Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30014998
Length (bp)1092
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30014998) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30014998) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014998

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014998SMESG000046507.1 Contig5308newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014998SMESG000046507.1 Contig5308uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014998SMESG000062644.1 Contig5308newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014998SMESG000062644.1 Contig5308uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
reproductive organSMED30014998SMESG000046507.1 Contig5308newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014998SMESG000046507.1 Contig5308uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014998SMESG000062644.1 Contig5308newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014998SMESG000062644.1 Contig5308uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 57.7658 bits (138), Expect = 7.417e-9
Identity = 41/142 (28.87%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   + + GS    +++
Sbjct:  125 TGLRTTGKLNLVDLAGSER--VGKSGAEGSRLREAQHINKSLSALGDVIAA----------LRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLKFAERVRSVELG-PGLRRAELGSWSSQEHL 251          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF22 (kinesin family member 22 [Source:HGNC Symbol;Acc:HGNC:6391])

HSP 1 Score: 55.8398 bits (133), Expect = 1.292e-8
Identity = 32/112 (28.57%), Postives = 56/112 (50.00%), Query Frame = 1
Query:   85 TNSKTGDEVKVYQFNKIFNNESSHIDI-SNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVG--KLIDEMNKEHRK-RFKIDVSFLEFYNDNLICLL 408
             N +   E   YQF+  +   S+  DI + + Q  +  L+ G N  ++ +G +G+GKTHT++G  +    I   L+   +L  E   E R     + +S+LE Y + ++ LL
Sbjct:    9 ANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGRPWALSVTMSYLEIYQEKVLDLL 120          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 58.151 bits (139), Expect = 1.449e-8
Identity = 41/142 (28.87%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   + + GS    +++
Sbjct:  520 TGLRTTGKLNLVDLAGSER--VGKSGAEGSRLREAQHINKSLSALGDVIA----------ALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLKFAERVRSVELG-PGLRRAELGSWSSQEHL 646          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 57.7658 bits (138), Expect = 1.600e-8
Identity = 41/142 (28.87%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   + + GS    +++
Sbjct:  523 TGLRTTGKLNLVDLAGSER--VGKSGAEGSRLREAQHINKSLSALGDVIA----------ALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLKFAERVRSVELG-PGLRRAELGSWSSQEHL 649          

HSP 2 Score: 53.9138 bits (128), Expect = 3.165e-7
Identity = 31/98 (31.63%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
            ++ +K+F+ ++S  D+    Q  +   I G+NVC+  +G +G+GKT+T+ G  ++  GI+   +  L  E+  K     + I VS  E YN+ L  LL
Sbjct:  351 FELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP-GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLL 447          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 57.7658 bits (138), Expect = 1.600e-8
Identity = 41/142 (28.87%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   + + GS    +++
Sbjct:  523 TGLRTTGKLNLVDLAGSER--VGKSGAEGSRLREAQHINKSLSALGDVIA----------ALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLKFAERVRSVELG-PGLRRAELGSWSSQEHL 649          

HSP 2 Score: 53.9138 bits (128), Expect = 3.165e-7
Identity = 31/98 (31.63%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
            ++ +K+F+ ++S  D+    Q  +   I G+NVC+  +G +G+GKT+T+ G  ++  GI+   +  L  E+  K     + I VS  E YN+ L  LL
Sbjct:  351 FELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENP-GINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLL 447          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-18 (Kinesin-like protein; Kinesin-like protein-18 [Source:UniProtKB/TrEMBL;Acc:G5EBX0])

HSP 1 Score: 46.2098 bits (108), Expect = 4.821e-11
Identity = 40/116 (34.48%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  112 KVYQFNKIFNNESSHIDISNNFQGSINQLIV-----GYNVCLIHFGTSGSGKTHTVVGDF-----QSECGI---STFLVGKLIDEMNKEHRK-RFKIDVSFLEFYNDNLICLLSEK 417
            K Y+ + IF++ SS  D+   F G++ + IV     GYN  +  +G +GSGKTHT++G       Q   G+   S   V + +D   KE +K  F + V F+E YN+ +  LL+ K
Sbjct:   40 KRYELHHIFDSSSSQEDV---F-GTVAKKIVEDCVEGYNGTVFAYGQTGSGKTHTMLGPCDSWTDQELMGLIPRSVEHVFQHLDTKAKECQKLTFSVSVEFVELYNEVIYDLLNAK 151          

HSP 2 Score: 39.6614 bits (91), Expect = 4.821e-11
Identity = 45/165 (27.27%), Postives = 80/165 (48.48%), Query Frame = 3
Query:  423 QLKDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSF-CXXXXXXXXXXXXXXXXXXXXTFVKTNSRLI-ICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSND 911
            QL+D+GK I +   + +++    +   L+Q+  Q+R T +T+     S    L+II     E T   VK  S ++ + DLAG E+ +    +  +  + E   IN+SL+VL + I             ++ K  +P+R S LT  LK    G++   +I+++  D
Sbjct:  155 QLRDSGKDIQLVGALSKNVDNPLDLMHLVQKGWQERSTGSTAMNAESSRSHALLIIRIKTQERTGELVKERSSILNLVDLAGSERQTHTKSSGDR--LKEATNINSSLTVLGRCIRLLA-------DPSKAKGHVPYRDSHLTHILKNSLGGNSKTAVIVNMHPD 310          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: bmk-1 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECF4])

HSP 1 Score: 41.2022 bits (95), Expect = 1.828e-9
Identity = 27/105 (25.71%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  124 FNKIFNNESSHIDISNNFQGS-INQLIVGYNVCLIHFGTSGSGKTHTVVG---DFQSE-----CGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLS 411
            F + ++ +++  +I ++   S I ++I G+N  +  +G +G+GKT T+ G   D +S       GI    V  + +++ +   + + + VS++E YN+ L  LL+
Sbjct:   60 FFRTYDPDTTQEEIYSDLVSSQIKKVIAGFNCTVFAYGQTGTGKTFTMEGGRTDAKSSTDDPTTGIIPRAVEDIFEQLERCGCEEYSLRVSYIELYNEELFDLLA 164          

HSP 2 Score: 39.2762 bits (90), Expect = 1.828e-9
Identity = 57/205 (27.80%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  432 DTGKKILIDDYVKE-SIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXT----FVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICLSKY 1031
            D  KK +I   V+E  +   ++  +LLQ  A+KR+T+AT     SSRSH + ++++      T     VK   +L + DLAG E  ++     +     E   IN SL  L ++I            LT     +P+R SKLT+ L+    G     LI  +S        +   L+    A + +  KP+C+   S    L +Y
Sbjct:  179 DPNKKGVIVSGVEEVPVRNRSDVFKLLQLGAEKRRTAATLMNMHSSRSHSLFMVNVVIRENTTTGEELVK-QGKLNLVDLAGSE--NIGRSGAQGNRAKEAGSINQSLLTLGRVIR----------LLTTNGQHIPYRESKLTRLLQDSLGGSTITSLIATLSPSSSNFEESQSTLEYAMRAANIK-NKPVCNTKLSKKTILKEY 369          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: bmk-1 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECF4])

HSP 1 Score: 41.2022 bits (95), Expect = 1.828e-9
Identity = 27/105 (25.71%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  124 FNKIFNNESSHIDISNNFQGS-INQLIVGYNVCLIHFGTSGSGKTHTVVG---DFQSE-----CGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLS 411
            F + ++ +++  +I ++   S I ++I G+N  +  +G +G+GKT T+ G   D +S       GI    V  + +++ +   + + + VS++E YN+ L  LL+
Sbjct:   60 FFRTYDPDTTQEEIYSDLVSSQIKKVIAGFNCTVFAYGQTGTGKTFTMEGGRTDAKSSTDDPTTGIIPRAVEDIFEQLERCGCEEYSLRVSYIELYNEELFDLLA 164          

HSP 2 Score: 39.2762 bits (90), Expect = 1.828e-9
Identity = 57/205 (27.80%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  432 DTGKKILIDDYVKE-SIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXT----FVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICLSKY 1031
            D  KK +I   V+E  +   ++  +LLQ  A+KR+T+AT     SSRSH + ++++      T     VK   +L + DLAG E  ++     +     E   IN SL  L ++I            LT     +P+R SKLT+ L+    G     LI  +S        +   L+    A + +  KP+C+   S    L +Y
Sbjct:  179 DPNKKGVIVSGVEEVPVRNRSDVFKLLQLGAEKRRTAATLMNMHSSRSHSLFMVNVVIRENTTTGEELVK-QGKLNLVDLAGSE--NIGRSGAQGNRAKEAGSINQSLLTLGRVIR----------LLTTNGQHIPYRESKLTRLLQDSLGGSTITSLIATLSPSSSNFEESQSTLEYAMRAANIK-NKPVCNTKLSKKTILKEY 369          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: bmk-1 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECF4])

HSP 1 Score: 41.2022 bits (95), Expect = 1.873e-9
Identity = 27/105 (25.71%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  124 FNKIFNNESSHIDISNNFQGS-INQLIVGYNVCLIHFGTSGSGKTHTVVG---DFQSE-----CGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLS 411
            F + ++ +++  +I ++   S I ++I G+N  +  +G +G+GKT T+ G   D +S       GI    V  + +++ +   + + + VS++E YN+ L  LL+
Sbjct:   55 FFRTYDPDTTQEEIYSDLVSSQIKKVIAGFNCTVFAYGQTGTGKTFTMEGGRTDAKSSTDDPTTGIIPRAVEDIFEQLERCGCEEYSLRVSYIELYNEELFDLLA 159          

HSP 2 Score: 39.2762 bits (90), Expect = 1.873e-9
Identity = 57/205 (27.80%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  432 DTGKKILIDDYVKE-SIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXT----FVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICLSKY 1031
            D  KK +I   V+E  +   ++  +LLQ  A+KR+T+AT     SSRSH + ++++      T     VK   +L + DLAG E  ++     +     E   IN SL  L ++I            LT     +P+R SKLT+ L+    G     LI  +S        +   L+    A + +  KP+C+   S    L +Y
Sbjct:  174 DPNKKGVIVSGVEEVPVRNRSDVFKLLQLGAEKRRTAATLMNMHSSRSHSLFMVNVVIRENTTTGEELVK-QGKLNLVDLAGSE--NIGRSGAQGNRAKEAGSINQSLLTLGRVIR----------LLTTNGQHIPYRESKLTRLLQDSLGGSTITSLIATLSPSSSNFEESQSTLEYAMRAANIK-NKPVCNTKLSKKTILKEY 364          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: bmk-1 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECF4])

