SMED30015018

Overview
NameSMED30015018
Smed IDSMED30015018
Length (bp)725
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015018 (SMED30015018) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015018 (SMED30015018) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015018 (SMED30015018) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015018 (SMED30015018) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015018

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30015018SMESG000075952.1 dd_Smed_v4_4158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015018SMESG000075952.1 dd_Smed_v4_4158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015018SMESG000075952.1 dd_Smed_v4_4158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015018SMESG000075952.1 dd_Smed_v4_4158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30015018SMESG000075952.1 Contig45758newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015018SMESG000075952.1 Contig45758uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30015018SMESG000075952.1 dd_Smed_v6_4158_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015018 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000121:152006..152760 +2172
Homology
BLAST of SMED30015018 vs. Ensembl Human
Match: SMDT1 (single-pass membrane protein with aspartate rich tail 1 [Source:HGNC Symbol;Acc:HGNC:25055])

HSP 1 Score: 53.5286 bits (127), Expect = 8.593e-9
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. Ensembl Human
Match: SMDT1 (single-pass membrane protein with aspartate rich tail 1 [Source:HGNC Symbol;Acc:HGNC:25055])

HSP 1 Score: 53.5286 bits (127), Expect = 8.593e-9
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. Ensembl Human
Match: SMDT1 (single-pass membrane protein with aspartate rich tail 1 [Source:HGNC Symbol;Acc:HGNC:25055])

HSP 1 Score: 53.5286 bits (127), Expect = 8.593e-9
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. Ensembl Human
Match: SMDT1 (single-pass membrane protein with aspartate rich tail 1 [Source:HGNC Symbol;Acc:HGNC:25055])

HSP 1 Score: 53.5286 bits (127), Expect = 8.593e-9
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. Ensembl Celegans
Match: emre-1 (Essential MCU regulator, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U3I4])

HSP 1 Score: 51.2174 bits (121), Expect = 1.198e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = -3
Query:  130 GCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 282
            G +  RP   K G LK   +    LY+GG I+ +GA+Y+EE +IFVP+D+D
Sbjct:   37 GGVGQRPFTNKAGVLKLIFVSASSLYIGGLIAHKGASYLEENEIFVPTDED 87          
BLAST of SMED30015018 vs. Ensembl Celegans
Match: emre-1 (Essential MCU regulator, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U3I4])

HSP 1 Score: 51.2174 bits (121), Expect = 1.198e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = -3
Query:  130 GCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 282
            G +  RP   K G LK   +    LY+GG I+ +GA+Y+EE +IFVP+D+D
Sbjct:   37 GGVGQRPFTNKAGVLKLIFVSASSLYIGGLIAHKGASYLEENEIFVPTDED 87          
BLAST of SMED30015018 vs. Ensembl Celegans
Match: emre-1 (Essential MCU regulator, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9U3I4])

HSP 1 Score: 51.2174 bits (121), Expect = 1.198e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = -3
Query:  130 GCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 282
            G +  RP   K G LK   +    LY+GG I+ +GA+Y+EE +IFVP+D+D
Sbjct:   37 GGVGQRPFTNKAGVLKLIFVSASSLYIGGLIAHKGASYLEENEIFVPTDED 87          
BLAST of SMED30015018 vs. Ensembl Fly
Match: EMRE (gene:FBgn0062440 transcript:FBtr0086781)

HSP 1 Score: 49.2914 bits (116), Expect = 1.131e-7
Identity = 22/54 (40.74%), Postives = 33/54 (61.11%), Query Frame = -3
Query:  139 SAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPS 300
            S Y  SG ++ +P    FG L  F  V+P L++G  IS+  A ++EE D+FVP+
Sbjct:   37 SVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPA 90          
BLAST of SMED30015018 vs. Ensembl Zebrafish
Match: smdt1a (single-pass membrane protein with aspartate-rich tail 1a [Source:ZFIN;Acc:ZDB-GENE-110411-114])

