Mitochondrial ribonuclease P protein 3

Overview
NameMitochondrial ribonuclease P protein 3
Smed IDSMED30015034
Length (bp)2156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial ribonuclease P protein 3 (SMED30015034) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial ribonuclease P protein 3 (SMED30015034) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial ribonuclease P protein 3 (SMED30015034) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial ribonuclease P protein 3 (SMED30015034) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015034

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015034SMESG000023790.1 SMESG000022512.1 SmedASXL_015274SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30015034SMESG000023790.1 SMESG000022512.1 dd_Smed_v4_9514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015034SMESG000023790.1 SMESG000022512.1 Contig51545newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015034SMESG000023790.1 SMESG000022512.1 Contig51545uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30015034SMESG000023790.1 SMESG000022512.1 dd_Smed_v4_9514_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Human
Match: PRORP (protein only RNase P catalytic subunit [Source:HGNC Symbol;Acc:HGNC:19958])

HSP 1 Score: 80.1073 bits (196), Expect = 4.725e-15
Identity = 85/322 (26.40%), Postives = 133/322 (41.30%), Query Frame = 3
Query:  699 IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTT-DGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIR-----NASILTLTSSDNLVKR-FKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAA---HIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            IK +N +  L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E + +S +    +   +M +V  +D  ++ Y+   P E+KRF +F  S   PFD VID  N  +       S L L     L KR  ++L      L R  ++ +   +  D             E++  A  FF  + +  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +          +   P +       + YD +  T    WH+PY +    +        W CL  K
Sbjct:  197 IKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDV--IDGGDQ-YRKTTPQELKRFENFIKS-RPPFDVVIDGLNVAKMFPKVRESQLLLNVVSQLAKRNLRLLV-----LGRKHMLRRSSQWSRDEM----------EEVQKQASCFF--ADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAI----------VNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQK 487          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Human
Match: AL121594.1 (novel transcript)

HSP 1 Score: 79.7221 bits (195), Expect = 7.289e-15
Identity = 88/323 (27.24%), Postives = 137/323 (42.41%), Query Frame = 3
Query:  699 IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTT-DGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKR-FKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQ--IVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            IK +N +  L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E + +S +    +   +M +V  +D  ++ Y+   P E+KRF +F  S   PFD VID       FP  +R + +L L     L KR  ++L      L R  ++ +   +  D             E++  A  FF  + +  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q  IV +    +L +            + YD +  T    WH+PY +    +        W CL  K
Sbjct:  292 IKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDV--IDGGDQ-YRKTTPQELKRFENFIKS-RPPFDVVIDGLNVAKMFPK-VRESQLL-LNVVSQLAKRNLRLLV-----LGRKHMLRRSSQWSRDEM----------EEVQKQASCFF--ADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTF---------QRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQK 582          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Human
Match: PRORP (protein only RNase P catalytic subunit [Source:HGNC Symbol;Acc:HGNC:19958])

HSP 1 Score: 79.7221 bits (195), Expect = 7.289e-15
Identity = 88/323 (27.24%), Postives = 137/323 (42.41%), Query Frame = 3
Query:  699 IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTT-DGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKR-FKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQ--IVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            IK +N +  L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E + +S +    +   +M +V  +D  ++ Y+   P E+KRF +F  S   PFD VID       FP  +R + +L L     L KR  ++L      L R  ++ +   +  D             E++  A  FF  + +  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q  IV +    +L +            + YD +  T    WH+PY +    +        W CL  K
Sbjct:  292 IKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDV--IDGGDQ-YRKTTPQELKRFENFIKS-RPPFDVVIDGLNVAKMFPK-VRESQLL-LNVVSQLAKRNLRLLV-----LGRKHMLRRSSQWSRDEM----------EEVQKQASCFF--ADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTF---------QRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQK 582          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Human
Match: PRORP (protein only RNase P catalytic subunit [Source:HGNC Symbol;Acc:HGNC:19958])

HSP 1 Score: 74.3294 bits (181), Expect = 3.443e-13
Identity = 85/320 (26.56%), Postives = 132/320 (41.25%), Query Frame = 3
Query:  699 IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKR-FKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQ--IVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            IK +N +  L +IL  LRNN LY   +  + I+  F++               C  CG  +E + +S +    +   +M +V  +D  ++ Y+   P E+KRF +F  S   PFD VID       FP  +R + +L L     L KR  ++L      L R  ++ +   +  D             E++  A  FF  + +  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q  IV +    +L +            + YD +  T    WH+PY +    +        W CL  K
Sbjct:  292 IKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESGQ-------------CSGCGKTIESIQLSPEEYECLKGKIMRDV--IDGGDQ-YRKTTPQELKRFENFIKS-RPPFDVVIDGLNVAKMFPK-VRESQLL-LNVVSQLAKRNLRLLV-----LGRKHMLRRSSQWSRDEM----------EEVQKQASCFF--ADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTF---------QRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQK 566          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Human
Match: PRORP (protein only RNase P catalytic subunit [Source:HGNC Symbol;Acc:HGNC:19958])

HSP 1 Score: 74.3294 bits (181), Expect = 3.443e-13
Identity = 85/320 (26.56%), Postives = 132/320 (41.25%), Query Frame = 3
Query:  699 IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKR-FKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQ--IVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            IK +N +  L +IL  LRNN LY   +  + I+  F++               C  CG  +E + +S +    +   +M +V  +D  ++ Y+   P E+KRF +F  S   PFD VID       FP  +R + +L L     L KR  ++L      L R  ++ +   +  D             E++  A  FF  + +  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q  IV +    +L +            + YD +  T    WH+PY +    +        W CL  K
Sbjct:  292 IKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESGQ-------------CSGCGKTIESIQLSPEEYECLKGKIMRDV--IDGGDQ-YRKTTPQELKRFENFIKS-RPPFDVVIDGLNVAKMFPK-VRESQLL-LNVVSQLAKRNLRLLV-----LGRKHMLRRSSQWSRDEM----------EEVQKQASCFF--ADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTF---------QRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQK 566          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Fly
Match: mldr (gene:FBgn0029858 transcript:FBtr0070898)