HSP 1 Score: 41.2022 bits (95), Expect = 1.873e-9
Identity = 27/105 (25.71%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  124 FNKIFNNESSHIDISNNFQGS-INQLIVGYNVCLIHFGTSGSGKTHTVVG---DFQSE-----CGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLS 411
            F + ++ +++  +I ++   S I ++I G+N  +  +G +G+GKT T+ G   D +S       GI    V  + +++ +   + + + VS++E YN+ L  LL+
Sbjct:   55 FFRTYDPDTTQEEIYSDLVSSQIKKVIAGFNCTVFAYGQTGTGKTFTMEGGRTDAKSSTDDPTTGIIPRAVEDIFEQLERCGCEEYSLRVSYIELYNEELFDLLA 159          

HSP 2 Score: 39.2762 bits (90), Expect = 1.873e-9
Identity = 57/205 (27.80%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  432 DTGKKILIDDYVKE-SIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXT----FVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICLSKY 1031
            D  KK +I   V+E  +   ++  +LLQ  A+KR+T+AT     SSRSH + ++++      T     VK   +L + DLAG E  ++     +     E   IN SL  L ++I            LT     +P+R SKLT+ L+    G     LI  +S        +   L+    A + +  KP+C+   S    L +Y
Sbjct:  174 DPNKKGVIVSGVEEVPVRNRSDVFKLLQLGAEKRRTAATLMNMHSSRSHSLFMVNVVIRENTTTGEELVK-QGKLNLVDLAGSE--NIGRSGAQGNRAKEAGSINQSLLTLGRVIR----------LLTTNGQHIPYRESKLTRLLQDSLGGSTITSLIATLSPSSSNFEESQSTLEYAMRAANIK-NKPVCNTKLSKKTILKEY 364          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0344976)

HSP 1 Score: 58.9214 bits (141), Expect = 3.898e-9
Identity = 37/127 (29.13%), Postives = 70/127 (55.12%), Query Frame = 1
Query:   40 FSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK---RFKIDVSFLEFYNDNLICLLS 411
            +++  +  + ++S+   +K+    +++ F+++F+  SS  DI       I   + GYN+C+  +G +GSGKT+T+ G  +S  G+    V  L D + + +R     ++I  +FLE YN+ L  LLS
Sbjct:  370 WTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPES-VGVIPRTVDLLFDSI-RGYRNLGWEYEIKATFLEIYNEVLYDLLS 494          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0085534)

HSP 1 Score: 58.9214 bits (141), Expect = 3.898e-9
Identity = 37/127 (29.13%), Postives = 70/127 (55.12%), Query Frame = 1
Query:   40 FSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK---RFKIDVSFLEFYNDNLICLLS 411
            +++  +  + ++S+   +K+    +++ F+++F+  SS  DI       I   + GYN+C+  +G +GSGKT+T+ G  +S  G+    V  L D + + +R     ++I  +FLE YN+ L  LLS
Sbjct:  370 WTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPES-VGVIPRTVDLLFDSI-RGYRNLGWEYEIKATFLEIYNEVLYDLLS 494          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 56.9954 bits (136), Expect = 1.329e-8
Identity = 37/139 (26.62%), Postives = 76/139 (54.68%), Query Frame = 1
Query:   10 MFQNKNTESIFSFVTDDKI--GIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDI-SNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSEC--GISTFLVGKLIDEMNK-EHRKRFKIDVSFLEFYNDNLICLL 408
            M +N+ +    S ++ DKI   I  +K N+   +  K Y F+ +F+  S+ +D+  +  +  +++++ GYN  ++ +G +G+GKT+T+ G+  S    GI       +   + K +  ++F + VS++E YN+ +  LL
Sbjct:   30 MDKNELSAGALSAISVDKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLL 168          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Khc (gene:FBgn0001308 transcript:FBtr0087184)

HSP 1 Score: 50.8322 bits (120), Expect = 1.310e-6
Identity = 40/114 (35.09%), Postives = 58/114 (50.88%), Query Frame = 1
Query:  112 KVYQFNKIFNNESSHIDISNNFQGSI-NQLIVGYNVCLIHFGTSGSGKTHT---VVGDFQSECGISTFLVGKLID-----EMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN 426
            KVY F+K+F   +S   + N    SI   ++ GYN  +  +G + SGKTHT   V+GD   + GI   +V  + +     E+N E    F I VS+ E Y D +  LL   K+N
Sbjct:   51 KVYLFDKVFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQ-GIIPRIVNDIFNHIYAMEVNLE----FHIKVSYYEIYMDKIRDLLDVSKVN 159          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp67A (gene:FBgn0004379 transcript:FBtr0333886)

HSP 1 Score: 50.447 bits (119), Expect = 1.777e-6
Identity = 26/100 (26.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  121 QFNKIFNNESSHIDISNNFQGS-INQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHR-KRFKIDVSFLEFYNDNLICLLSE 414
            +F+++F+ ++S+ D+        ++ ++ GYN  +  +G +G+GKT T++G  ++  G++   +  L D++  +   ++F + VS+LE YN++++ LL++
Sbjct:   73 EFDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLGS-EAHPGLTYLTMQDLFDKIQAQSDVRKFDVGVSYLEVYNEHVMNLLTK 171          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: si:dkey-96l17.6 (si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-350])

HSP 1 Score: 57.3806 bits (137), Expect = 8.549e-9
Identity = 34/95 (35.79%), Postives = 53/95 (55.79%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDF-QSECGISTFLVGKLIDEM-NKEHRKRFKIDVSFLEFYNDNL 396
            +QF+KIFN E +  ++     G I   I G+NVC+  +G +GSGKT T+VGD  +   G+      ++ + + + E +  FK+    LE YND L
Sbjct:   57 FQFDKIFNTECTQEEVFIESSGLIQCAIDGFNVCIFAYGHTGSGKTFTMVGDRDRRNPGLIPRTFTRIFEIIQDNESKFEFKVSAYMLELYNDRL 151          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: si:dkey-96l17.6 (si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-350])

HSP 1 Score: 57.3806 bits (137), Expect = 1.100e-8
Identity = 34/95 (35.79%), Postives = 53/95 (55.79%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDF-QSECGISTFLVGKLIDEM-NKEHRKRFKIDVSFLEFYNDNL 396
            +QF+KIFN E +  ++     G I   I G+NVC+  +G +GSGKT T+VGD  +   G+      ++ + + + E +  FK+    LE YND L
Sbjct:   60 FQFDKIFNTECTQEEVFIESSGLIQCAIDGFNVCIFAYGHTGSGKTFTMVGDRDRRNPGLIPRTFTRIFEIIQDNESKFEFKVSAYMLELYNDRL 154          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 56.225 bits (134), Expect = 4.140e-8
Identity = 31/99 (31.31%), Postives = 56/99 (56.57%), Query Frame = 1
Query:  115 VYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
             ++ +K+F  +++  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    +KI VS +E YN+ L  LL
Sbjct:  397 TFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-IPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLL 494          

HSP 2 Score: 51.6026 bits (122), Expect = 1.006e-6
Identity = 35/119 (29.41%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  624 KTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            +T+ +L + DLAG E+ + +        + E   IN SLS L  +I   N  + KH H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + E+G
Sbjct:  573 RTSGKLNLVDLAGSERIAKS--GAEGSRLREAQCINKSLSALGDVI---NSLRSKHSHV-------PFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIG 679          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 56.225 bits (134), Expect = 4.158e-8
Identity = 31/99 (31.31%), Postives = 56/99 (56.57%), Query Frame = 1
Query:  115 VYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
             ++ +K+F  +++  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    +KI VS +E YN+ L  LL
Sbjct:  425 TFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-IPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLL 522          

HSP 2 Score: 51.6026 bits (122), Expect = 1.224e-6
Identity = 35/119 (29.41%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  624 KTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            +T+ +L + DLAG E+ + +        + E   IN SLS L  +I   N  + KH H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + E+G
Sbjct:  601 RTSGKLNLVDLAGSERIAKS--GAEGSRLREAQCINKSLSALGDVI---NSLRSKHSHV-------PFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIG 707          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 55.8398 bits (133), Expect = 4.334e-8
Identity = 31/99 (31.31%), Postives = 56/99 (56.57%), Query Frame = 1
Query:  115 VYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
             ++ +K+F  +++  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    +KI VS +E YN+ L  LL
Sbjct:  421 TFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-IPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLL 518          

HSP 2 Score: 51.2174 bits (121), Expect = 1.562e-6
Identity = 35/119 (29.41%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  624 KTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            +T+ +L + DLAG E+ + +        + E   IN SLS L  +I   N  + KH H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + E+G
Sbjct:  597 RTSGKLNLVDLAGSERIAKS--GAEGSRLREAQCINKSLSALGDVI---NSLRSKHSHV-------PFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIG 703          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 51.2174 bits (121), Expect = 2.025e-15
Identity = 35/136 (25.74%), Postives = 71/136 (52.21%), Query Frame = 1
Query:   22 KNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEM-NKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN 426
               E++ +F  DD  G+  +   ++ G E+  ++ +K+F   ++  ++       I   + GY+VC++ +G +GSGKT+++ G   S+ GI+   +  L+ E+  + +    ++ VS +E YN+ L  LL     N
Sbjct:  168 PGAENVVNFDPDDD-GVLYV---AQKGKEMS-FELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG-IPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSN 297          

HSP 2 Score: 51.2174 bits (121), Expect = 2.025e-15
Identity = 48/181 (26.52%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  444 KILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            ++ + +  +  + ++ + N++L+   ++R T  T+  + SSRSH ++I++ K   T T + +  +L + DLAG E+ S +      + + E   IN SLS L  +   F+  + +  H+       P+R+SKLT  L+     D    L++ VS     I+ +   L+ G    + ELG P
Sbjct:  310 ELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRS--GAAGERLREAQCINRSLSALGDV---FSALRSQQGHI-------PYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAP 478          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 50.8322 bits (120), Expect = 2.431e-15
Identity = 31/111 (27.93%), Postives = 61/111 (54.95%), Query Frame = 1
Query:   91 SKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNK-----EHRKRFKIDVSFLEFYNDNLICLL 408
            ++ G E+  ++ +K+F   ++  ++       I   + GY+VC++ +G +GSGKT+++ G   S+ GI+   +  L+ E+ +     EH    ++ VS +E YN+ L  LL
Sbjct:  686 AQKGKEMS-FELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG-IPSDPGINQRALHLLLSEVKERSNSWEH----ELSVSMVEIYNETLRDLL 790          