HSP 1 Score: 50.8322 bits (120), Expect = 5.693e-8
Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = -3
Query:  142 SSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 357
            S  +  ++L+H   R    +A   +G +  +P    FG L+   +V PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   52 SPQLGLQQLQH---RTAVNTA---TGAILAKPKKTAFGLLRIMTVVAPFLYVGTLISKNFAALLEEHDIFVP 117          
BLAST of SMED30015018 vs. Ensembl Zebrafish
Match: smdt1b (single-pass membrane protein with aspartate-rich tail 1b [Source:ZFIN;Acc:ZDB-GENE-141212-9])

HSP 1 Score: 48.1358 bits (113), Expect = 3.388e-7
Identity = 24/72 (33.33%), Postives = 39/72 (54.17%), Query Frame = -3
Query:  142 SSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 357
            S N   + +  TG      +    +G +  +P    FG  +  ++V+PFLY+G  IS+  AA +EE++IFVP
Sbjct:   21 SRNANQKSVNVTGPTLSRTAVSSTTGRVLPKPDKVPFGLTRMTIVVVPFLYVGTLISKNFAALLEEHEIFVP 92          
BLAST of SMED30015018 vs. Ensembl Zebrafish
Match: smdt1a (single-pass membrane protein with aspartate-rich tail 1a [Source:ZFIN;Acc:ZDB-GENE-110411-114])

HSP 1 Score: 45.8246 bits (107), Expect = 1.211e-6
Identity = 23/45 (51.11%), Postives = 30/45 (66.67%), Query Frame = -3
Query:  142 LRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 276
            L + PT   FG L+   +V PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   14 LASTPT--AFGLLRIMTVVAPFLYVGTLISKNFAALLEEHDIFVP 56          
BLAST of SMED30015018 vs. Ensembl Xenopus
Match: steap1 (six transmembrane epithelial antigen of the prostate 1 [Source:Xenbase;Acc:XB-GENE-940653])

HSP 1 Score: 53.5286 bits (127), Expect = 5.701e-9
Identity = 23/49 (46.94%), Postives = 33/49 (67.35%), Query Frame = -3
Query:  142 DSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 288
             +G +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   44 SAGTVLPKPEKVSFGLLRVFTVVIPFLYIGTLISKNFAALLEEHDIFVP 92          
BLAST of SMED30015018 vs. Ensembl Xenopus
Match: steap1 (six transmembrane epithelial antigen of the prostate 1 [Source:Xenbase;Acc:XB-GENE-940653])

HSP 1 Score: 52.7582 bits (125), Expect = 1.179e-8
Identity = 23/49 (46.94%), Postives = 33/49 (67.35%), Query Frame = -3
Query:  142 DSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 288
             +G +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   44 SAGTVLPKPEKVSFGLLRVFTVVIPFLYIGTLISKNFAALLEEHDIFVP 92          
BLAST of SMED30015018 vs. Ensembl Mouse
Match: Smdt1 (single-pass membrane protein with aspartate rich tail 1 [Source:MGI Symbol;Acc:MGI:1916279])

HSP 1 Score: 53.1434 bits (126), Expect = 8.479e-9
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. Ensembl Mouse
Match: Smdt1 (single-pass membrane protein with aspartate rich tail 1 [Source:MGI Symbol;Acc:MGI:1916279])

HSP 1 Score: 46.9802 bits (110), Expect = 2.978e-7
Identity = 21/36 (58.33%), Postives = 28/36 (77.78%), Query Frame = -3
Query:  142 FGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 249
            FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:    3 FGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 38          
BLAST of SMED30015018 vs. Ensembl Mouse
Match: Smdt1 (single-pass membrane protein with aspartate rich tail 1 [Source:MGI Symbol;Acc:MGI:1916279])

