTKVHRGITFEESGWLKTYIDLNTSLRAKATNDFEKDFFKLMNNSVFGKTMENIRNRVDIRLITNEKQARKLISKPNYK 1397          

HSP 2 Score: 23.0978 bits (48), Expect = 5.403e-18
Identity = 8/24 (33.33%), Postives = 14/24 (58.33%), Query Frame = 2
Query:  494 LDRPSYIGQSVFDLSKLRICELQY 565
             ++P Y+G  + DLSK  + +  Y
Sbjct: 1418 FNKPVYLGMCILDLSKNLMYDFHY 1441          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000029316.1 (SMESG000029316.1)

HSP 1 Score: 284.263 bits (726), Expect = 1.318e-94
Identity = 138/140 (98.57%), Postives = 139/140 (99.29%), Query Frame = 2
Query: 1055 MFQSFIFIHSTEKYQTCKIFKPSEKPNYEIVVTNQLIDQWICRYMGRVTNGKFIDRIGHYNIKARIAFHSASIVSFSILRNYIPIAKCIRLSTKKLKNAEFGSCDMETIKVIKPSDRITIQANEVDRSYAIITDEKYSQL 1474
            MFQSFIFIHSTEKYQTCKIFKPSEK NYEIVVTNQLIDQWICRYMGRVTNGKFIDRIGHYNIKARIAFHSASIVSFSILRNYIPIAKCIRLSTKKLK+AEFGSCDMETIKVIKPSDRITIQANEVDRSYAIITDEKYSQL
Sbjct:    1 MFQSFIFIHSTEKYQTCKIFKPSEKLNYEIVVTNQLIDQWICRYMGRVTNGKFIDRIGHYNIKARIAFHSASIVSFSILRNYIPIAKCIRLSTKKLKHAEFGSCDMETIKVIKPSDRITIQANEVDRSYAIITDEKYSQL 140          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000076702.1 (SMESG000076702.1)

HSP 1 Score: 219.55 bits (558), Expect = 4.555e-74
Identity = 119/154 (77.27%), Postives = 127/154 (82.47%), Query Frame = 3
Query:    3 LESLSYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQKISKV 464
            LESLSYG TLEV+LEI S+L DKL DFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGV+VTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNYY                K +N +L   EKK+ITYASKPTFQ+  K+
Sbjct:  837 LESLSYGYTLEVNLEIPSDLHDKLDDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVEVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNYY----------------KLLNNSL--YEKKMITYASKPTFQRSIKI 972          

HSP 2 Score: 78.5666 bits (192), Expect = 4.555e-74
Identity = 42/62 (67.74%), Postives = 48/62 (77.42%), Query Frame = 2
Query:  464 ADLLNSDSISLDRPSYIGQSVFDLSKLRICELQYRDLEKYRTKFNC*LK*VIKFT-SFYLPI 646
            A LLN DS+ LDRPSYIGQSV DLSKLR+ ELQY+DLEKYR +FNC +  V   T SF+L I
Sbjct:  978 AALLNPDSVCLDRPSYIGQSVLDLSKLRMYELQYKDLEKYRRQFNCEINIVAGDTDSFFLEI 1039          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000072420.1 (SMESG000072420.1)

HSP 1 Score: 215.698 bits (548), Expect = 4.189e-73
Identity = 118/154 (76.62%), Postives = 126/154 (81.82%), Query Frame = 3
Query:    3 LESLSYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQKISKV 464
            LESLSYG TLEVDLEI SEL  KL DFPIAAEKMKPEGSKVEKLLLTHYPK NYVIHWRLLKLY+SLGVKVTHVNR VRFKQS IFK YID NTELRAKSTNTLDKNYYKLL   +        +KRMN  LC  +KK++TY SKPTF+K  K+
Sbjct: 2544 LESLSYGYTLEVDLEIPSELHVKLDDFPIAAEKMKPEGSKVEKLLLTHYPKYNYVIHWRLLKLYMSLGVKVTHVNRGVRFKQSNIFKKYIDINTELRAKSTNTLDKNYYKLLNNSLYGKTVENLKKRMNLRLCTTDKKLVTYTSKPTFKKSIKI 2697          

HSP 2 Score: 79.337 bits (194), Expect = 4.189e-73
Identity = 43/62 (69.35%), Postives = 48/62 (77.42%), Query Frame = 2
Query:  464 ADLLNSDSISLDRPSYIGQSVFDLSKLRICELQYRDLEKYRTKFNC*LK*VIKFT-SFYLPI 646
            A LLN DSI LDRPSYIGQSV DLSKLR+ ELQY+DLEKYR +FNC +  V   T SF+L I
Sbjct: 2703 AALLNPDSICLDRPSYIGQSVLDLSKLRMYELQYKDLEKYRQQFNCEINIVAGDTDSFFLEI 2764          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000069427.1 (SMESG000069427.1)