HSP 2 Score: 50.8322 bits (120), Expect = 2.431e-15
Identity = 48/181 (26.52%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  444 KILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            ++ + +  +  + ++ + N++L+   ++R T  T+  + SSRSH ++I++ K   T T + +  +L + DLAG E+ S +      + + E   IN SLS L  +   F+  + +  H+       P+R+SKLT  L+     D    L++ VS     I+ +   L+ G    + ELG P
Sbjct:  809 ELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRS--GAAGERLREAQCINRSLSALGDV---FSALRSQQGHI-------PYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAP 977          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 50.8322 bits (120), Expect = 2.772e-15
Identity = 31/111 (27.93%), Postives = 61/111 (54.95%), Query Frame = 1
Query:   91 SKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNK-----EHRKRFKIDVSFLEFYNDNLICLL 408
            ++ G E+  ++ +K+F   ++  ++       I   + GY+VC++ +G +GSGKT+++ G   S+ GI+   +  L+ E+ +     EH    ++ VS +E YN+ L  LL
Sbjct:  671 AQKGKEMS-FELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG-IPSDPGINQRALHLLLSEVKERSNSWEH----ELSVSMVEIYNETLRDLL 775          

HSP 2 Score: 50.8322 bits (120), Expect = 2.772e-15
Identity = 48/181 (26.52%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  444 KILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            ++ + +  +  + ++ + N++L+   ++R T  T+  + SSRSH ++I++ K   T T + +  +L + DLAG E+ S +      + + E   IN SLS L  +   F+  + +  H+       P+R+SKLT  L+     D    L++ VS     I+ +   L+ G    + ELG P
Sbjct:  794 ELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRS--GAAGERLREAQCINRSLSALGDV---FSALRSQQGHI-------PYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAP 962          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 50.8322 bits (120), Expect = 2.945e-15
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 1
Query:   28 TESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNK-----EHRKRFKIDVSFLEFYNDNLICLL 408
             E++ +F  DD  G+  +   ++ G E+  ++ +K+F   ++  ++       I   + GY+VC++ +G +GSGKT+++ G   S+ GI+   +  L+ E+ +     EH    ++ VS +E YN+ L  LL
Sbjct:  498 AENVVNFDPDDD-GVLYV---AQKGKEMS-FELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG-IPSDPGINQRALHLLLSEVKERSNSWEH----ELSVSMVEIYNETLRDLL 619          

HSP 2 Score: 50.8322 bits (120), Expect = 2.945e-15
Identity = 48/181 (26.52%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  444 KILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            ++ + +  +  + ++ + N++L+   ++R T  T+  + SSRSH ++I++ K   T T + +  +L + DLAG E+ S +      + + E   IN SLS L  +   F+  + +  H+       P+R+SKLT  L+     D    L++ VS     I+ +   L+ G    + ELG P
Sbjct:  638 ELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRS--GAAGERLREAQCINRSLSALGDV---FSALRSQQGHI-------PYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAP 806          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 50.8322 bits (120), Expect = 3.297e-15
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 1
Query:   28 TESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNK-----EHRKRFKIDVSFLEFYNDNLICLL 408
             E++ +F  DD  G+  +   ++ G E+  ++ +K+F   ++  ++       I   + GY+VC++ +G +GSGKT+++ G   S+ GI+   +  L+ E+ +     EH    ++ VS +E YN+ L  LL
Sbjct:  572 AENVVNFDPDDD-GVLYV---AQKGKEMS-FELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEG-IPSDPGINQRALHLLLSEVKERSNSWEH----ELSVSMVEIYNETLRDLL 693          

HSP 2 Score: 50.8322 bits (120), Expect = 3.297e-15
Identity = 48/181 (26.52%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  444 KILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            ++ + +  +  + ++ + N++L+   ++R T  T+  + SSRSH ++I++ K   T T + +  +L + DLAG E+ S +      + + E   IN SLS L  +   F+  + +  H+       P+R+SKLT  L+     D    L++ VS     I+ +   L+ G    + ELG P
Sbjct:  712 ELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRS--GAAGERLREAQCINRSLSALGDV---FSALRSQQGHI-------PYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFGDRVRAVELGAP 880          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 60.077 bits (144), Expect = 2.512e-9
Identity = 42/142 (29.58%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   +T+ GS    +++
Sbjct:  660 TGLRTTGKLNLVDLAGSER--VGKSGAEGNRLREAQHINRSLSALGDVIA----------ALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLRFAERVRSVELG-PGSRRTELGSWSSQEHL 786          

HSP 2 Score: 53.1434 bits (126), Expect = 4.344e-7
Identity = 32/98 (32.65%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
            ++ +K+F+  +S  D+    Q  I   I G+NVC+  +G +G+GKT+T+ G  ++  GI+   +  L  E+  K    ++ I VS  E YN+ L  LL
Sbjct:  488 FELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP-GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLL 584          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 59.6918 bits (143), Expect = 2.692e-9
Identity = 42/142 (29.58%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   +T+ GS    +++
Sbjct:  614 TGLRTTGKLNLVDLAGSER--VGKSGAEGNRLREAQHINRSLSALGDVIA----------ALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLRFAERVRSVELG-PGSRRTELGSWSSQEHL 740          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 59.6918 bits (143), Expect = 2.891e-9
Identity = 42/142 (29.58%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   +T+ GS    +++
Sbjct:  545 TGLRTTGKLNLVDLAGSER--VGKSGAEGNRLREAQHINRSLSALGDVIA----------ALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLRFAERVRSVELG-PGSRRTELGSWSSQEHL 671          

HSP 2 Score: 52.7582 bits (125), Expect = 4.407e-7
Identity = 32/98 (32.65%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
            ++ +K+F+  +S  D+    Q  I   I G+NVC+  +G +G+GKT+T+ G  ++  GI+   +  L  E+  K    ++ I VS  E YN+ L  LL
Sbjct:  373 FELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP-GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLL 469          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 59.6918 bits (143), Expect = 2.984e-9
Identity = 42/142 (29.58%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELGKPICHKTDSGSICLSKYI 1034
            T ++T  +L + DLAG E+  V         + E  +IN SLS L  +I            L  R+  +PFR+SKLT  L+    GD+   +++ VS  PV+ +++  +  L+  +   S ELG P   +T+ GS    +++
Sbjct:  523 TGLRTTGKLNLVDLAGSER--VGKSGAEGNRLREAQHINRSLSALGDVIA----------ALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVS--PVEKNTSETLYSLRFAERVRSVELG-PGSRRTELGSWSSQEHL 649          

HSP 2 Score: 52.7582 bits (125), Expect = 4.207e-7
Identity = 32/98 (32.65%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
            ++ +K+F+  +S  D+    Q  I   I G+NVC+  +G +G+GKT+T+ G  ++  GI+   +  L  E+  K    ++ I VS  E YN+ L  LL
Sbjct:  351 FELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENP-GINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLL 447          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif13b (kinesin family member 13B [Source:MGI Symbol;Acc:MGI:1098265])

HSP 1 Score: 51.9878 bits (123), Expect = 8.502e-8
Identity = 26/73 (35.62%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  205 GYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKE--HRKRFKIDVSFLEFYNDNLICLLSEK 417
            GYN C+  +G +GSGK++T++G    + G+   L   L +   KE    + FK++VS++E YN+ +  LL  K
Sbjct:   30 GYNACIFAYGQTGSGKSYTMMGT-ADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPK 101          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q07970|KN14C_ARATH (Kinesin-like protein KIN-14C OS=Arabidopsis thaliana OX=3702 GN=KIN14C PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.123e-21
Identity = 58/170 (34.12%), Postives = 83/170 (48.82%), Query Frame = 3
Query:  477 IITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            + ++   + LLQQ AQ R    T    QSSRSH +  + I   N  T  +    L + DLAG E+ S +        + ET  IN SLS LS +I  F L K K +H+       PFR+SKLT  L+PC  GD+   + +++S DP     +   L+      + E+G P
Sbjct:  620 VCSVGKISSLLQQAAQSRSVGKTQMNEQSSRSHFVFTMRISGVNESTEQQVQGVLNLIDLAGSERLSKS--GATGDRLKETQAINKSLSALSDVI--FALAK-KEDHV-------PFRNSKLTYLLQPCLGGDSKTLMFVNISPDPTSAGESLCSLRFAARVNACEIGIP 777          

HSP 2 Score: 56.6102 bits (135), Expect = 5.123e-21
Identity = 30/104 (28.85%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK------RFKIDVSFLEFYNDNLICLLS 411
            + F+K+FN+E+S  ++       +   + GY VC+  +G +GSGKT+T++G  + E      L+ + ++++ +  +       ++K+ VS LE YN+ +  LLS
Sbjct:  478 FTFDKVFNHEASQEEVFFEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMG--RPEAPDQKGLIPRSLEQIFQASQSLGAQGWKYKMQVSMLEIYNETIRDLLS 579          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|F4JGP4|KN14D_ARATH (Kinesin-like protein KIN-14D OS=Arabidopsis thaliana OX=3702 GN=KIN14D PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.324e-19
Identity = 58/170 (34.12%), Postives = 83/170 (48.82%), Query Frame = 3
Query:  477 IITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            + ++   + LLQQ AQ R    T    QSSRSH +  + I   N  T  +    L + DLAG E+ S +        + ET  IN SLS LS +I  F L K K +H+       PFR+SKLT  L+PC  GD+   + +++S DP     +   L+      + E+G P
Sbjct:  617 VCSIGQISSLLQQAAQSRSVGKTHMNEQSSRSHFVFTLRISGVNESTEQQVQGVLNLIDLAGSERLSRS--GATGDRLKETQAINKSLSALSDVI--FALAK-KEDHV-------PFRNSKLTYLLQPCLGGDSKTLMFVNISPDPSSTGESLCSLRFAARVNACEIGIP 774          