HSP 1 Score: 47.3654 bits (111), Expect = 4.166e-7
Identity = 21/36 (58.33%), Postives = 28/36 (77.78%), Query Frame = -3
Query:  142 FGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 249
            FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   29 FGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 64          
BLAST of SMED30015018 vs. UniProt/SwissProt
Match: sp|Q5XG64|EMRE_XENLA (Essential MCU regulator, mitochondrial OS=Xenopus laevis OX=8355 GN=smdt1 PE=3 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.793e-8
Identity = 23/49 (46.94%), Postives = 33/49 (67.35%), Query Frame = -3
Query:  142 DSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 288
             +G +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   42 SAGAILPKPEKVSFGLLRVFTVVIPFLYIGTLISKNFAAVLEEHDIFVP 90          
BLAST of SMED30015018 vs. UniProt/SwissProt
Match: sp|Q28ED6|EMRE_XENTR (Essential MCU regulator, mitochondrial OS=Xenopus tropicalis OX=8364 GN=smdt1 PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.163e-8
Identity = 23/49 (46.94%), Postives = 33/49 (67.35%), Query Frame = -3
Query:  142 DSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 288
             +G +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   44 SAGTVLPKPEKVSFGLLRVFTVVIPFLYIGTLISKNFAALLEEHDIFVP 92          
BLAST of SMED30015018 vs. UniProt/SwissProt
Match: sp|Q9H4I9|EMRE_HUMAN (Essential MCU regulator, mitochondrial OS=Homo sapiens OX=9606 GN=SMDT1 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.127e-8
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. UniProt/SwissProt
Match: sp|Q2M2S2|EMRE_BOVIN (Essential MCU regulator, mitochondrial OS=Bos taurus OX=9913 GN=SMDT1 PE=3 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 5.472e-8
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. UniProt/SwissProt
Match: sp|Q9DB10|EMRE_MOUSE (Essential MCU regulator, mitochondrial OS=Mus musculus OX=10090 GN=Smdt1 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 5.931e-8
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG L+ F +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   53 SGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. TrEMBL
Match: A0A1S8WLK6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_08891 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.497e-16
Identity = 44/96 (45.83%), Postives = 55/96 (57.29%), Query Frame = -3
Query:  130 IHKFTKLYENFKMIQRLFQSSSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 417
            +  F+     F M+ RL  S   +   RL    +   Y  A++ SG LR RP   +FG L+S  M LPF+ LG  ISREGAA +EE DIFVPSDDD
Sbjct:   15 VSAFSLNPSPFPMLMRLLPSCGIV--TRLSKFTFSTAYAGAHRPSGALRERPEKMRFGILRSLAMGLPFICLGAYISREGAALLEEMDIFVPSDDD 108          
BLAST of SMED30015018 vs. TrEMBL
Match: A0A075A4F8 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14890 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.155e-16
Identity = 42/84 (50.00%), Postives = 51/84 (60.71%), Query Frame = -3
Query:  130 MIQRLFQSSSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 381
            M+ RL  S   +   RL    +   Y  A++ SG LR RP   +FG L+S  M LPF+ LG  ISREGAA +EE DIFVPSDDD
Sbjct:    1 MLMRLLPSCGIV--TRLSKFTFSTAYAGAHRPSGALRERPEKMRFGILRSLAMGLPFICLGAYISREGAALLEEMDIFVPSDDD 82          
BLAST of SMED30015018 vs. TrEMBL
Match: H2KVL5 (UPF0466 protein C22orf32 mitochondrial OS=Clonorchis sinensis OX=79923 GN=CLF_112624 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.096e-15
Identity = 41/84 (48.81%), Postives = 50/84 (59.52%), Query Frame = -3
Query:  130 MIQRLFQSSSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 381
            M+ R+  S   +   RL        Y  A++ SG LR RP   +FG L+S  M LPF+ LG  ISREGAA +EE DIFVPSDDD
Sbjct:    1 MLMRILPSCGTV--TRLSKFMSSTAYAGAHRPSGALRQRPEIMRFGILRSLSMGLPFICLGAYISREGAALLEEMDIFVPSDDD 82          
BLAST of SMED30015018 vs. TrEMBL
Match: A0A4S2LMY1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006056 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.209e-15
Identity = 41/84 (48.81%), Postives = 49/84 (58.33%), Query Frame = -3
Query:  130 MIQRLFQSSSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 381
            M+ R+  S   +   RL        Y  A++ SG LR RP    FG L+S  M LPF+ LG  ISREGAA +EE DIFVPSDDD
Sbjct:    1 MLMRILPSCGTV--TRLSRFMSSTAYAGAHRTSGALRERPEIMSFGILRSLAMGLPFICLGAYISREGAALLEEMDIFVPSDDD 82          
BLAST of SMED30015018 vs. TrEMBL
Match: A0A2G8K8R3 (Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_18725 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.604e-13
Identity = 29/51 (56.86%), Postives = 40/51 (78.43%), Query Frame = -3
Query:  130 GCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 282
            G ++ +P   K G LK+F++V+PFLY+G  IS+EGAA++EE DIFVP DDD
Sbjct:   39 GSIKQQPPQVKLGLLKAFVVVVPFLYIGATISKEGAAFLEENDIFVPEDDD 89          
BLAST of SMED30015018 vs. Ensembl Cavefish
Match: smdt1b (essential MCU regulator, mitochondrial-like [Source:NCBI gene;Acc:103023443])