HSP 1 Score: 69.3218 bits (168), Expect = 6.790e-12
Identity = 65/258 (25.19%), Postives = 110/258 (42.64%), Query Frame = 3
Query:  858 CKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQ-KPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQ--IVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMI--NWACLKMK 1616
            C+SC  +L+ V IS +   ++++  +E V+    +   +Q   P E+ RF  F    + P+DCVID  N     S  T  +   L K    + +  +   KR+ ++G+   ++ + +    KQ +  +    NA  F   + N   DD  +LY  L+SG +    S D  R H   +   +L   F +WQ   Q  +V +    ++      V       +    +  TWHVPY     P       +  NW C++MK
Sbjct:  294 CQSCQQHLQPVAISDEEFRQLSECFLERVLIRRDV---FQRSTPEEVARFKKFVEKTA-PYDCVIDGLNVA--YSTGTKKTPQQLAKLVATVVRHFREQDKRVLVLGR--EHMRNWS----KQAMHYVHC--NASLFL--TSNLSHDDPFLLYATLRSGQETDFFSRDLMRSHAFHL-GTELKPIFRRWQQEHQFSLVTQTQTGQII-----VKEPVRHRLCAHQVADTWHVPYCAQYTPHPTDSFEVPANWLCIQMK 529          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Fly
Match: mldr (gene:FBgn0029858 transcript:FBtr0305494)

HSP 1 Score: 69.3218 bits (168), Expect = 6.790e-12
Identity = 65/258 (25.19%), Postives = 110/258 (42.64%), Query Frame = 3
Query:  858 CKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQ-KPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQ--IVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMI--NWACLKMK 1616
            C+SC  +L+ V IS +   ++++  +E V+    +   +Q   P E+ RF  F    + P+DCVID  N     S  T  +   L K    + +  +   KR+ ++G+   ++ + +    KQ +  +    NA  F   + N   DD  +LY  L+SG +    S D  R H   +   +L   F +WQ   Q  +V +    ++      V       +    +  TWHVPY     P       +  NW C++MK
Sbjct:  294 CQSCQQHLQPVAISDEEFRQLSECFLERVLIRRDV---FQRSTPEEVARFKKFVEKTA-PYDCVIDGLNVA--YSTGTKKTPQQLAKLVATVVRHFREQDKRVLVLGR--EHMRNWS----KQAMHYVHC--NASLFL--TSNLSHDDPFLLYATLRSGQETDFFSRDLMRSHAFHL-GTELKPIFRRWQQEHQFSLVTQTQTGQII-----VKEPVRHRLCAHQVADTWHVPYCAQYTPHPTDSFEVPANWLCIQMK 529          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Zebrafish
Match: prorp (protein only RNase P catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-100618-4])

HSP 1 Score: 72.4034 bits (176), Expect = 1.049e-12
Identity = 85/342 (24.85%), Postives = 145/342 (42.40%), Query Frame = 3
Query:  627 KYVNELLQLSEQWLEDVEKSIFEK-IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNT-TDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGG----SYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAA---HIAIQYDGI----KGTWHVPYVDSENPKLFQHGMINWACL 1607
            K  +ELL+L     +D  + +F+  I        L ++L  +R+N +Y +   +  I+  F++     +R  F++ T    C++C + LE + ++     ++   +ME V+    +   +   +P E+K F SF      PFD VID  N  +   +     S+ L+     L +Q  +   I ++G+      S   DR  +S+        +K  A  FF  +++  +DD  +LY AL SG  C   S D  RDHKA + +      F KWQ   Q+V+           ++ P         + YD I      +WH+PY      +        W CL
Sbjct:  263 KLYDELLELGLVPGQDTWQCLFQSGITQRGHEDKLFDVLSYMRDNQIYPEKPLMETIKAWFESLPDQKWRGKFSSVTPSGDCRNCKALLESIQLTEVEYAQLKHNVMEKVIEGGDV---FNKSNPEELKSFKSFVKQ-RPPFDIVIDGLNVAK--MLPHAAQSETLLAVVSELEQQSLN---ILVLGRKHMLRHSRNWDRQNMSL--------IKQKAHCFF--TEDISEDDPYLLYAALNSGVHCKFLSRDLMRDHKACLPDSATRCLFFKWQRGHQLVIS----------HYTPGKRVRFERILSYDTIIQTNGSSWHIPYDQKAEDRASYEVPQKWLCL 575          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Xenopus
Match: c1orf21 (chromosome 1 open reading frame 21 [Source:Xenbase;Acc:XB-GENE-5830151])

HSP 1 Score: 65.855 bits (159), Expect = 1.537e-10
Identity = 85/348 (24.43%), Postives = 143/348 (41.09%), Query Frame = 3
Query:  636 NELLQLSEQWLEDVEKSIFEK-IKFENSTFI--LENILETLRNNDLYLQINSLNLIEQQFKNTA--GFRLNFNT-TDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQ----YDGIKG----TWHVPY----VDS---ENPKLFQHGMINWACLKMK 1616
            NE+L+      ED  +S+F      ++ TF   L  + +  R++ +Y     +  I+  F++     +R + +T ++   C+ C   LE +++  +    + D  +++V+        ++   P E++ F  F  S   P+D V+D  N    A I T       +    I+       KR+ ++G+       RT       L    L+  A  FF    N  +DD  +LY +L SG  C   + D  RDHK+ + +      F KWQ   Q+V+       FY+         + +Q    YD I      +WH+PY    VD    E PK        W CL+ K
Sbjct:  268 NEMLEADLTPCEDAIQSLFNADPALQDETFRNKLFGVFDYFRDHQIYPGEPLMQSIKSWFESIPNESWRGHLSTVSENGHCQVCKQQLESIHLMPEEYRTLKDVFLQSVIEGHDT---FRKTTPQELQEFRQFVRS-HPPYDIVVDGLNV---AYITTKGRGSQTL--LDIVSGLCSGGKRVLVLGRKHMLQESRTWQRRHMQL----LQQRADCFFI--DNISEDDPFLLYASLNSGSHCCFLTRDLMRDHKSCLPDAQTKRLFFKWQRGHQLVLP------FYT-----PGRKVLLQPIMCYDTIVQRTDFSWHIPYDKMGVDRASFEVPK-------TWLCLQKK 582          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Mouse
Match: Prorp (protein only RNase P catalytic subunit [Source:MGI Symbol;Acc:MGI:1913382])