HSP 2 Score: 52.7582 bits (125), Expect = 1.324e-19
Identity = 29/104 (27.88%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK------RFKIDVSFLEFYNDNLICLLS 411
            + F+K+F++ +S  ++       +   + GY VC+  +G +GSGKT+T++G  + E      L+ + ++++ K  +       ++K+ VS LE YN+++  LLS
Sbjct:  475 FTFDKVFDHGASQEEVFFEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMG--RPETPEQKGLIPRSLEQIFKTSQSLSTQGWKYKMQVSMLEIYNESIRDLLS 576          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q7Y1C8|KN14G_ORYSJ (Kinesin-like protein KIN-14G OS=Oryza sativa subsp. japonica OX=39947 GN=KIN14G PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 5.109e-17
Identity = 56/185 (30.27%), Postives = 88/185 (47.57%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            D      + D +   ++++N  + LL++ AQ R    T    +SSRSH +  +     N  T  +    L + DLAG E+  +N        + ET  IN SLS LS +I  F++ K K EH+       PFR+SKLT  L+PC  GD+   + +++S +      +   L+      S E+G P
Sbjct:  543 DANGNTHVSDLIIVDVLSINEVSSLLKRAAQSRSVGRTQMNEESSRSHCVFTLRFFGVNEGTDQQVQGVLNLIDLAGSER--LNKSGATGDRLKETQAINKSLSCLSDVI--FSIAK-KEEHV-------PFRNSKLTYLLQPCLGGDSKTLMFVNLSPEVSSTGESICSLRFAARVNSCEIGIP 715          

HSP 2 Score: 47.7506 bits (112), Expect = 5.109e-17
Identity = 30/108 (27.78%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  118 YQFNKIFNNESSH----IDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK------RFKIDVSFLEFYNDNLICLLS 411
            + F+K+F   +S     I+IS+  Q +++    GY VC+  +G +GSGKT+T++G+   E      L+ + ++++ +  +       ++K+  S LE YN+ +  LL+
Sbjct:  423 FTFDKVFEQSTSQEDVFIEISHLVQSALD----GYKVCIFAYGQTGSGKTYTMMGN--PELHDQKGLIPRSLEQIFQTSQALISQGWKYKMQASMLEIYNEAICDLLA 524          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|A3BFT0|KN14N_ORYSJ (Kinesin-like protein KIN-14N OS=Oryza sativa subsp. japonica OX=39947 GN=KIN14N PE=2 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 1.320e-16
Identity = 55/170 (32.35%), Postives = 84/170 (49.41%), Query Frame = 3
Query:  477 IITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            + ++N  + LL++ AQ R    T    +SSRSH +  + I   N  T  +    L + DLAG E+  +N        + ET  IN SLS LS +I  F++ K K EH+       PFR+SKLT  L+PC  GD+   + +++S +      +   L+      S E+G P
Sbjct:  595 VSSINEVSSLLKRAAQSRSVGRTQMNEESSRSHCVFTLRIFGVNEGTDQQVQGVLNLIDLAGSER--LNKSGATGDRLKETQAINKSLSCLSDVI--FSIAK-KEEHV-------PFRNSKLTYLLQPCLGGDSKTLMFVNLSPEVSSTGESICSLRFAARVNSCEIGIP 752          

HSP 2 Score: 49.6766 bits (117), Expect = 1.320e-16
Identity = 28/104 (26.92%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK------RFKIDVSFLEFYNDNLICLLS 411
            + F+K+F   +S  D+       I   + GY VC+  +G +GSGKT+T++G+   E      L+ + ++++ +  +       ++K+  S LE YN+ +  LL+
Sbjct:  460 FTFDKVFEQSASQEDVFIEISQLIQSALDGYKVCIFAYGQTGSGKTYTMMGN--PELHDQKGLIPRSLEQIFQTSQALISQGWKYKMQASMLEIYNEAIRDLLA 561          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|F4I1T9|KN14T_ARATH (Kinesin-like protein KIN-14T OS=Arabidopsis thaliana OX=3702 GN=KIN14T PE=3 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.609e-15
Identity = 34/99 (34.34%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  112 KVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLL 408
            K Y F+++F  +SS  D+    +  I  +I GYN C+  +G +G+GKT+T+ G   +  GI    +  L  ++ +E    F I  S LE Y  NL  LL
Sbjct:  128 KTYNFDRVFQPDSSQDDVFLEIEPVIKSVIDGYNACIFAYGQTGTGKTYTMEG-LPNSPGIVPRAIKGLFKQV-EESNHMFTIHFSMLEIYMGNLKDLL 224          

HSP 2 Score: 46.2098 bits (108), Expect = 3.609e-15
Identity = 53/184 (28.80%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGK 983
            D   +I I++ VK  +   N   RL +   + R T++T+  S SSRSH +I +S+ S       +  +++ + DL G E+        R+   DE   IN SLS L  +I            L ++ S +P+R+SKLTQ LK     D+   +++H+S     +  T   L     A +  LG+
Sbjct:  244 DPNGEIDIENLVKLKVDDFNEILRLYKVGCRSRATASTNSNSVSSRSHCMIRVSVTSLGAPERRRETNKIWLVDLGGSERVLKTRATGRR--FDEGKAINLSLSALGDVIN----------SLQRKNSHIPYRNSKLTQVLKDSLGQDSKTLMLVHISPKEDDLCETICSLNFATRAKNIHLGQ 415          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A183VSE0 (Kinesin motor domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS3396 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.841e-25
Identity = 42/128 (32.81%), Postives = 70/128 (54.69%), Query Frame = 1
Query:   58 DKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN*KILG 441
            DK+ I + + +  +  E+  ++FNKI    +S  ++       I++L+ GYNV L+ +G   SGKTHT  G   ++ GI++  V +LI           +I  SF+E YN++  C+LS++ IN K  G
Sbjct:  283 DKLNIYANRRHKASSTEMCTFEFNKILLPNTSQCEVYFTVSSQIHRLLDGYNVTLLCYGVCASGKTHTCCGT-PNDPGIASLAVSELITLAKNRSMHNIRIYASFIEIYNEHTYCMLSKQPINLKDTG 409          

HSP 2 Score: 70.8626 bits (172), Expect = 1.841e-25
Identity = 57/200 (28.50%), Postives = 104/200 (52.00%), Query Frame = 3
Query:  426 LKDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTS---ATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYM-------DETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICH 995
            LKDTG  I I+  +++ I + +++N LL Q+  +R+ S   ++++ S  S   + I + ++        +  S LII DLA +   +  I +              E Y+I  S+ +L+ I+            L ++ +   +R SKLT+ LKPCF GD+Y  LI++++++P + + T  IL++G++ M   L +PI H
Sbjct:  405 LKDTGDIIHIEGQIEQYIKSAHDFNTLLFQIISERKKSLIQSSNYYSSRSHFFIFIKLVLEKCENQITSEYLSTLIIGDLANYTLANRKIPSSGNNNYNNNTLIKQENYHIQKSVVMLTNILHG----------LRKQNAFSVYRGSKLTELLKPCFNGDSYLTLILNITDNPSEAYFTNVILEVGKSLMCANLSRPIKH 594          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A074ZP05 (Kinesin motor domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_07399 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.952e-23
Identity = 38/117 (32.48%), Postives = 67/117 (57.26%), Query Frame = 1
Query:   91 SKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN*KILG 441
            + T + V++Y FN+IF   +    +  +    + +++ GYNV ++H GTSGSGKT T  G+   E GI++F +  L+  + ++ +       SF+E YND + C+LS++ +  K  G
Sbjct:  359 TTTDNTVRLYNFNQIFPPGTPQCKVYQSISNQVKRILDGYNVTVLHSGTSGSGKTFTCCGNT-VEPGIASFSMADLLRLVTEKGQTNISFYASFIEIYNDRVRCVLSKRAVQIKDTG 474          

HSP 2 Score: 64.3142 bits (155), Expect = 3.952e-23
Identity = 53/206 (25.73%), Postives = 94/206 (45.63%), Query Frame = 3
Query:  423 QLKDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVK---TNSR-------LIICDLAGFEKTSVNIENMR-----KQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICH 995
            Q+KDTG  + + D  +  I  L ++N LL +V  +R++                       +   F+K   TN         LI+ DLA    T V ++        + +  E+++I  S  +LS ++ +          L +R   +  R ++LT+ LKPCF GD++  +++ +++DP Q  +T  +L+ G+ A  T LG P  H
Sbjct:  469 QIKDTGSTVFVKDQKEVRINRLGDFNTLLNRVGCERKSYTID-----------RNQHNSRSHLFIFIKCILTNGGQEANIGTLIMGDLA----TPVRLKQSHPLVNDRLFKQESWHIQKSNILLSSMLHQ----------LRKRGVVINCRGTRLTELLKPCFSGDSHLIMLLTITDDPEQASTTQNVLEFGKLASETALGTPKNH 649          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A1S3JJA7 (Kinesin-like protein OS=Lingula unguis OX=7574 GN=LOC106173586 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.097e-22
Identity = 59/182 (32.42%), Postives = 92/182 (50.55%), Query Frame = 3
Query:  438 GKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGK 983
            G K++I    +  + ++ +  R+++   + R T+AT   SQSSRSHLI+ +S++  N      ++  L++CDLAG E+  V     + Q + E   IN SL+ L Q+   F+  +    H+       P+R+SKLT  L+P   GDA   L + VS D   I  T   L  G  A    LG+
Sbjct:  408 GNKVVIPGLTEVEVTSMADIQRVMELGNKNRTTAATKMNSQSSRSHLILKLSVEGLNRKAGTHSSGSLMLCDLAGSER--VGKTEAQGQRLVEAAAINKSLTALGQV---FSALRASQLHI-------PYRNSKLTHILQPALGGDAKACLFVAVSPDVRNITETISTLTFGSNARQIALGQ 577          

HSP 2 Score: 65.855 bits (159), Expect = 5.097e-22
Identity = 43/142 (30.28%), Postives = 76/142 (53.52%), Query Frame = 1
Query:    4 IRMFQ----NKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKR--FKIDVSFLEFYNDNLICLLS 411
            IR+F     +   E    F +D  I   +  T  K     K++ F+K+++  S   ++  +    I+  + GYNVC++ +G +GSGKTHT++G  + + G++   +  L+ E+ KE   +  + + VS LE YN+N+  LLS
Sbjct:  262 IRVFARCRYDNRVECSLEFPSDSDIATFNPATQQK-----KIFSFDKVYSPSSKQTEVFEDTLPIIHSCVDGYNVCILAYGQTGSGKTHTMMGP-EHDPGVNIRSIKALL-EICKERSDKADYTLKVSLLEIYNENVQDLLS 396          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A1S3IW30 (Kinesin-like protein OS=Lingula unguis OX=7574 GN=LOC106167505 PE=3 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 9.553e-22
Identity = 58/182 (31.87%), Postives = 90/182 (49.45%), Query Frame = 3
Query:  438 GKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGK 983
            G K++I    +  + ++ +  R+++   + R T+AT   SQSSRSHLI+ +S++  N      ++  L++CDLAG E+  V     + Q + E   IN SL+ L Q+       +L           +P+R+SKLT  L+P   GDA   L + VS D   I  T   L  G  A    LG+
Sbjct:  622 GNKVVIPGLTEVEVTSMADIQRVMELGNKNRTTAATKMNSQSSRSHLILKLSVEGLNRKAGTHSSGSLMLCDLAGSER--VGKTEAQGQRLVEAAAINKSLTALGQVFSALRASQLH----------IPYRNSKLTHILQPALGGDAKACLFVAVSPDVRNITETISTLTFGSNARQIALGQ 791          

HSP 2 Score: 65.0846 bits (157), Expect = 9.553e-22
Identity = 39/126 (30.95%), Postives = 70/126 (55.56%), Query Frame = 1
Query:   40 FSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKR--FKIDVSFLEFYNDNLICLLS 411
              F +D  I   +  T  K     K++ F+K+++  S   ++  +    I+  + GYNVC++ +G +GSGKTHT++G  + + G++   +  L+ E+ KE   +  + + VS LE YN+N+  LLS
Sbjct:  492 LEFPSDSDIATFNPATQQK-----KIFSFDKVYSPSSKQTEVFEDTLPIIHSCVDGYNVCILAYGQTGSGKTHTMMGP-EHDPGVNIRSIKALL-EICKERSDKADYTLKVSLLEIYNENVQDLLS 610          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A183AIW1 (Kinesin motor domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS6896 PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.497e-21
Identity = 33/118 (27.97%), Postives = 66/118 (55.93%), Query Frame = 1
Query:   88 NSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN*KILG 441
            +    + ++ YQFNKIF  E+S   +  +    + ++I G+NV ++  GTSG GKT+T  G    + G+++     L+  + ++  + + +  S +E +N+++ CLLS++ +  K  G
Sbjct:  183 DCPANEAIRQYQFNKIFTPEASQQTVYQSISEHVKRVIEGFNVTILFHGTSGGGKTYTCCGTA-DKSGMASLACQGLLKLVQEKGSQNWALYASMIEIHNEHVTCLLSKRPVKIKDTG 299          

HSP 2 Score: 65.0846 bits (157), Expect = 2.497e-21
Identity = 52/199 (26.13%), Postives = 99/199 (49.75%), Query Frame = 3
Query:  423 QLKDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQT-----SATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTS-VNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKT 1001
            ++KDTG  + +++  +  I  L  +  LL+  + +R++     S  S  S       ++  +  +   +T V T   LI+ DLAG  + +    +   +Q   E++Y+  SL + + +      + LK   +      +  R S+LT+ LKPCF GD+Y  L+++V++D     +T  +L++G +A +  LG P+ H T
Sbjct:  294 KIKDTGTLVHVENQKEVPITELKEFTALLEIASAQRKSLQIDRSHMSSRSHLFVIIKLVSRNSATAMELTHVGT---LILGDLAGLTRVNPTETQPQDRQLKQESWYLQKSLILFASL-----FHNLKRSDVG-----INCRGSRLTELLKPCFCGDSYLTLVLNVTDDTDLSSTTQTVLEVGNSAQAIVLGPPVNHLT 479          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 53.1434 bits (126), Expect = 7.734e-17
Identity = 36/131 (27.48%), Postives = 69/131 (52.67%), Query Frame = 1
Query:   25 NTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLLSE 414
            +++++ SF +DD   +  L    K    +  ++ +K+F  + +  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    + I VS +E YN+ L  LL +
Sbjct:  702 DSKTMVSFDSDDD-AVLYLSNKGK----LMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGD 826          

HSP 2 Score: 53.1434 bits (126), Expect = 7.734e-17
Identity = 53/184 (28.80%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTS-VNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            D   ++ +    + S+ ++ + NR+ +     R T+ T+    SSRSH ++II++   N+ T  +T+ +L + DLAG E+ +    E  R   + E   IN SLS L  +I   N  + +H H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + ELG
Sbjct:  839 DGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSR---LREAQCINKSLSALGDVI---NALRSRHSHV-------PFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELG 1009          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 53.1434 bits (126), Expect = 7.861e-17
Identity = 36/131 (27.48%), Postives = 69/131 (52.67%), Query Frame = 1
Query:   25 NTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLLSE 414
            +++++ SF +DD   +  L    K    +  ++ +K+F  + +  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    + I VS +E YN+ L  LL +
Sbjct:  690 DSKTMVSFDSDDD-AVLYLSNKGK----LMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGD 814          

HSP 2 Score: 53.1434 bits (126), Expect = 7.861e-17
Identity = 53/184 (28.80%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTS-VNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            D   ++ +    + S+ ++ + NR+ +     R T+ T+    SSRSH ++II++   N+ T  +T+ +L + DLAG E+ +    E  R   + E   IN SLS L  +I   N  + +H H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + ELG
Sbjct:  827 DGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSR---LREAQCINKSLSALGDVI---NALRSRHSHV-------PFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELG 997          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 53.5286 bits (127), Expect = 2.068e-16
Identity = 51/183 (27.87%), Postives = 90/183 (49.18%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            D   ++ +    + S+ ++ + NR+ +     R T+ T+    SSRSH ++II++   N+ T  +T+ +L + DLAG E+ + +        + E   IN SLS L  +I   N  + +H H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + ELG
Sbjct:  594 DGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKS--GAEGSRLREAQCINKSLSALGDVI---NALRSRHSHV-------PFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELG 764          

HSP 2 Score: 51.2174 bits (121), Expect = 2.068e-16
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = 1
Query:   25 NTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
            +++++ SF +DD   +  L    K    +  ++ +K+F  + +  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    + I VS +E YN+ L  LL
Sbjct:  457 DSKTMVSFDSDDD-AVLYLSNKGK----LMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLL 579          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 53.1434 bits (126), Expect = 3.373e-16
Identity = 36/131 (27.48%), Postives = 69/131 (52.67%), Query Frame = 1
Query:   25 NTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLLSE 414
            +++++ SF +DD   +  L    K    +  ++ +K+F  + +  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    + I VS +E YN+ L  LL +
Sbjct:  702 DSKTMVSFDSDDD-AVLYLSNKGK----LMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGD 826          

HSP 2 Score: 50.8322 bits (120), Expect = 3.373e-16
Identity = 51/183 (27.87%), Postives = 90/183 (49.18%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            D   ++ +    + S+ ++ + NR+ +     R T+ T+    SSRSH ++II++   N+ T  +T+ +L + DLAG E+ + +        + E   IN SLS L  +I   N  + +H H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + ELG
Sbjct:  839 DGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKS--GAEGSRLREAQCINKSLSALGDVI---NALRSRHSHV-------PFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELG 1009          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 52.7582 bits (125), Expect = 3.878e-16
Identity = 53/184 (28.80%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTS-VNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            D   ++ +    + S+ ++ + NR+ +     R T+ T+    SSRSH ++II++   N+ T  +T+ +L + DLAG E+ +    E  R   + E   IN SLS L  +I   N  + +H H+       PFR+S+LT  L+    GD+   +++ VS     I  +   L+  Q   + ELG
Sbjct:  654 DGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSR---LREAQCINKSLSALGDVI---NALRSRHSHV-------PFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELG 824          

HSP 2 Score: 50.8322 bits (120), Expect = 3.878e-16
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = 1
Query:   25 NTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMN-KEHRKRFKIDVSFLEFYNDNLICLL 408
            +++++ SF +DD   +  L    K    +  ++ +K+F  + +  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G    + GI+   +  L  E++ K+    + I VS +E YN+ L  LL
Sbjct:  517 DSKTMVSFDSDDD-AVLYLSNKGK----LMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLL 639          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 55.4546 bits (132), Expect = 7.118e-18
Identity = 29/100 (29.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTV--VGDFQSECGISTFLVGKLIDEM-NKEHRKRFKIDVSFLEFYNDNLICLL 408
            +Q +++F   +S  ++    Q  +   + GYN+C+  +G +GSGKT+T+          GI+   +  L  EM  ++   R+ + +S LE YN+ L  LL
Sbjct:  127 FQLDRVFPPHASQEEVFREVQDLVTSCVDGYNICIFAYGQTGSGKTYTMERAQGTAKAPGINQRALQHLFQEMEERQDEWRYTLSLSMLEIYNETLRDLL 226          

HSP 2 Score: 51.9878 bits (123), Expect = 7.118e-18
Identity = 52/185 (28.11%), Postives = 90/185 (48.65%), Query Frame = 3
Query:  432 DTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKI--LQLGQTAMSTELG 980
            D   ++ +    +E + +L + +RL+      R T  T+    SSRSH +I++++ + N+IT   T  RL + DLAG E+ + +        + E   IN SL+ L  +I+           L  +++ +PFR+SKLT  L+     ++   ++I V+  P   H+   I  L   Q A + ELG
Sbjct:  241 DGSGELCVPGLRQEPVTSLGDVHRLVSLGHSNRATHCTNMNEHSSRSHALILVTVSATNSITGTSTRGRLNLVDLAGSERLAKS--RAEGDRLREAQNINRSLAALGDVIQA----------LRAKQAHVPFRNSKLTYLLQDSLARESKTLMVIQVA--PAARHAAETICSLHFAQRARAVELG 411          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010492.1 (pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 gene:ENSPMAG00000009502.1 transcript:ENSPMAT00000010492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 8.908e-10
Identity = 28/100 (28.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEK 417
            + F+++F   ++   +  +    I   + GYNVC++ +G +GSGKTHT++G   +  G++   V +L++   + H  ++ + +S LE YN+ +  LL + 
Sbjct:  102 FAFDQVFPPNATQEQVFADTLPLITSCVDGYNVCILAYGQTGSGKTHTMMGTSNAP-GVNVRSVKELLNICKERHNVKYTLKISMLEIYNETVRDLLGKP 200          

HSP 2 Score: 52.7582 bits (125), Expect = 6.118e-8
Identity = 38/120 (31.67%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  627 TNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTL--PFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELG 980
            ++  LI+ DLAG E+ S        Q + E   IN SL+ L Q+             L  R  +L  P+R+SKLT  L+P   G+A   + + VS D      T   LQ G +     LG
Sbjct:  274 SHGSLILGDLAGSERISRT--EATGQRLVEAAAINKSLTSLGQVF------------LALRNGSLHVPYRNSKLTHLLQPALGGNAKACVFVTVSADDANRGETLSTLQFGSSIRQVALG 379          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005274.1 (pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 gene:ENSPMAG00000004797.1 transcript:ENSPMAT00000005274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 6.519e-9
Identity = 26/81 (32.10%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  181 GSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK--RFKIDVSFLEFYNDNLICLLSEK 417
            G ++    GYN C+  +G +GSGK+++++G  + + G++  L G L + +++  R    FK++VS++E YN+ +  LL  K
Sbjct:   13 GILDNAFQGYNACIFAYGQTGSGKSYSMMGSAE-QPGLTPRLCGALFERVSRLSRDDHSFKVEVSYMEIYNEKVRDLLDPK 92          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005277.1 (pep scaffold:Pmarinus_7.0:GL482849:207:11964:-1 gene:ENSPMAG00000004797.1 transcript:ENSPMAT00000005277.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 7.527e-9
Identity = 26/81 (32.10%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  181 GSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK--RFKIDVSFLEFYNDNLICLLSEK 417
            G ++    GYN C+  +G +GSGK+++++G  + + G++  L G L + +++  R    FK++VS++E YN+ +  LL  K
Sbjct:   10 GILDNAFQGYNACIFAYGQTGSGKSYSMMGSAE-QPGLTPRLCGALFERVSRLSRDDHSFKVEVSYMEIYNEKVRDLLDPK 89          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 55.4546 bits (132), Expect = 1.005e-8
Identity = 30/103 (29.13%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  118 YQFNKIFNNESSHIDISNNFQGSI-NQLIVGYNVCLIHFGTSGSGKTHTVVGDFQ--SECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEK 417
            +QF KIF+ ++   +I       + + ++ GYN  +  +G +GSGKT T+ G  +  ++ GI   ++G L ++  K+  + +   +S+LE YN+N   LL+ +
Sbjct:   56 FQFKKIFDQQAKQEEIFETIARPVADSVLSGYNGTIFAYGQTGSGKTFTITGGAERFADRGIIPRILGYLFEQFQKDTNRVYTAHISYLEIYNENGYDLLNPR 158          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 60.8474 bits (146), Expect = 1.210e-10
Identity = 38/123 (30.89%), Postives = 71/123 (57.72%), Query Frame = 1
Query:   55 DDKIGIKSLK-TNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVV--GDFQSECGISTFLVGKLIDEMNKEHRK--RFKIDVSFLEFYNDNLICLL 408
            DD  G++S++ T  +   +V  ++F+KIF+ + +++D+       +   + GYNVC+  +G +GSGKT T++  GD     GI    +  + + +NK   K   +K++  F+E YN+N++ LL
Sbjct:  414 DDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-----GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531          

HSP 2 Score: 49.2914 bits (116), Expect = 5.692e-7
Identity = 36/113 (31.86%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  639 LIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTEL 977
            L + DLAG E+  +N+  +    + ET  IN SLS L  +I     + L     T+R   +PFR+SKLT  L+    GD+   + +++S     I+ T   L+      ST L
Sbjct:  622 LNLVDLAGSER--INVSQVVGDRLRETQNINKSLSCLGDVI-----HALGQPDSTKRH--IPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRL 725          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 54.299 bits (129), Expect = 1.554e-8
Identity = 35/110 (31.82%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  112 KVYQFNKIFNNESSHIDISN-NFQGSINQLIVGYNVCLIHFGTSGSGKTHT------VVGDFQS--------ECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNL 396
            K YQF+++F  ES    + N   +  I +++ GYN  +  +G +G+GKT+T      ++GD QS          GI   ++  L  E++  + K + + +SFLE YN+NL
Sbjct:  100 KTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLN-KEYSVKISFLELYNENL 208          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 52.7582 bits (125), Expect = 4.592e-8
Identity = 35/114 (30.70%), Postives = 66/114 (57.89%), Query Frame = 1
Query:   85 TNSKT--GDEVKVYQFNKIFNNESSHIDI-SNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKL---IDEMNKEHRKRFKIDVSFLEFYNDNLICLL 408
            TN KT   +E+  ++F+ +F +  +++++     +  I++L++G+N  +  +G +GSGKT T+ G+ Q E G+    V  L   I E +    K+F + +S+LE YN+ +  LL
Sbjct:  150 TNDKTIVHEEIGEFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ-ELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLL 262          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 46.9802 bits (110), Expect = 3.359e-6
Identity = 32/105 (30.48%), Postives = 59/105 (56.19%), Query Frame = 1
Query:  100 GDEVKVYQFNKIFNNESSHIDISNNFQGSI-NQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNK-EHRKRFKIDVSFLEFYNDNLICLL 408
            G E+K + F+K+F+  SS   +       + + ++ G+N  +  +G +G GKT+TV G   S+ GI    + +L +++   +  K F+I +S+LE YN+ +  LL
Sbjct:  148 GGEIK-FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT-PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 46.2098 bits (108), Expect = 6.509e-6
Identity = 38/130 (29.23%), Postives = 54/130 (41.54%), Query Frame = 3
Query:  633 SRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICL 1022
            S++ + DLAG E  ++N      Q   E   IN SL  L ++I            L  +   +PFR SKLT+ L+    G+    LI  +S   V    TC  L+    A      K I +K   GS  +
Sbjct:  377 SKMNLVDLAGSE--NINRSGALNQRAKEAGSINQSLLTLGRVINA----------LVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA------KNIKNKPQLGSFIM 488          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO45950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH2])

HSP 1 Score: 54.299 bits (129), Expect = 4.073e-18
Identity = 36/131 (27.48%), Postives = 67/131 (51.15%), Query Frame = 1
Query:   22 KNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDE-MNKEHRKRFKIDVSFLEFYNDNLICLLS 411
            K  E++ SF  DD   +      +     +K ++ +++F  +S+ +++    +  +   + GYNVC+  +G +GSGKT T+ G   S  GI+   +  L  E  ++     +++ VS +E YN+ L  LLS
Sbjct:  107 KPAENVISFDDDDDAILNVFSRGA-----LKPFEMDRVFQPQSTQVEVFEEVKPLVISCVDGYNVCIFAYGQTGSGKTFTMEGPV-SNPGINQRALQHLFTETADRGVDWDYQVTVSVMEIYNEMLRDLLS 231          

HSP 2 Score: 54.299 bits (129), Expect = 4.073e-18
Identity = 53/178 (29.78%), Postives = 82/178 (46.07%), Query Frame = 3
Query:  477 IITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTS-VNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDS 1007
            +  L+  N + Q   Q R T+ T     SSRSH ++  ++   N  T  +T  +L + DLAG E+ S    E  R   M E   IN SLS L  +I           +L  + + +P+R+SKLT  L+    GD+   +++ V+     +  T   L   Q   + ELG+    KTD+
Sbjct:  257 VTNLDEVNEIFQLGKQNRATAFTDMNEHSSRSHALLCATVIGVNRTTGARTIGKLNLVDLAGSERVSKSGSEGAR---MKEAQNINKSLSSLGDVIH----------NLKNKSAHVPYRNSKLTYLLQESLGGDSKTLMVVQVAPVEKNVGETVCSLNFAQRVRAVELGQ-ATRKTDN 420          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO39270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAG0])

HSP 1 Score: 50.8322 bits (120), Expect = 2.537e-15
Identity = 37/122 (30.33%), Postives = 65/122 (53.28%), Query Frame = 1
Query:   73 KSLKT-NSKTGDEVKVYQFNKIFNNESSHIDISN-NFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKR----FKIDVSFLEFYNDNLICLLSEKK 420
            KSL+  N + G  ++ YQF+  FN++S+  +I   +    +  +++G N  +  +G +G+GKTHT++G    E G+    V  +   +  E  K     F+I  S+LE Y + +  LL+ KK
Sbjct:   53 KSLEVWNWRNGSSIQ-YQFDGFFNDQSTQEEIYRFSISPVMQYVLLGENTSVFAYGPTGAGKTHTMLGT-ADEPGVIPRSVCNIFKAIQTEKAKSPSWNFEITFSYLEIYQEKVNDLLNTKK 172          

HSP 2 Score: 48.521 bits (114), Expect = 2.537e-15
Identity = 42/177 (23.73%), Postives = 83/177 (46.89%), Query Frame = 3
Query:  429 KDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSF-CXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTS-VNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLG 953
            +D    I I +  + SI +  +++ + +  +Q R T+AT      S    +++I  ++ +    F K   ++ + DLAG E       E +R   + E+  IN SL  L Q+++  N  + +          +P+R+SKLT+ L+    G A+  +I +++ +P   + T   L+  
Sbjct:  179 QDREGSIFIPELSEISIKSFEDFDAVFKDASQNRTTAATKLNPHSSRSHSILLIKVVRGQQVAPFRKLTGKMYLVDLAGSEDNRRTGNEGIR---LKESGAINGSLFALGQVVDALNTGQPR----------VPYRNSKLTRLLQDSLGGSAHTCVIANIAPEPDLYYDTLNTLKFA 342          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO49145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH21])

HSP 1 Score: 57.3806 bits (137), Expect = 4.940e-9
Identity = 34/110 (30.91%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  112 KVYQFNKIFNNESSHIDISNNF-QGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSE---------CGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLS 411
            K + F+K+F   S  ID+       ++++++ GYN  +  +G +G+GKT+T+ G+   E          GI    + +L + +N +    F + VSFLE YN+ L  LLS
Sbjct:   57 KTFTFDKVFAPNSKQIDVYKAVVMPTLDEVLQGYNCTIFAYGQTGTGKTYTMEGEKSEENLSWDQDPLAGIIPRTMHQLFERLNSQTDCEFSVRVSFLEIYNEELFDLLS 166          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO31606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF7])

HSP 1 Score: 56.9954 bits (136), Expect = 6.335e-9
Identity = 40/119 (33.61%), Postives = 55/119 (46.22%), Query Frame = 3
Query:  627 TNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGK 983
            T+S L + DLAG E+ S        Q + E   IN SLS L Q+   F   +    H+       P+R+SKLTQ L+    GD    + ++VS     +  T   LQ G  A   +LGK
Sbjct:  700 THSTLTLVDLAGSERISKT--EATGQRLVEAAAINKSLSALGQV---FTALRTNAMHV-------PYRNSKLTQLLQGSLGGDGKACMFVNVSPAEWNLSETISTLQFGAGAKQVQLGK 806          

HSP 2 Score: 54.6842 bits (130), Expect = 3.176e-8
Identity = 28/101 (27.72%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  112 KVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSE 414
            K + F+++F  +S+   +  +    I   + GYNVC++ +G +G+GKT T++G  +   G++   + +L+   N+     + + ++ LE YN+ L  LL E
Sbjct:  523 KTFMFDRVFTPDSTQEQVFEDTLPLIASCVDGYNVCIMAYGQTGAGKTFTMMGP-EDNPGVNVRSILELLRVCNERPNVDYTLSLAMLEVYNETLKDLLEE 622          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO31386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY31])

HSP 1 Score: 55.8398 bits (133), Expect = 1.444e-8
Identity = 35/108 (32.41%), Postives = 62/108 (57.41%), Query Frame = 1
Query:  115 VYQFNKIFNNESSHIDISNNFQGS-INQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN*KI 435
            VY F+++F+  +S  D+  +F    I  ++ G+N  +  +G + SGKTHT++GD  S  GI    + ++   +++   + F + VS++E YN+ +  LLS  K N KI
Sbjct:   41 VYAFDQVFDQITSTEDVYGSFAKPVILSVMEGFNGTIFAYGQTASGKTHTMMGD-DSCPGIIPQAIDEIFTYIDQHPNREFCLVVSYMEIYNEVITDLLSTNKKNLKI 147          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: si:dkey-96l17.6 (kinesin-like protein KIN-14E [Source:NCBI gene;Acc:105354761])

HSP 1 Score: 63.5438 bits (153), Expect = 1.478e-10
Identity = 47/136 (34.56%), Postives = 75/136 (55.15%), Query Frame = 1
Query:    1 RIR-MFQNKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDF-QSECGISTFLVGKLIDEMNKEHRKRFKIDVS--FLEFYNDNL 396
            R+R M +N+  +   +FV  +KI   S+   +  G  ++ +QF+K+F  E+S  ++  +    I  +I GYNVC+  +G +GSGKT T+VGD  Q   GI       + D + +E+  +F+  VS   LE YND L
Sbjct:  280 RLRPMNRNEAGQGGTAFV--EKIDDYSVSVETPRG--LREFQFDKVFGAEASQDEVFQDTSRLIQSVIDGYNVCIFAYGQTGSGKTFTMVGDKDQRNPGIMPRSFNAIFD-ITRENSSKFEFKVSAYMLELYNDRL 410          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 60.4622 bits (145), Expect = 1.431e-9
Identity = 39/133 (29.32%), Postives = 71/133 (53.38%), Query Frame = 1
Query:   19 NKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEM-NKEHRKRFKIDVSFLEFYNDNLICLLSE 414
            + + +++ SF ++D   +  L    KT      ++ +KIF  +++  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G  + + GI+   +  L DE+  K     ++I VS +E YN+ L  LL E
Sbjct:  580 SADAKTLLSFDSEDD-AVLYLSNKGKT----MTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VEGDPGINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRE 706          

HSP 2 Score: 51.9878 bits (123), Expect = 7.221e-7
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQI-HSTCKI 941
            T  +T  RL + DLAG E+  +         + E   IN SLS L  +I   +  + KH H+       PFR+S+LT  L+    GD+   +++ VS  P  +  S C +
Sbjct:  780 TGTRTQGRLNLVDLAGSER--IGKSGAEGSRLREAQCINKSLSALGDVI---SALRGKHAHV-------PFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSL 877          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 60.077 bits (144), Expect = 1.914e-9
Identity = 39/131 (29.77%), Postives = 70/131 (53.44%), Query Frame = 1
Query:   25 NTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEM-NKEHRKRFKIDVSFLEFYNDNLICLLSE 414
            + +++ SF ++D   +  L    KT      ++ +KIF  +++  ++    Q  +   I G+NVC+  +G +GSGKT+T+ G  + + GI+   +  L DE+  K     ++I VS +E YN+ L  LL E
Sbjct:  476 DAKTLLSFDSEDD-AVLYLSNKGKT----MTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEG-VEGDPGINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRE 600          

HSP 2 Score: 51.9878 bits (123), Expect = 6.877e-7
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 3
Query:  615 TFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQI-HSTCKI 941
            T  +T  RL + DLAG E+  +         + E   IN SLS L  +I   +  + KH H+       PFR+S+LT  L+    GD+   +++ VS  P  +  S C +
Sbjct:  674 TGTRTQGRLNLVDLAGSER--IGKSGAEGSRLREAQCINKSLSALGDVI---SALRGKHAHV-------PFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSL 771          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: si:dkey-96l17.6 (kinesin-like protein KIN-14E [Source:NCBI gene;Acc:105354761])

HSP 1 Score: 59.3066 bits (142), Expect = 2.005e-9
Identity = 47/139 (33.81%), Postives = 76/139 (54.68%), Query Frame = 1
Query:    1 RIR-MFQNKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGS--INQLIVGYNVCLIHFGTSGSGKTHTVVGDF-QSECGISTFLVGKLIDEMNKEHRKRF---KIDVSFLEFYNDNL 396
            R+R M +N+  +   +FV  +KI   S+   +  G  ++ +QF+K+F  E+S  ++   FQ +  I  +I GYNVC+  +G +GSGKT T+VGD  Q   GI       + D + +E+  +F   ++    LE YND L
Sbjct:   16 RLRPMNRNEAGQGGTAFV--EKIDDYSVSVETPRG--LREFQFDKVFGAEASQDEV---FQDTSLIQSVIDGYNVCIFAYGQTGSGKTFTMVGDKDQRNPGIMPRSFNAIFD-ITRENSSKFEFKQVSAYMLELYNDRL 146          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:101163027])

HSP 1 Score: 58.151 bits (139), Expect = 8.407e-9
Identity = 34/103 (33.01%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  112 KVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRK---RFKIDVSFLEFYNDNLICLLS 411
            +V++ +K+F  +++  +I    +  +   I GY+VC+  +G +GSGKTHT+ G  ++  GI+   +  L  E+  E RK    + + VS +E YN+ L  LLS
Sbjct:  622 RVFELDKVFQPQATQEEIFQEIEPLVTSSIDGYHVCIFAYGQTGSGKTHTMEGTVENP-GINQRALKHLFHEI--EERKDMWSYNVSVSSVEIYNEVLRDLLS 721          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000046507.1 (SMESG000046507.1)

HSP 1 Score: 373.629 bits (958), Expect = 2.717e-125
Identity = 205/208 (98.56%), Postives = 207/208 (99.52%), Query Frame = 3
Query:  414 KENQLKDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCXXXXXXXXXXXXXXXXXXXXTFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICLSKYIR 1037
            K+ +LKDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCSQSSRSHLIIIISIKSENTITFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICLSKYIR
Sbjct:  404 KKIKLKDTGKKILIDDYVKESIITLNNYNRLLQQVAQKRQTSATSFCSQSSRSHLIIIISIKSENTITFVKTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPICHKTDSGSICLSKYIR 611          

HSP 2 Score: 289.656 bits (740), Expect = 1.300e-92
Identity = 145/149 (97.32%), Postives = 145/149 (97.32%), Query Frame = 1
Query:    1 RIRMFQNKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN*KILGKK 447
            RIRMFQNKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKI  K  GKK
Sbjct:  266 RIRMFQNKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIKLKDTGKK 414          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000049581.1 (SMESG000049581.1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.340e-18
Identity = 51/120 (42.50%), Postives = 68/120 (56.67%), Query Frame = 3
Query:  624 KTNSRLIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGK 983
            + +S LI CDLAG E ++  IE     +  ET +IN SL  LS++ E           L  +KS +P+R SKLT  LKPC  G A C LII +S D  +++ + K LQ GQTAM   +GK
Sbjct:  585 RRSSSLIFCDLAGSE-SAEKIE-ANDAFKVETGHINRSLVALSRVFE----------CLRNQKSPIPYRDSKLTHLLKPCLGGQAKCLLIITISGDLCKVNRSIKALQFGQTAMDIAVGK 692          

HSP 2 Score: 55.4546 bits (132), Expect = 4.247e-8
Identity = 33/98 (33.67%), Postives = 55/98 (56.12%), Query Frame = 1
Query:   31 ESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLID 324
            ES + F  +DKI I         GDE   Y FN++   ES++ +I +  +  I+  I G+NVC + +G +GSGKT+T+ G  + + G++   + +L D
Sbjct:  387 ESSWGFKGNDKIRIPE-ACQLPRGDE-GCYTFNRVLRPESTNREIFDETKSLISSCIDGFNVCFLAYGPTGSGKTYTMQGT-REDPGLTLRTIAELSD 481          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000030838.1 (SMESG000030838.1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.877e-11
Identity = 37/109 (33.94%), Postives = 61/109 (55.96%), Query Frame = 1
Query:   91 SKTGDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVS--FLEFYNDNLICLLS 411
            SK G + K +QF+++F  E    D+  +    I     GYNVC+  +G +GSGKTHT++G+ Q+  GI+     +L + M  E + +F   +    LE YN+ L+ L++
Sbjct:  532 SKDG-KPKEFQFDRVFPPEIGQDDVFEDTSRLIQSAFDGYNVCIFAYGQTGSGKTHTLIGNLQNAPGIAPRSFVRLFEVMT-EGKAKFSATLKCYMLELYNEKLLDLMT 638          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000003250.1 (SMESG000003250.1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.608e-11
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  639 LIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKP 986
            L++CDLAG E  +    ++ +  M E+ YI+ SL+VL ++ E           L  +   +PFR SKLT  LKP   GDA    I+ +S     ++++ ++L L +      LG+P
Sbjct:  664 LMLCDLAGSENCT---SSLSENSMTESKYISKSLTVLGRVFEA----------LYNKLLVIPFRDSKLTHILKPSLSGDAKFAFIVTISGKTENLNNSIRVLNLAKKVAQISLGQP 766          

HSP 2 Score: 58.9214 bits (141), Expect = 3.550e-9
Identity = 34/99 (34.34%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  115 VYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLS 411
            +Y FN++F    S  +I +  +  I   + GYNV +I +G SGSGKT T++G  + E G+ T  + ++     +     FKI +S LE YN+ +  LL+
Sbjct:  481 IYNFNRVFKPSCSQPEIFSEVRQLITSFVDGYNVNMITYGQSGSGKTFTMIGT-KEEPGLVTHSIREVFKLCKQRSSWSFKICLSVLEIYNETIFDLLT 578          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000003819.1 (SMESG000003819.1)

HSP 1 Score: 63.5438 bits (153), Expect = 9.078e-11
Identity = 30/106 (28.30%), Postives = 64/106 (60.38%), Query Frame = 1
Query:  100 GDEVKVYQFNKIFNNESSHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGISTFLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEK 417
            G   K + F+++F  +S  I++       I   + GYNVC++ +G +GSGKTHT++G  Q E G++   + +L++  +   + ++++ +S +E Y +++  +L++K
Sbjct:  423 GKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQ-EPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADK 527          

HSP 2 Score: 50.447 bits (119), Expect = 1.596e-6
Identity = 33/109 (30.28%), Postives = 51/109 (46.79%), Query Frame = 3
Query:  639 LIICDLAGFEKTSVNIENMRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKLTQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAM 965
            L +CDLAG E  +V       +  +E   IN SL+ L ++ +    +        Q+ S   +R +KLT  LKP   GD+ C L ++V  +P     T + +  G  AM
Sbjct:  606 LTLCDLAGSE--NVTKSGATGERFNEATCINKSLTTLGRVFDSLRNH--------QKPS---YRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAM 701          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIFC37.417e-928.87kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIF221.292e-828.57kinesin family member 22 [Source:HGNC Symbol;Acc:H... [more]
KIFC31.449e-828.87kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC31.600e-828.87kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC31.600e-828.87kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-184.821e-1134.48Kinesin-like protein; Kinesin-like protein-18 [So... [more]
bmk-11.828e-925.71Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
bmk-11.828e-925.71Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
bmk-11.873e-925.71Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
bmk-11.873e-925.71Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncd3.898e-929.13gene:FBgn0002924 transcript:FBtr0344976[more]
ncd3.898e-929.13gene:FBgn0002924 transcript:FBtr0085534[more]
Klp64D1.329e-826.62gene:FBgn0004380 transcript:FBtr0077157[more]
Khc1.310e-635.09gene:FBgn0001308 transcript:FBtr0087184[more]
Klp67A1.777e-626.00gene:FBgn0004379 transcript:FBtr0333886[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-96l17.68.549e-935.79si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
si:dkey-96l17.61.100e-835.79si:dkey-96l17.6 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
kifc34.140e-831.31kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc34.158e-831.31kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc34.334e-831.31kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc32.025e-1525.74kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc32.431e-1527.93kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc32.772e-1527.93kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc32.945e-1527.27kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc33.297e-1527.27kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kifc32.512e-929.58kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc32.692e-929.58kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc32.891e-929.58kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc32.984e-929.58kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kif13b8.502e-835.62kinesin family member 13B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07970|KN14C_ARATH5.123e-2134.12Kinesin-like protein KIN-14C OS=Arabidopsis thalia... [more]
sp|F4JGP4|KN14D_ARATH1.324e-1934.12Kinesin-like protein KIN-14D OS=Arabidopsis thalia... [more]
sp|Q7Y1C8|KN14G_ORYSJ5.109e-1730.27Kinesin-like protein KIN-14G OS=Oryza sativa subsp... [more]
sp|A3BFT0|KN14N_ORYSJ1.320e-1632.35Kinesin-like protein KIN-14N OS=Oryza sativa subsp... [more]
sp|F4I1T9|KN14T_ARATH3.609e-1534.34Kinesin-like protein KIN-14T OS=Arabidopsis thalia... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183VSE01.841e-2532.81Kinesin motor domain-containing protein OS=Trichob... [more]
A0A074ZP053.952e-2332.48Kinesin motor domain-containing protein OS=Opistho... [more]
A0A1S3JJA75.097e-2232.42Kinesin-like protein OS=Lingula unguis OX=7574 GN=... [more]
A0A1S3IW309.553e-2231.87Kinesin-like protein OS=Lingula unguis OX=7574 GN=... [more]
A0A183AIW12.497e-2127.97Kinesin motor domain-containing protein OS=Echinos... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc37.734e-1727.48kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc37.861e-1727.48kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc32.068e-1627.87kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc33.373e-1627.48kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc33.878e-1628.80kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc37.118e-1829.00kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000010492.18.908e-1028.00pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 ... [more]
ENSPMAT00000005274.16.519e-932.10pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 ge... [more]
ENSPMAT00000005277.17.527e-932.10pep scaffold:Pmarinus_7.0:GL482849:207:11964:-1 ge... [more]
kif61.005e-829.13kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR31.210e-1030.89Minus-end-directed microtubule motor; functions in... [more]
KIP11.554e-831.82Kinesin-related motor protein; required for mitoti... [more]
KIP24.592e-830.70Kinesin-related motor protein involved in mitotic ... [more]
KIP33.359e-630.48Kinesin-related antiparallel sliding motor protein... [more]
CIN86.509e-629.23Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO459504.073e-1827.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392702.537e-1530.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491454.940e-930.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316066.335e-933.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313861.444e-832.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-96l17.61.478e-1034.56kinesin-like protein KIN-14E [Source:NCBI gene;Acc... [more]
kifc31.431e-929.32kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
kifc31.914e-929.77kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
si:dkey-96l17.62.005e-933.81kinesin-like protein KIN-14E [Source:NCBI gene;Acc... [more]
si:ch211-257p13.38.407e-933.01kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046507.12.717e-12598.56SMESG000046507.1[more]
SMESG000049581.15.340e-1842.50SMESG000049581.1[more]
SMESG000030838.12.877e-1133.94SMESG000030838.1[more]
SMESG000003250.14.608e-1131.90SMESG000003250.1[more]
SMESG000003819.19.078e-1128.30SMESG000003819.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014998 ID=SMED30014998|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1092bp
AGAATTCGCATGTTTCAAAACAAAAATACAGAATCCATATTTTCTTTTGT
TACTGACGACAAAATTGGCATAAAATCATTGAAAACAAACAGTAAAACTG
GAGATGAAGTTAAAGTTTATCAATTTAATAAAATTTTTAATAATGAAAGC
AGTCATATTGATATTTCTAACAACTTTCAAGGATCTATCAATCAGTTAAT
TGTCGGTTATAATGTTTGTTTGATCCATTTTGGAACTTCGGGATCTGGCA
AAACTCACACTGTTGTAGGGGATTTTCAAAGCGAATGTGGGATCAGCACA
TTTCTGGTAGGCAAATTGATTGACGAAATGAATAAAGAACACAGAAAACG
TTTTAAAATTGATGTATCATTTCTCGAATTTTACAATGACAATTTAATCT
GTTTATTAAGTGAAAAGAAAATCAATTAAAAGATACTGGGAAAAAAATTC
TAATTGACGATTATGTTAAAGAGTCTATAATAACTCTAAATAACTATAAT
AGGCTTCTACAACAAGTGGCACAAAAACGGCAAACCAGTGCAACGTCATT
TTGTTCTCAATCATCTAGATCCCATCTCATTATTATTATATCTATCAAAT
CTGAAAATACAATTACTTTTGTTAAAACTAATAGTCGACTAATAATTTGC
GACTTAGCTGGATTTGAAAAAACCTCGGTTAATATTGAGAATATGAGAAA
GCAATACATGGATGAAACGTATTATATTAATAATTCATTGTCAGTATTGA
GTCAGATTATTGAAGAATTTAATTTGTACAAGTTAAAACATGAACATTTG
ACACAAAGAAAATCAACATTACCATTTAGGTCGAGTAAATTAACTCAATT
TCTAAAACCATGCTTCTTTGGAGATGCCTATTGTTATTTAATTATACATG
TTTCAAATGATCCAGTTCAGATTCATTCAACTTGTAAAATCCTTCAGTTA
GGCCAAACTGCCATGTCAACTGAATTAGGTAAACCGATTTGCCATAAAAC
AGATTCAGGTTCAATTTGTTTATCAAAATACATAAGATAGTGATGTTTTT
TAAAAATAGTTTTCATGTTACTATTTAAAAACGGAGATCGGA
back to top

protein sequence of SMED30014998-orf-1

>SMED30014998-orf-1 ID=SMED30014998-orf-1|Name=SMED30014998-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp
RIRMFQNKNTESIFSFVTDDKIGIKSLKTNSKTGDEVKVYQFNKIFNNES
SHIDISNNFQGSINQLIVGYNVCLIHFGTSGSGKTHTVVGDFQSECGIST
FLVGKLIDEMNKEHRKRFKIDVSFLEFYNDNLICLLSEKKIN*
back to top

protein sequence of SMED30014998-orf-2

>SMED30014998-orf-2 ID=SMED30014998-orf-2|Name=SMED30014998-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MRKQYMDETYYINNSLSVLSQIIEEFNLYKLKHEHLTQRKSTLPFRSSKL
TQFLKPCFFGDAYCYLIIHVSNDPVQIHSTCKILQLGQTAMSTELGKPIC
HKTDSGSICLSKYIR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: molecular function
TermDefinition
GO:0008569ATP-dependent microtubule motor activity, minus-end-directed
GO:0005524ATP binding
GO:0003777microtubule motor activity
GO:0008017microtubule binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR001752Kinesin_motor_dom
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 1..139
e-value: 2.6E-23
score: 82.5
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 1..143
score: 19.754
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..143
e-value: 5.4E-24
score: 86.6
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 17..140