HSP 1 Score: 216.083 bits (549), Expect = 4.707e-73
Identity = 118/154 (76.62%), Postives = 126/154 (81.82%), Query Frame = 3
Query:    3 LESLSYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQKISKV 464
            LESLSYG TLEVDLEI SEL  KL DFPIAAEKMKPEGSKVEKLLLTHYPK NYVIHWRLLKLY+SLGVKVTHVNR VRFKQS IFK YID NTELRAKSTNTLDKNYYKLL   +        +KRMN  LC  +KK++TY SKPTF+K  K+
Sbjct: 2263 LESLSYGYTLEVDLEIPSELHVKLDDFPIAAEKMKPEGSKVEKLLLTHYPKYNYVIHWRLLKLYMSLGVKVTHVNRGVRFKQSNIFKKYIDINTELRAKSTNTLDKNYYKLLNNSLYGKTVENLKKRMNLRLCTTDKKLVTYTSKPTFKKSIKI 2416          

HSP 2 Score: 78.9518 bits (193), Expect = 4.707e-73
Identity = 43/62 (69.35%), Postives = 48/62 (77.42%), Query Frame = 2
Query:  464 ADLLNSDSISLDRPSYIGQSVFDLSKLRICELQYRDLEKYRTKFNC*LK*VIKFT-SFYLPI 646
            A LLN DSI LDRPSYIGQSV DLSKLR+ ELQY+DLEKYR +FNC +  V   T SF+L I
Sbjct: 2422 AVLLNPDSICLDRPSYIGQSVLDLSKLRMYELQYKDLEKYRQQFNCEINIVAGDTDSFFLEI 2483          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000006691.1 (SMESG000006691.1)

HSP 1 Score: 215.312 bits (547), Expect = 1.428e-71
Identity = 117/154 (75.97%), Postives = 125/154 (81.17%), Query Frame = 3
Query:    3 LESLSYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKSTNTLDKNXXXXXXXXVIR*NR*KPEKRMNKTLCKAEKKVITYASKPTFQKISKV 464
            LESLSYG TLEVDLEI SEL  KL DFPIAAEKMKPEGSKVEKLLLTHYPK NYVIHWRLLKLY+SLGVKVTHVNR VRFKQS IFK YID NTE RAKSTNTLDKNYYKLL   +        +KRMN  LC  +KK++TY SKPTF+K  K+
Sbjct: 1417 LESLSYGYTLEVDLEIPSELHVKLDDFPIAAEKMKPEGSKVEKLLLTHYPKYNYVIHWRLLKLYMSLGVKVTHVNRGVRFKQSNIFKKYIDINTEFRAKSTNTLDKNYYKLLINSLYGKTVENLKKRMNLRLCTTDKKLVTYTSKPTFKKSIKI 1570          