HSP 1 Score: 53.1434 bits (126), Expect = 5.273e-9
Identity = 24/61 (39.34%), Postives = 35/61 (57.38%), Query Frame = -3
Query:  142 TGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 324
            TG      +    SG +  +P     G  +  ++V+PFLYLG CIS+  AA +EE++IFVP
Sbjct:   32 TGSAPGRTAVTSISGAVLPKPDKTPLGLTRMTMVVVPFLYLGTCISKNFAALLEEHEIFVP 92          
BLAST of SMED30015018 vs. Ensembl Cavefish
Match: smdt1a (single-pass membrane protein with aspartate rich tail 1 [Source:NCBI gene;Acc:103036919])

HSP 1 Score: 51.9878 bits (123), Expect = 1.293e-8
Identity = 23/49 (46.94%), Postives = 34/49 (69.39%), Query Frame = -3
Query:  142 DSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 288
            +SG L  +P    FG ++  ++V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   52 NSGALLPKPRKTPFGLIRICMVVVPFLYVGTLISKNFAALLEEHDIFVP 100          
BLAST of SMED30015018 vs. Ensembl Sea Lamprey
Match: smdt1a (single-pass membrane protein with aspartate-rich tail 1a [Source:ZFIN;Acc:ZDB-GENE-110411-114])

HSP 1 Score: 50.8322 bits (120), Expect = 1.111e-8
Identity = 22/52 (42.31%), Postives = 31/52 (59.62%), Query Frame = -3
Query:  142 AYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 297
            A   +G +  +P     G  K F +V+PFL LG   S++GA  +EE+DIFVP
Sbjct:   57 AETTTGAILPKPEKVSLGLTKVFTVVIPFLILGAIASKKGAELLEEHDIFVP 108          
BLAST of SMED30015018 vs. Ensembl Medaka
Match: smdt1a (single-pass membrane protein with aspartate rich tail 1 [Source:NCBI gene;Acc:101156580])

HSP 1 Score: 54.299 bits (129), Expect = 1.433e-9
Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = -3
Query:  142 TGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 324
            T YR    S    SG +  +P    FG ++  L+V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:   30 TPYRSAVSS---SSGAILPKPKKTPFGLMRIALVVVPFLYVGTQISKNFAALLEEHDIFVP 87          
BLAST of SMED30015018 vs. Ensembl Medaka
Match: smdt1b (essential MCU regulator, mitochondrial [Source:NCBI gene;Acc:110014938])

HSP 1 Score: 48.521 bits (114), Expect = 1.048e-7
Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = -3
Query:  142 SGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVP 285
            SG +  +P    FG ++   +V+PFLY+G  IS+  AA +EE+DIFVP
Sbjct:    6 SGGILPKPDKTPFGLIRMTAVVVPFLYVGTLISKNFAALLEEHDIFVP 53          
BLAST of SMED30015018 vs. Planmine SMEST
Match: SMESG000075952.1 (SMESG000075952.1)

HSP 1 Score: 177.563 bits (449), Expect = 2.255e-57
Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = -3
Query:  130 MIQRLFQSSSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 381
            MIQRLFQSSSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD
Sbjct:    1 MIQRLFQSSSNIFFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDDD 84          
BLAST of SMED30015018 vs. Planmine SMEST
Match: SMESG000041237.1 (SMESG000041237.1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.585e-9
Identity = 27/71 (38.03%), Postives = 41/71 (57.75%), Query Frame = -3
Query:  133 FFRRLKHTGYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAAYMEEYDIFVPSDD 345
            F + + H  Y+ E Y   K+ G + NRP   +FG  K  +M+   ++ G  IS+  AA++EE DIF+P DD
Sbjct:   13 FIKNMHH--YKYESYYPIKN-GVVENRPFQSRFGTFKVAIMLSSAMFAGALISKTCAAFLEENDIFIPEDD 80          
The following BLAST results are available for this feature:
BLAST of SMED30015018 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SMDT18.593e-950.00single-pass membrane protein with aspartate rich t... [more]
SMDT18.593e-950.00single-pass membrane protein with aspartate rich t... [more]
SMDT18.593e-950.00single-pass membrane protein with aspartate rich t... [more]
SMDT18.593e-950.00single-pass membrane protein with aspartate rich t... [more]
back to top
BLAST of SMED30015018 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
emre-11.198e-845.10Essential MCU regulator, mitochondrial [Source:Un... [more]
emre-11.198e-845.10Essential MCU regulator, mitochondrial [Source:Un... [more]
emre-11.198e-845.10Essential MCU regulator, mitochondrial [Source:Un... [more]
back to top
BLAST of SMED30015018 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
EMRE1.131e-740.74gene:FBgn0062440 transcript:FBtr0086781[more]
back to top
BLAST of SMED30015018 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smdt1a5.693e-837.50single-pass membrane protein with aspartate-rich t... [more]
smdt1b3.388e-733.33single-pass membrane protein with aspartate-rich t... [more]
smdt1a1.211e-651.11single-pass membrane protein with aspartate-rich t... [more]
back to top
BLAST of SMED30015018 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
steap15.701e-946.94six transmembrane epithelial antigen of the prosta... [more]
steap11.179e-846.94six transmembrane epithelial antigen of the prosta... [more]
back to top
BLAST of SMED30015018 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Smdt18.479e-950.00single-pass membrane protein with aspartate rich t... [more]
Smdt12.978e-758.33single-pass membrane protein with aspartate rich t... [more]
Smdt14.166e-758.33single-pass membrane protein with aspartate rich t... [more]
back to top
BLAST of SMED30015018 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XG64|EMRE_XENLA1.793e-846.94Essential MCU regulator, mitochondrial OS=Xenopus ... [more]
sp|Q28ED6|EMRE_XENTR2.163e-846.94Essential MCU regulator, mitochondrial OS=Xenopus ... [more]
sp|Q9H4I9|EMRE_HUMAN4.127e-850.00Essential MCU regulator, mitochondrial OS=Homo sap... [more]
sp|Q2M2S2|EMRE_BOVIN5.472e-850.00Essential MCU regulator, mitochondrial OS=Bos taur... [more]
sp|Q9DB10|EMRE_MOUSE5.931e-850.00Essential MCU regulator, mitochondrial OS=Mus musc... [more]
back to top
BLAST of SMED30015018 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WLK61.497e-1645.83Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A075A4F86.155e-1650.00Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
H2KVL52.096e-1548.81UPF0466 protein C22orf32 mitochondrial OS=Clonorch... [more]
A0A4S2LMY12.209e-1548.81Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A2G8K8R31.604e-1356.86Uncharacterized protein OS=Stichopus japonicus OX=... [more]
back to top
BLAST of SMED30015018 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smdt1b5.273e-939.34essential MCU regulator, mitochondrial-like [Sourc... [more]
smdt1a1.293e-846.94single-pass membrane protein with aspartate rich t... [more]
back to top
BLAST of SMED30015018 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smdt1a1.111e-842.31single-pass membrane protein with aspartate-rich t... [more]
back to top
BLAST of SMED30015018 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015018 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015018 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smdt1a1.433e-944.26single-pass membrane protein with aspartate rich t... [more]
smdt1b1.048e-745.83essential MCU regulator, mitochondrial [Source:NCB... [more]
back to top
BLAST of SMED30015018 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000075952.12.255e-57100.00SMESG000075952.1[more]
SMESG000041237.12.585e-938.03SMESG000041237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015018 ID=SMED30015018|Name=SMED30015018|organism=Schmidtea mediterranea sexual|type=transcript|length=725bp
TTTTTTCAAATTGACTATAAATATATTAATAATAACAATATAAATTCATA
TAAGAATGCCGTAAGTCGAAAAGAAATAAAGAAAATATCTCATAGTGAGT
GTAAGAAGCACGCTATAATCGTGTTTCTAATCATCATCAGAAGGAACAAA
AATATCATATTCCTCCATATATGCAGCCCCTTCACGACTAATACATCCAC
CCAAATAAAGAAATGGAAGAACCATGAGGAAAGATTTTAACCATCCGAAC
TTCTCATAAGTTGGTCGATTTCGAAGGCAGCCAGAATCCTTGTATGCTGA
GTAATACTCGTCACGATAACCCGTGTGTTTCAGTCTGCGAAAGAATATGT
TGGAAGAACTTTGAAAAAGCCGCTGAATCATTTTAAAATTTTCATATAAT
TTTGTGAATTTATGAATTTTGCTAAGTAAAACAATTACAAATAACAAAAA
AAAGATAAAAATGTAATTCATAATATGTAATTTTTCAAATAATTCTAGTT
AATATTAATTTTGCTTTATAGTAAATAATAAATTTGAAATAAATTGAGTT
TAATAACTATTTAGATTATAAATACAAACAAACGGATTTTAAGAATTTAA
AAGGAAGTATTTTCCATTAGATTAAAACTTCAAATTATCCCATTATTTTA
AAAGATAAATATTATTTATTCAATTTTTGATACTAAATTAATTCAAGTCT
AAATTGATTTATTTATATTATTTAT
back to top

protein sequence of SMED30015018-orf-1

>SMED30015018-orf-1 ID=SMED30015018-orf-1|Name=SMED30015018-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
MNYIFIFFLLFVIVLLSKIHKFTKLYENFKMIQRLFQSSSNIFFRRLKHT
GYRDEYYSAYKDSGCLRNRPTYEKFGWLKSFLMVLPFLYLGGCISREGAA
YMEEYDIFVPSDDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: cellular component
TermDefinition
GO:1990246uniplex complex
Vocabulary: biological process
TermDefinition
GO:0051560mitochondrial calcium ion homeostasis
GO:0036444mitochondrial calcium uptake
Vocabulary: INTERPRO
TermDefinition
IPR018782MCU_reg
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018782Essential MCU regulator, mitochondrialPFAMPF10161DDDDcoord: 29..84
e-value: 7.9E-17
score: 60.8
IPR018782Essential MCU regulator, mitochondrialPANTHERPTHR33904FAMILY NOT NAMEDcoord: 27..84