HSP 1 Score: 84.7297 bits (208), Expect = 1.323e-16
Identity = 86/312 (27.56%), Postives = 136/312 (43.59%), Query Frame = 3
Query:  726 LENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTTD-GLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQI-VMKCDQKELFYSLYHVPNAAHIAIQYDGI----KGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E +++S +    + + +M +V  +D  ++ Y+   P E+KRF SF NSC  PFD VID       FP    + ++L + S         ++  +K  L+            S      ++Q+ K       A  FF  + N  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +MK  QK    +  H+       + YD +      +WH+PY +    +        W CL+ K
Sbjct:  298 LLDILLYLRNNQLYPGESFAHSIKTWFESIPGRQWKGQFTTIQKSGQCSGCGRTIEPIHLSPEEYEFLKEKIMRDV--IDGGDQ-YKKTTPQELKRFESFVNSCP-PFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLRP----------SSQWRKEEMEQVRK------QAHCFF--ADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQQGHQLAIMKGFQKSKL-TFQHI-------LSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLCLQRK 579          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Mouse
Match: Prorp (protein only RNase P catalytic subunit [Source:MGI Symbol;Acc:MGI:1913382])

HSP 1 Score: 84.7297 bits (208), Expect = 1.323e-16
Identity = 86/312 (27.56%), Postives = 136/312 (43.59%), Query Frame = 3
Query:  726 LENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTTD-GLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQI-VMKCDQKELFYSLYHVPNAAHIAIQYDGI----KGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E +++S +    + + +M +V  +D  ++ Y+   P E+KRF SF NSC  PFD VID       FP    + ++L + S         ++  +K  L+            S      ++Q+ K       A  FF  + N  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +MK  QK    +  H+       + YD +      +WH+PY +    +        W CL+ K
Sbjct:  298 LLDILLYLRNNQLYPGESFAHSIKTWFESIPGRQWKGQFTTIQKSGQCSGCGRTIEPIHLSPEEYEFLKEKIMRDV--IDGGDQ-YKKTTPQELKRFESFVNSCP-PFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLRP----------SSQWRKEEMEQVRK------QAHCFF--ADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQQGHQLAIMKGFQKSKL-TFQHI-------LSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLCLQRK 579          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Mouse
Match: Prorp (protein only RNase P catalytic subunit [Source:MGI Symbol;Acc:MGI:1913382])

HSP 1 Score: 80.1073 bits (196), Expect = 4.513e-15
Identity = 83/309 (26.86%), Postives = 131/309 (42.39%), Query Frame = 3
Query:  726 LENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQI-VMKCDQKELFYSLYHVPNAAHIAIQYDGI----KGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            L +IL  LRNN LY   +  + I+  F++               C  CG  +E +++S +    + + +M +V  +D  ++ Y+   P E+KRF SF NSC  PFD VID       FP    + ++L + S         ++  +K  L+            S      ++Q+ K       A  FF  + N  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +MK  QK    +  H+       + YD +      +WH+PY +    +        W CL+ K
Sbjct:  298 LLDILLYLRNNQLYPGESFAHSIKTWFESGQ-------------CSGCGRTIEPIHLSPEEYEFLKEKIMRDV--IDGGDQ-YKKTTPQELKRFESFVNSCP-PFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLRP----------SSQWRKEEMEQVRK------QAHCFF--ADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQQGHQLAIMKGFQKSKL-TFQHI-------LSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLCLQRK 563          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Mouse
Match: Prorp (protein only RNase P catalytic subunit [Source:MGI Symbol;Acc:MGI:1913382])

HSP 1 Score: 75.0998 bits (183), Expect = 2.353e-14
Identity = 72/265 (27.17%), Postives = 114/265 (43.02%), Query Frame = 3
Query:  858 CKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQI-VMKCDQKELFYSLYHVPNAAHIAIQYDGI----KGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            C  CG  +E +++S +    + + +M +V  +D  ++ Y+   P E+KRF SF NSC  PFD VID       FP    + ++L + S         ++  +K  L+            S      ++Q+ K       A  FF  + N  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +MK  QK    +  H+       + YD +      +WH+PY +    +        W CL+ K
Sbjct:   32 CSGCGRTIEPIHLSPEEYEFLKEKIMRDV--IDGGDQ-YKKTTPQELKRFESFVNSCP-PFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLRP----------SSQWRKEEMEQVRK------QAHCFF--ADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQQGHQLAIMKGFQKSKL-TFQHI-------LSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLCLQRK 266          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Mouse
Match: Prorp (protein only RNase P catalytic subunit [Source:MGI Symbol;Acc:MGI:1913382])

HSP 1 Score: 63.929 bits (154), Expect = 5.785e-11
Identity = 64/223 (28.70%), Postives = 94/223 (42.15%), Query Frame = 3
Query:  972 YQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQI-VMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            Y+   P E+KRF SF NSC  PFD VID       FP    + ++L + S         ++  +K  L+            S      ++Q+ K       A  FF  + N  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +MK  QK    +  H+  +    +Q  G   +WH+PY +    +        W CL+ K
Sbjct:   11 YKKTTPQELKRFESFVNSCP-PFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLR----------PSSQWRKEEMEQVRK------QAHCFF--ADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQQGHQLAIMKGFQKSKL-TFQHI-LSYDTVVQRTG--DSWHIPYDEDLVQRSSCEVPTKWLCLQRK 210          
BLAST of Mitochondrial ribonuclease P protein 3 vs. UniProt/SwissProt
Match: sp|Q4R366|MRPP3_MACFA (Mitochondrial ribonuclease P catalytic subunit OS=Macaca fascicularis OX=9541 GN=PRORP PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.857e-16
Identity = 86/320 (26.88%), Postives = 134/320 (41.88%), Query Frame = 3
Query:  699 IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTTD-GLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            IK +N +  L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E + +S +    +   +M +V  +D  ++ Y+   P E+KRF +F  SC  PFD VID       FP   R + +L    S    +  ++L      L R  ++ +   +  D             E++  A  FF  + N  KDD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +         +  H+       + YD +  T    WH+PY +    +        W CL  K
Sbjct:  290 IKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVQKSGQCLGCGKTIESIQLSPEEYEFLKGRIMRDV--IDGGDQ-YKKTTPQELKRFENFVKSCP-PFDIVIDGLNVAKMFPK-ARESQVLLNVVSQLAKQNLRLLV-----LGRKHMLRQSFQWRKDEMA----------EVQKQASCFF--ADNISKDDPFLLYATLHSGNHCRFITKDLMRDHKACLPDAKTQRLFFKWQQGHQLAIINGFPGSKLTFQHI-------LSYDTVVQTTGDSWHIPYDEDVVERYSYEVPTKWLCLHQK 580          
BLAST of Mitochondrial ribonuclease P protein 3 vs. UniProt/SwissProt
Match: sp|B5DF07|MRPP3_RAT (Mitochondrial ribonuclease P catalytic subunit OS=Rattus norvegicus OX=10116 GN=Prorp PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.169e-16
Identity = 83/307 (27.04%), Postives = 135/307 (43.97%), Query Frame = 3
Query:  726 LENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTTD-GLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C SCG  +E +++S +    + + +M +V  +D  ++ Y+   P E+KRF  F  SC  PFD VID       FP    + ++L + S         ++  +K  L+          +  D     ++Q+ K       A  FF  + N  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +     +   +  H+ +   + +Q  G   TWH+PY +   P+        W CL+ K
Sbjct:  301 LLDILLYLRNNQLYPGESFAHSIKTWFESIPGRQWKGQFTTIQKSGQCSSCGRAIESIHLSPEEYEFLKETIMRDV--IDGGDQ-YKKTTPQELKRFERFVKSCP-PFDIVIDGLNVAKMFPKGRESQNLLGIVSQLAQQNLQLLVLGRKHMLR------PSSQWRKDE----MEQVRK------QAHCFF--ADNISEDDPFLLYATLNSGSHCKFITKDLLRDHKACLPDARAQRLFFKWQQGHQLAITKGFLKSKLTFQHILSYDTV-VQTTG--DTWHIPYDEDLVPRSSCEVPTKWLCLQRK 582          
BLAST of Mitochondrial ribonuclease P protein 3 vs. UniProt/SwissProt
Match: sp|Q8JZY4|MRPP3_MOUSE (Mitochondrial ribonuclease P catalytic subunit OS=Mus musculus OX=10090 GN=Prorp PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 9.256e-16
Identity = 86/312 (27.56%), Postives = 136/312 (43.59%), Query Frame = 3
Query:  726 LENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTTD-GLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQI-VMKCDQKELFYSLYHVPNAAHIAIQYDGI----KGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E +++S +    + + +M +V  +D  ++ Y+   P E+KRF SF NSC  PFD VID       FP    + ++L + S         ++  +K  L+            S      ++Q+ K       A  FF  + N  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q+ +MK  QK    +  H+       + YD +      +WH+PY +    +        W CL+ K
Sbjct:  298 LLDILLYLRNNQLYPGESFAHSIKTWFESIPGRQWKGQFTTIQKSGQCSGCGRTIEPIHLSPEEYEFLKEKIMRDV--IDGGDQ-YKKTTPQELKRFESFVNSCP-PFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLRP----------SSQWRKEEMEQVRK------QAHCFF--ADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQQGHQLAIMKGFQKSKL-TFQHI-------LSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLCLQRK 579          
BLAST of Mitochondrial ribonuclease P protein 3 vs. UniProt/SwissProt
Match: sp|O15091|MRPP3_HUMAN (Mitochondrial ribonuclease P catalytic subunit OS=Homo sapiens OX=9606 GN=PRORP PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 3.500e-14
Identity = 88/323 (27.24%), Postives = 137/323 (42.41%), Query Frame = 3
Query:  699 IKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAG--FRLNFNTT-DGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID-------FPNFIRNASILTLTSSDNLVKR-FKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQ--IVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            IK +N +  L +IL  LRNN LY   +  + I+  F++  G  ++  F T      C  CG  +E + +S +    +   +M +V  +D  ++ Y+   P E+KRF +F  S   PFD VID       FP  +R + +L L     L KR  ++L      L R  ++ +   +  D             E++  A  FF  + +  +DD  +LY  L SG  C   + D  RDHKA + +      F KWQ   Q  IV +    +L +            + YD +  T    WH+PY +    +        W CL  K
Sbjct:  292 IKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDV--IDGGDQ-YRKTTPQELKRFENFIKS-RPPFDVVIDGLNVAKMFPK-VRESQLL-LNVVSQLAKRNLRLLV-----LGRKHMLRRSSQWSRDEM----------EEVQKQASCFF--ADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTF---------QRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQK 582          
BLAST of Mitochondrial ribonuclease P protein 3 vs. TrEMBL
Match: A0A5K3F8F1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.124e-31
Identity = 125/475 (26.32%), Postives = 215/475 (45.26%), Query Frame = 3
Query:  240 DKSNIQNLKRI--PKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDI-----VNDTVFEHLYHEYLTVLLK-NPQYRSKAFDLIDNRERNF--RHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKI-KFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTT-DGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNAS-----ILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSEN-PKLFQHGMINWACLK 1610
            D S  Q+LK+I   K ++   L  +K NL+DS + YI+ +   H    LISVL    +    FD +   YE I      +D V   +Y   +++ L   P Y+     L    ERN   +  S L+  + T    ++    V+EL  +  + ++       E++   E    ++  +L+ ++     +  ++  LI++ F+ + G+R     T  GL C SC   + K++ S  +C ++A+   E+ +   + ++L+      E++ F SF NS S  FDCV+D PNF+   S      +++    +++        +   + R+C++GK    V  +        +K+L  K       F ++    DD+ M+YLAL SGP CY+ S DEFR H+  +   +L     +WQ +R I ++ +    F      P     +IQ   I G WH+PY   E  P         W CL+
Sbjct:  101 DPSTDQHLKQIFWSKFVS-AALTFDKNNLVDSLILYILEKPHSHSTVTLISVLKALGSKR-RFDEFRSLYELIKSRLSPSDIV---VYAADMSLALALTPFYKDARVLLDMTFERNLPIKQFSCLLTAAATYGPLHEAISLVDELHPMMLKPIDSFYSVFIERLYGVEEGKELMNQLLKVIQKCQYPISKSTALLIKEWFE-SYGWRGTLGVTFSGLSCASCLKPVRKLSFSSQDCCRLAELFYEHALKGKTEDELFLTTTNKELESFHSFINSRSRSFDCVVDLPNFLHTVSNRKLNTISIEEQTDMLSDLIHSLHRTYLVNRVCLVGKQRGVVGKKHFWDS---IKALGNKTGVSVHTFLTEPKSNDDVFMIYLALWSGPHCYLLSNDEFRQHRFTV-GPELGKLLSQWQASRHIRLRNNHPTSFLG----PVLCDTSIQGSMISG-WHIPYESGEQRPSYLPPN--TWLCLQ 558          
BLAST of Mitochondrial ribonuclease P protein 3 vs. TrEMBL
Match: A0A0R3T7A8 (PRORP domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2945 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.143e-29
Identity = 94/303 (31.02%), Postives = 149/303 (49.17%), Query Frame = 3
Query:  735 ILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLL-CKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNS-CSLPFDCVIDFPNFI-----RNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQI---LKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFY-SLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLK 1610
            +LE +R    Y+  NS+ L+ +++    G++         L C SC   L+KV I  + CN++A+   ENV+   + ++L+    P E++ FL F  +  +L FDCVID PNF+     R  S +++     L+    ++  +    KRIC++GK      +R ++  KQ    +K+L  +       F   +   DD  M+YLAL SGPDC++ S DEFR H+  I  +  +    +WQ ARQI +K     +F  S+   P           +K  WH+PY DS  P+L       W CL+
Sbjct:  241 LLEAVRKYK-YVLTNSVALLLKEWFERLGWKGTMGVNPSRLSCPSCLRYLDKVQIDSETCNQLAEIFYENVLKGKTSDELFLTTTPKELESFLVFLETNKTLRFDCVIDLPNFLHSVTHRKLSNMSIEEQVGLLSDLVLILHRTYHFKRICLVGK------ERAVVKKKQFWDAIKALGNRTGINVQTFLVDHRSNDDAFMIYLALWSGPDCHLLSIDEFRQHRYTIGPEGAD-LLAQWQTARQISVKNTHPLIFNDSVVCDPRVQ------GNMKDGWHIPY-DSGVPRLSYLPPTTWLCLQ 528          
BLAST of Mitochondrial ribonuclease P protein 3 vs. TrEMBL
Match: A0A0R3S834 (PRORP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS266 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.559e-27
Identity = 98/316 (31.01%), Postives = 153/316 (48.42%), Query Frame = 3
Query:  723 ILENILETLRNNDLYLQINSLNLIEQQF-----KNTAGFRLN------FNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNS-CSLPFDCVIDFPNFI-----RNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQ---ILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLK 1610
            ++ ++LET+R  +  L      LI++ F     K T G  L+         +  L C SC   L+KV++  + CN++A+    NV+   + ++L+    P E++ FL F  +  +L FDCVID PN++     R  S +++     L+     +  +    KRIC++GK      +R I+  KQ   ++K+L  +       F   +N  DD  M+Y+AL SGPDCY+ S DEFR H+  I  +  +    +WQ ARQI +K      F      P      IQ   +K  WH+PY DS  P+L       W CL+
Sbjct:  236 LMVSLLETVRKYNYALTNFVALLIKEWFERLGWKGTMGVNLSRYVHYFLIDSARLSCPSCLKYLDKVHLDSETCNQLAEIFFNNVLKGKTSDELFLTTTPKELESFLIFLKTNKTLRFDCVIDLPNYLHSVTHRKLSKMSIEEQVGLLSDLISILHRTYHFKRICLVGK------ERAIVKRKQFWDVIKTLGNRTGINVQTFLVDHN-NDDAFMIYMALWSGPDCYLLSIDEFRQHRYTIGPEGAD-LLAQWQTARQISVKNTHPLSFND----PVVCDSRIQ-GNMKDGWHIPY-DSGEPRLSYLPPTTWLCLR 537          
BLAST of Mitochondrial ribonuclease P protein 3 vs. TrEMBL
Match: A0A5K3FAR0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.486e-27
Identity = 112/430 (26.05%), Postives = 200/430 (46.51%), Query Frame = 3
Query:  240 DKSNIQNLKRI--PKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDI-----VNDTVFEHLYHEYLTVLLK-NPQYRSKAFDLIDNRERNF--RHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKI-KFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTT-DGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNAS-----ILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSL 1478
            D S  Q+LK+I   K ++   L  +K NL+DS + YI+ +   H    LISVL    +    FD +   YE I      +D V   +Y   +++ L   P Y+     L    ERN   +  S L+  + T    ++    V+EL  +  + ++       E++   E    ++  +L+ ++     +  ++  LI++ F+ + G+R     T  GL C SC   + K++ S  +C ++A+   E+ +   + ++L+      E++ F SF NS S  FDCV+D PNF+   S      +++    +++        +   + R+C++GK    V  +        +K+L  K       F ++    DD+ M+YLAL SGP CY+ S DEFR H+  +   +L     +WQ +R I ++ +    F S+
Sbjct:  101 DPSTDQHLKQIFWSKFVS-AALTFDKNNLVDSLILYILEKPHSHSTVTLISVLKALGSKR-RFDEFRSLYELIKSRLSPSDIV---VYAADMSLALALTPFYKDARVLLDMTFERNLPIKQFSCLLTAAATYGPLHEAISLVDELHPMMLKPIDSFYSVFIERLYGVEEGKELMNQLLKVIQKCQYPISKSTALLIKEWFE-SYGWRGTLGVTFSGLSCASCLKPVRKLSFSSQDCCRLAELFYEHALKGKTEDELFLTTTNKELESFHSFINSRSRSFDCVVDLPNFLHTVSNRKLNTISIEEQTDMLSDLIHSLHRTYLVNRVCLVGKQRGVVGKKHFWDS---IKALGNKTGVSVHTFLTEPKSNDDVFMIYLALWSGPHCYLLSNDEFRQHRFTV-GPELGKLLSQWQASRHIRLRNNHPTSFLSV 520          
BLAST of Mitochondrial ribonuclease P protein 3 vs. TrEMBL
Match: A0A5K3F912 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.338e-25
Identity = 78/274 (28.47%), Postives = 127/274 (46.35%), Query Frame = 3
Query:  819 GFRLNFNTT-DGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNAS-----ILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQI---LKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSEN-PKLFQHGMINWACLK 1610
            G+R     T  GL C SC   + K++ S  +C ++A+   E+ +   + ++L+      E++ F SF NS S  FDCV+D PNF+   S      +++    +++        +   + R+C++GK       R ++  K     +K+L  K       F ++    DD+ M+YLAL SGP CY+ S DEFR H+  +   +L     +WQ +R I ++ +    F      P     +IQ   I G WH+PY   E  P         W CL+
Sbjct:   32 GWRGTLGVTFSGLSCASCLKPVRKLSFSSQDCCRLAELFYEHALKGKTEDELFLTTTNKELESFHSFINSRSRSFDCVVDLPNFLHTVSNRKLNTISIEEQTDMLSDLIHSLHRTYLVNRVCLVGK------QRGVVGKKHFWDSIKALGNKTGVSVHTFLTEPKSNDDVFMIYLALWSGPHCYLLSNDEFRQHRFTV-GPELGKLLSQWQASRHIRLRNNHPTSFLG----PVLCDTSIQGSMISG-WHIPYESGEQRPSYLPPN--TWLCLQ 291          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Cavefish
Match: prorp (protein only RNase P catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-100618-4])

HSP 1 Score: 76.2554 bits (186), Expect = 4.499e-14
Identity = 85/340 (25.00%), Postives = 146/340 (42.94%), Query Frame = 3
Query:  636 NELLQLSEQWLEDVEKSIF-EKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKN--TAGFRLNFNTTDGL-LCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRT-----ILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAA---HIAIQYDGI----KGTWHVPYVDSENPKLFQHGMINWACL 1607
            NE+++L  +  ++V + +F      +     L +IL  +R N +Y Q   +  I+  F++    G+   F++ D    C SC + +E + ++ +  +++   +M NV+    +   +    P E++ F +F    S  FD ++D  N + N S+     S NL+     L  Q      I ++G+       +      IL +KQI         A  FF  + N  KDD  +LY AL SG +C   S D  RDHKA + +      F KWQ   Q+V+           ++VP         ++YD +      +WH+PY +    +        W CL
Sbjct:  246 NEMMELGLEPNQEVWQCMFNSATSLQKDKEKLLDILIYMRENQVYPQEMLVKSIKTWFQSLPGEGWTGRFSSVDSRDRCGSCQAEMESIELTEEEYSQLKQRVMANVIEGRDV---FFKTTPQELQSFKNFVKK-SPAFDVIVDGLN-VANISVHG-PKSQNLLAVVSELCDQG---LTILVLGRKHMMQHSKMWNRYDILKIKQI---------AHCFF--TDNISKDDPFLLYAALHSGNNCKFVSRDLMRDHKACLPDSATRRLFFKWQRGHQLVVP----------WYVPGKKVRFQRELRYDTVVQSTPTSWHLPYDEDGEDRSSYEIPQKWLCL 555          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Sea Lamprey
Match: prorp (protein only RNase P catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-100618-4])

HSP 1 Score: 70.0922 bits (170), Expect = 6.771e-13
Identity = 65/263 (24.71%), Postives = 105/263 (39.92%), Query Frame = 3
Query:  858 CKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIR------NASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHI---AIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACL 1607
            C SCG NLE + ++     ++ + +M +V+    I   Y+   P E+ RF     S   P+D V+D  N          + IL      ++V       KQ   L R  ++    S++ +   +          ++  A  F    +N  KDD  +LY  L SG  C+  + D  RDH AR+ E  +   F KWQ   Q+V++           ++P    I      +D +  T    WH+PY      +       NW C+
Sbjct:  208 CPSCGENLESIYLTEGEYKQLQECIMNDVIKGHDI---YRKTTPAELARFQRHIASNG-PYDVVVDSLNVSHISGKYAQSQILM-----DVVSHLAEHGKQVLVLGRRHMLKNSNSWLREHMNI----------VRTQADCFLM--ENISKDDPFLLYACLHSGNHCWFVTRDLLRDHCARLTEPIMRHLFRKWQRGHQLVLET----------YIPKGQIIFKTVPSFDTVLQTTTKSWHIPYDKDGIERSHIQVPGNWVCM 439          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Medaka
Match: prorp (protein only RNase P catalytic subunit [Source:NCBI gene;Acc:101168413])

HSP 1 Score: 76.2554 bits (186), Expect = 5.251e-14
Identity = 79/312 (25.32%), Postives = 130/312 (41.67%), Query Frame = 3
Query:  726 LENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGL---LCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID---FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTIL--SVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQ---YDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            L  IL  +RNN +Y      N I+  F++ +  +   + T      LC  CGS LE + ++ +   ++ + ++ +V+    +   ++   P E++ F  F      PFD V+D     N  R+ + L+ T          ++ + K     I ++G+       + +L  S+    K++ L       FFT  N  +DD  +LY  L SG  C   S D  RDHKA + +      F KWQ   Q+V+               N     +    YD I  T    WH+PY D+E+   ++     W CL  K
Sbjct:  317 LLGILLYMRNNQIYPNKMVANAIKTWFESLSSQKWTGSWTSPRSKGLCGCCGSELESIQLTAEEYQELKEKVIADVIQGRDV---FKKTTPEELEHFKEFVRR-KPPFDVVVDGLNVANVNRDKTKLSHT-------LLAVVSELKHQGLTILVLGR-------KHMLRPSISWDRKNMSLIQQKAHCFFTD-NISEDDPFLLYATLHSGYHCRFVSRDLMRDHKACLPDGATRRLFFKWQRGHQLVLD--------GFVAAGNRVKFQVSRENYDTIVQTTSDSWHIPYDDTEDRSTYEVPQ-RWLCLTKK 600          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Medaka
Match: prorp (protein only RNase P catalytic subunit [Source:NCBI gene;Acc:101168413])

HSP 1 Score: 74.7146 bits (182), Expect = 1.158e-13
Identity = 79/308 (25.65%), Postives = 126/308 (40.91%), Query Frame = 3
Query:  726 LENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVID---FPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVM----KCDQKELFYSLYHVPNAAHIAIQYDGIKGT----WHVPYVDSENPKLFQHGMINWACLKMK 1616
            L  IL  +RNN +Y      N I+  F+               LC  CGS LE + ++ +   ++ + ++ +V+    +   ++   P E++ F  F      PFD V+D     N  R+ + L+ T          ++ + K     I ++G+           S+    K++ L       FFT  N  +DD  +LY  L SG  C   S D  RDHKA + +      F KWQ   Q+V+        +  F S   +P+       YD I  T    WH+PY D+E+   ++     W CL  K
Sbjct:  210 LLGILLYMRNNQIYPNKMVANAIKTWFERG-------------LCGCCGSELESIQLTAEEYQELKEKVIADVIQGRDV---FKKTTPEELEHFKEFVRR-KPPFDVVVDGLNVANVNRDKTKLSHT-------LLAVVSELKHQGLTILVLGRKHMLRP-----SISWDRKNMSLIQQKAHCFFTD-NISEDDPFLLYATLHSGYHCRFVSRDLMRDHKACLPDGATRRLFFKWQRGHQLVLDGFVAAGNRVKFQS---IPS-------YDTIVQTTSDSWHIPYDDTEDRSTYEVPQ-RWLCLTKK 476          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Planmine SMEST
Match: SMESG000023790.1 (SMESG000023790.1)

HSP 1 Score: 1076.62 bits (2783), Expect = 0.000e+0
Identity = 526/529 (99.43%), Postives = 528/529 (99.81%), Query Frame = 3
Query:   30 MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYHEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLY+EYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMN+DSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFY LYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK
Sbjct:    1 MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYNEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNIDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYGLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 529          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Planmine SMEST
Match: SMESG000022512.1 (SMESG000022512.1)

HSP 1 Score: 1075.46 bits (2780), Expect = 0.000e+0
Identity = 526/529 (99.43%), Postives = 528/529 (99.81%), Query Frame = 3
Query:   30 MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYHEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLY+EYLTVLLKNPQYRSKAFDLI+NRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFY LYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK
Sbjct:    1 MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYNEYLTVLLKNPQYRSKAFDLIENRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYGLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 529          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Planmine SMEST
Match: SMESG000023790.1 (SMESG000023790.1)

HSP 1 Score: 1042.34 bits (2694), Expect = 0.000e+0
Identity = 508/511 (99.41%), Postives = 510/511 (99.80%), Query Frame = 3
Query:   84 MRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYHEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            MRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLY+EYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMN+DSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFY LYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK
Sbjct:    1 MRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYNEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNIDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYGLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 511          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Planmine SMEST
Match: SMESG000022512.1 (SMESG000022512.1)

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 508/511 (99.41%), Postives = 510/511 (99.80%), Query Frame = 3
Query:   84 MRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYHEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 1616
            MRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLY+EYLTVLLKNPQYRSKAFDLI+NRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFY LYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK
Sbjct:    1 MRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYNEYLTVLLKNPQYRSKAFDLIENRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYGLYHVPNAAHIAIQYDGIKGTWHVPYVDSENPKLFQHGMINWACLKMK 511          
BLAST of Mitochondrial ribonuclease P protein 3 vs. Planmine SMEST
Match: SMESG000022512.1 (SMESG000022512.1)

HSP 1 Score: 978.008 bits (2527), Expect = 0.000e+0
Identity = 483/486 (99.38%), Postives = 485/486 (99.79%), Query Frame = 3
Query:   30 MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYHEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHV 1487
            MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLY+EYLTVLLKNPQYRSKAFDLI+NRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFY LYHV
Sbjct:    1 MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNEIHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDSFLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHLYNEYLTVLLKNPQYRSKAFDLIENRERNFRHLSMLVKTSPTSERWNKIKKYVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQINSLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADYLMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNASILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQILKSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKARIHEKDLNAFFVKWQVARQIVMKCDQKELFYGLYHV 486          
The following BLAST results are available for this feature:
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRORP4.725e-1526.40protein only RNase P catalytic subunit [Source:HGN... [more]
AL121594.17.289e-1527.24novel transcript[more]
PRORP7.289e-1527.24protein only RNase P catalytic subunit [Source:HGN... [more]
PRORP3.443e-1326.56protein only RNase P catalytic subunit [Source:HGN... [more]
PRORP3.443e-1326.56protein only RNase P catalytic subunit [Source:HGN... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mldr6.790e-1225.19gene:FBgn0029858 transcript:FBtr0070898[more]
mldr6.790e-1225.19gene:FBgn0029858 transcript:FBtr0305494[more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prorp1.049e-1224.85protein only RNase P catalytic subunit [Source:ZFI... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
c1orf211.537e-1024.43chromosome 1 open reading frame 21 [Source:Xenbase... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prorp1.323e-1627.56protein only RNase P catalytic subunit [Source:MGI... [more]
Prorp1.323e-1627.56protein only RNase P catalytic subunit [Source:MGI... [more]
Prorp4.513e-1526.86protein only RNase P catalytic subunit [Source:MGI... [more]
Prorp2.353e-1427.17protein only RNase P catalytic subunit [Source:MGI... [more]
Prorp5.785e-1128.70protein only RNase P catalytic subunit [Source:MGI... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q4R366|MRPP3_MACFA1.857e-1626.88Mitochondrial ribonuclease P catalytic subunit OS=... [more]
sp|B5DF07|MRPP3_RAT2.169e-1627.04Mitochondrial ribonuclease P catalytic subunit OS=... [more]
sp|Q8JZY4|MRPP3_MOUSE9.256e-1627.56Mitochondrial ribonuclease P catalytic subunit OS=... [more]
sp|O15091|MRPP3_HUMAN3.500e-1427.24Mitochondrial ribonuclease P catalytic subunit OS=... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F8F13.124e-3126.32Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3T7A84.143e-2931.02PRORP domain-containing protein OS=Rodentolepis na... [more]
A0A0R3S8341.559e-2731.01PRORP domain-containing protein OS=Hymenolepis dim... [more]
A0A5K3FAR03.486e-2726.05Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F9121.338e-2528.47Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prorp4.499e-1425.00protein only RNase P catalytic subunit [Source:ZFI... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prorp6.771e-1324.71protein only RNase P catalytic subunit [Source:ZFI... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prorp5.251e-1425.32protein only RNase P catalytic subunit [Source:NCB... [more]
prorp1.158e-1325.65protein only RNase P catalytic subunit [Source:NCB... [more]
back to top
BLAST of Mitochondrial ribonuclease P protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023790.10.000e+099.43SMESG000023790.1[more]
SMESG000022512.10.000e+099.43SMESG000022512.1[more]
SMESG000023790.10.000e+099.41SMESG000023790.1[more]
SMESG000022512.10.000e+099.41SMESG000022512.1[more]
SMESG000022512.10.000e+099.38SMESG000022512.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015034 ID=SMED30015034|Name=Mitochondrial ribonuclease P protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2156bp
CTATATAAATCTTATATGTTTTAGATTTGATGAATATATTAAAAGGTATT
CGATTATCAAAGATTAAGCCGTTGTTATCATTTATGAGAAGTACATATTA
CGAATCATCCATTGAATATGAGCATAATTTGAACGAAATTCTTTTACGTG
GTTATGATGGTCGTGCGAAATTCAACGAAATACATGATCTTAAAATTTCT
CCTAATGACTGGAATAAGATTCTAATGAAATGGTCCAATGATAAAAGCAA
TATTCAAAATTTAAAACGAATTCCAAAACTTATGACTTTGAAGATATTAT
TAATGGAAAAACGAAATTTATTAGACTCATTTCTTTTTTATATAATTAAT
GAAGAAACATTTCATGATCCATTTATTCTTATATCAGTACTATTAGTAAC
TGAGAATAATAATCCTTATTTTGATCTATATATTCAAAAATACGAAGATA
TCGTAAATGATACAGTTTTTGAACATCTATACCATGAATATTTAACTGTT
TTACTAAAGAATCCTCAATACAGAAGCAAAGCGTTTGATTTAATAGATAA
CCGGGAAAGAAATTTCAGGCATCTCTCAATGTTGGTAAAAACATCACCAA
CGTCAGAACGATGGAATAAAATTAAAAAATACGTTAATGAATTGCTACAG
TTATCTGAACAATGGCTCGAAGACGTTGAAAAGTCGATTTTCGAAAAAAT
TAAATTTGAAAATTCAACATTTATTTTAGAAAATATTTTAGAAACTCTGC
GTAATAATGATTTGTATTTACAAATAAACTCGTTAAATTTGATTGAGCAA
CAATTCAAAAATACTGCCGGGTTTCGATTGAATTTCAATACTACAGATGG
ATTACTATGCAAGTCGTGCGGCTCGAACTTAGAAAAAGTCAACATATCGT
TGGATAATTGCAATAAAGTAGCCGATTATCTGATGGAAAATGTTATGAAT
GTAGATTCCATTGAGAAATTATATCAAAATTGTGATCCTGTGGAGATTAA
ACGATTTCTTTCTTTTTATAACAGTTGTAGTCTTCCTTTTGACTGTGTTA
TTGATTTTCCAAATTTTATCCGGAATGCTTCTATTTTAACCTTAACTTCC
AGTGATAATCTCGTCAAGAGATTCAAAATTTTATTCAAACAAAAACCGGA
CTTAAAACGAATTTGTATTATTGGAAAGGGCGGCAGTTATGTTTCCGATC
GAACCATTTTATCAGTGAAACAAATCCTTAAGTCATTGGAACTTAAATAC
AATGCTAAGTTTTTCTTTTTTACTTCTAAAAACAACAGGAAAGACGATTT
GTTGATGTTGTATTTGGCTCTGAAATCAGGTCCCGACTGCTATATTTGTA
GTGGCGATGAATTCCGTGACCATAAAGCTAGAATTCATGAAAAGGATTTG
AATGCATTTTTTGTTAAATGGCAAGTTGCTCGTCAAATTGTAATGAAATG
TGACCAGAAAGAGCTTTTTTATAGCCTATATCATGTCCCCAACGCAGCAC
ACATAGCTATTCAATATGACGGCATTAAGGGTACTTGGCATGTTCCATAT
GTGGATTCTGAAAATCCGAAATTATTTCAACATGGAATGATTAACTGGGC
CTGTCTAAAGATGAAATGAATTATGCAACATAAATAAATCCTTCAATTTT
ATTACTATTGATGTTATTTTCAAATAATAATTACATTCAATTATATTTTA
TTTGAATTCAATAATAATAATAAAATAATATTATTATGAATGCCAAAATT
ATGTTATCAGAATTATATGAAATGTATAGAGATGAAGTTGGATTATAGTT
CCATCAAGTTAGAGGATTTATCCAATTGCTATAAGCTTGATTTTCATCAC
ATGGAAGCTTTATATAATTCGATAGTACTTGCGTGTATTGGGTTTTTCAA
AATAAAAGTGGACGGGAAACTAAATGAATCGAAAATCTGATTAATAGTTG
AAGTCACGGATATCCTTTTGATGAGTTATAGGATGTCAAAGTTGGAAACT
ATGTATGCCTTTCCCCAAGTTACACCATGTAAATATTATCATTCGGCATC
CGTTGCTTCAGTGGGTGGTCATACAAAAAAGAACTATTTTGAAGTTTGTG
GTCACACACACCCGTATACCTGACTTCCAGCATTATATATATATAACCAA
ACTTTA
back to top

protein sequence of SMED30015034-orf-1

>SMED30015034-orf-1 ID=SMED30015034-orf-1|Name=SMED30015034-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MNILKGIRLSKIKPLLSFMRSTYYESSIEYEHNLNEILLRGYDGRAKFNE
IHDLKISPNDWNKILMKWSNDKSNIQNLKRIPKLMTLKILLMEKRNLLDS
FLFYIINEETFHDPFILISVLLVTENNNPYFDLYIQKYEDIVNDTVFEHL
YHEYLTVLLKNPQYRSKAFDLIDNRERNFRHLSMLVKTSPTSERWNKIKK
YVNELLQLSEQWLEDVEKSIFEKIKFENSTFILENILETLRNNDLYLQIN
SLNLIEQQFKNTAGFRLNFNTTDGLLCKSCGSNLEKVNISLDNCNKVADY
LMENVMNVDSIEKLYQNCDPVEIKRFLSFYNSCSLPFDCVIDFPNFIRNA
SILTLTSSDNLVKRFKILFKQKPDLKRICIIGKGGSYVSDRTILSVKQIL
KSLELKYNAKFFFFTSKNNRKDDLLMLYLALKSGPDCYICSGDEFRDHKA
RIHEKDLNAFFVKWQVARQIVMKCDQKELFYSLYHVPNAAHIAIQYDGIK
GTWHVPYVDSENPKLFQHGMINWACLKMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR033495MRPP3
IPR031595PRORP_C
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0008033tRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031595Protein-only RNase P, C-terminalPFAMPF16953PRORPcoord: 280..529
e-value: 3.7E-33
score: 115.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.11980coord: 306..484
e-value: 7.1E-19
score: 70.0
NoneNo IPR availablePANTHERPTHR13547UNCHARACTERIZEDcoord: 226..512
NoneNo IPR availableCDDcd18718PIN_PRORPcoord: 412..475
e-value: 2.24378E-12
score: 61.8165
IPR033495Mitochondrial ribonuclease P catalytic subunitPANTHERPTHR13547:SF1MITOCHONDRIAL RIBONUCLEASE P CATALYTIC SUBUNITcoord: 226..512