HSP 2 Score: 74.7146 bits (182), Expect = 1.428e-71
Identity = 43/62 (69.35%), Postives = 48/62 (77.42%), Query Frame = 2
Query:  464 ADLLNSDSISLDRPSYIGQSVFDLSKLRICELQYRDLEKYRTKFNC*LK*VIKFT-SFYLPI 646
            A LLN DSI LDRPSYIGQSV DLSKLR+ ELQY+DLEKYR +FNC +  V   T SF+L I
Sbjct: 1576 AVLLNPDSICLDRPSYIGQSVLDLSKLRMYELQYKDLEKYR-QFNCEINIVAGDTDSFFLEI 1636          
The following BLAST results are available for this feature:
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZC53.41.329e-1433.33pep chromosome:WBcel235:X:1925750:1937689:1 gene:W... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2PKA11.697e-2645.45Uncharacterized protein OS=Araneus ventricosus OX=... [more]
K7JBR61.324e-2249.51Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
K7JCV33.081e-2249.51Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
A0A3S4Q4108.147e-2240.69Uncharacterized protein (Fragment) OS=Dinothrombiu... [more]
K7J8D71.035e-2148.54Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO461095.403e-1839.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029316.11.318e-9498.57SMESG000029316.1[more]
SMESG000076702.14.555e-7477.27SMESG000076702.1[more]
SMESG000072420.14.189e-7376.62SMESG000072420.1[more]
SMESG000069427.14.707e-7376.62SMESG000069427.1[more]
SMESG000006691.11.428e-7175.97SMESG000006691.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015036 ID=SMED30015036|Name=DNA_pol_B_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1543bp
ATCTTGAATCTTTGTCATATGGGTGTACTTTAGAAGTTGATCTTGAGATT
TCTTCTGAACTTGATGATAAGTTAGGTGACTTTCCTATTGCTGCTGAGAA
AATGAAACCTGAGGGATCTAAGGTTGAAAAATTGTTATTGACTCATTACC
CAAAAAAGAATTATGTGATTCATTGGCGTTTACTAAAATTATACTTGTCT
CTTGGTGTTAAGGTTACTCATGTGAATCGAGCTGTAAGATTCAAACAGTC
TCCTATTTTTAAAAACTACATTGATACCAATACAGAGTTAAGAGCAAAAA
GTACAAACACGCTAGATAAAAATTATTATAAGCTCCTAAAATAATAGGTT
ATACGGTAAAACCGTTGAAAACCTGAAAAAAGAATGAATAAAACATTATG
TAAAGCCGAAAAAAAGGTGATTACATATGCTTCCAAACCAACATTTCAAA
AGATATCAAAAGTGCCGATTTATTAAATAGTGACTCGATAAGTTTAGATA
GACCTAGTTATATTGGTCAATCGGTCTTCGATTTATCTAAATTAAGAATA
TGTGAGCTTCAGTATAGGGACCTGGAAAAATATCGTACAAAGTTTAATTG
CTAACTTAAGTGAGTTATAAAGTTCACATCCTTCTATTTACCTATAATCT
CTAATTACAATTAAGAAAACCTGTGTGTTATGTAAAATAAAAAACACTTA
CACAAAATTTATTGATCAAGATCAATAATTGTTTTCTATAAAATATCAGC
CTAAAGAAATTTTGATTTTATTTATTTACAAATTAAGTTTGGTTTCAAAA
CAAACAAATAATTCATAAAATAAAATTGCTGTAATTTTTAAAGTTTATTT
CTGTTTAAAAAATGTTAGAATTTTTAGAATATCCGTGTGAGAAAAAAATT
GAAAAATTTTGTAATACAATTTAAAATTTCAACAAATGAAAACACATCCG
AAAACAATTGACTAGGCCTACTGATGACTATATCACTAGTCTGTTAGCAA
ATTTTCATAATTTGATCAAGTCAATTTCTGATGAGTTACTTACTGATACT
ACTGATGTTTCAATCATTTATTTTCATCCATTCAACAGAAAAATATCAAA
CTTGCAAAATCTTTAAACCCAGCGAAAAACCAAATTACGAGATTGTAGTG
ACCAATCAGCTGATAGATCAATGGATTTGTCGGTATATGGGAAGAGTGAC
CAATGGAAAATTCATCGATCGTATTGGACACTACAATATCAAAGCGCGAA
TCGCCTTTCATTCGGCGTCTATCGTGAGTTTTTCGATTCTAAGAAATTAT
ATTCCAATTGCAAAATGTATTCGACTATCGACAAAGAAACTTAAAAATGC
TGAATTTGGAAGTTGCGACATGGAAACTATTAAAGTGATAAAGCCATCTG
ATAGAATTACCATACAAGCAAATGAGGTAGATCGTTCGTATGCAATTATT
ACAGATGAAAAATACTCACAACTTATATTAATACGCATCCCATGAATTAT
TTTTATATCAAATTTTCAAAAAAAATATAGGCAGATCGGAAGA
back to top

protein sequence of SMED30015036-orf-1

>SMED30015036-orf-1 ID=SMED30015036-orf-1|Name=SMED30015036-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
LESLSYGCTLEVDLEISSELDDKLGDFPIAAEKMKPEGSKVEKLLLTHYP
KKNYVIHWRLLKLYLSLGVKVTHVNRAVRFKQSPIFKNYIDTNTELRAKS
TNTLDKNYYKLLK*
back to top

protein sequence of SMED30015036-orf-2

>SMED30015036-orf-2 ID=SMED30015036-orf-2|Name=SMED30015036-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MSYLLILLMFQSFIFIHSTEKYQTCKIFKPSEKPNYEIVVTNQLIDQWIC
RYMGRVTNGKFIDRIGHYNIKARIAFHSASIVSFSILRNYIPIAKCIRLS
TKKLKNAEFGSCDMETIKVIKPSDRITIQANEVDRSYAIITDEKYSQLIL
IRIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003887DNA-directed DNA polymerase activity
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0071897DNA biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell