AGAP013516-RB

Overview
NameAGAP013516-RB
Smed IDSMED30014989
Length (bp)1775
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AGAP013516-RB (SMED30014989) t-SNE clustered cells

Violin plots show distribution of expression levels for AGAP013516-RB (SMED30014989) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AGAP013516-RB (SMED30014989) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AGAP013516-RB (SMED30014989) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014989

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014989SMESG000056770.1 dd_Smed_v4_2589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014989SMESG000056770.1 dd_Smed_v4_2589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014989SMESG000056770.1 dd_Smed_v4_2589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014989SMESG000056770.1 SMESG000037569.1 OX_Smed_1.0.01515ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
gutSMED30014989SMESG000056770.1 SMED30014989smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30014989SMESG000056770.1 SMED30014989smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30014989SMESG000056770.1 SMED30014989smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AGAP013516-RB vs. Ensembl Human
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:HGNC Symbol;Acc:HGNC:6859])

HSP 1 Score: 175.637 bits (444), Expect = 1.075e-47
Identity = 101/267 (37.83%), Postives = 147/267 (55.06%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL+
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQ 299          
BLAST of AGAP013516-RB vs. Ensembl Human
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:HGNC Symbol;Acc:HGNC:6859])

HSP 1 Score: 175.252 bits (443), Expect = 2.164e-47
Identity = 101/267 (37.83%), Postives = 147/267 (55.06%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL+
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQ 299          
BLAST of AGAP013516-RB vs. Ensembl Human
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:HGNC Symbol;Acc:HGNC:6859])

HSP 1 Score: 175.637 bits (444), Expect = 4.422e-47
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. Ensembl Human
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:HGNC Symbol;Acc:HGNC:6859])

HSP 1 Score: 175.637 bits (444), Expect = 7.021e-47
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. Ensembl Human
Match: MAP3K20 (mitogen-activated protein kinase kinase kinase 20 [Source:HGNC Symbol;Acc:HGNC:17797])

HSP 1 Score: 130.568 bits (327), Expect = 5.018e-32
Identity = 87/262 (33.21%), Postives = 129/262 (49.24%), Query Frame = 2
Query:  110 DPDFFK---GGSYGSVQR---ISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            D  FF+   GGS+GSV R   IS +  E AVK     E       E E LS  +H NI++ YG     P+ G       + E+A  GSL + ++   +    +   + W    A+G+ YLH      ++HRD+K  N+++   G V+K+CDFG  +    T + +  GT+ +MAPEV+ S+       +E CD YS  ++LWE+L R+ PFK       +   VV K ERL     CP     L+  CW+   K+RP    +
Sbjct:   15 DLQFFENCGGGSFGSVYRAKWISQDK-EVAVKKLLKIEK------EAEILSVLSHRNIIQFYGVILEPPNYG------IVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADG-VLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLP-----VSETCDTYSYGVVLWEMLTREVPFKGL-EGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQI 256          
BLAST of AGAP013516-RB vs. Ensembl Celegans
Match: mom-4 (Mitogen-activated protein kinase kinase kinase mom-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTC6])

HSP 1 Score: 120.939 bits (302), Expect = 8.737e-29
Identity = 73/218 (33.49%), Postives = 117/218 (53.67%), Query Frame = 2
Query:  251 NHENIVKLYG--AGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFK---NAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSII 889
            NH NI+K+YG    P  G       +ME+   GS+ +LL+++ ++NYT+    +W+ Q +  V + H   S+  +HRD+K  N+LL +    +KLCDFGT  S+ Q+  T++ GT + MAPEV      R   YN K D+YSI II+W+I+ R  P++   + P     ++T  ++ + L+    C   L    K CW      RP  S+  E  +++
Sbjct:  106 NHPNIIKIYGLYKSPRNG----QGVVMEYMDCGSMADLLYDRTHINYTIDHVASWMFQLSSAVDFFH---SNSQVHRDLKLQNMLLSDRYRTMKLCDFGTFTSMHQSM-TSNRGTPITMAPEVF-----RCEQYNMKSDIYSIGIIMWQIIARNHPYRRDLSVPGLLYNVATANLRPQELE----CNPILSEFYKKCWNDNADIRPTSSECVEYFTLL 306          
BLAST of AGAP013516-RB vs. Ensembl Celegans
Match: zak-1 (Mammalian ZAK kinase homolog [Source:UniProtKB/TrEMBL;Acc:H2KZW3])

HSP 1 Score: 117.087 bits (292), Expect = 3.629e-27
Identity = 78/274 (28.47%), Postives = 139/274 (50.73%), Query Frame = 2
Query:   86 ELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYG----AGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLN-------WVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADS--GTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            ++ +D ++  D    G++G+V   +    + + +   L++ +     E E LS+  H+NI++ YG     G D       + + E+A  GSL + +H + + ++  + G N       W  Q A G++YLH      I+HRD+K  N++L +   V K+CDFGT K +  +  TA S  GT  +M+PE++     +        DV+S  ++LWEIL ++ P+K+  + F I + +      L   P CP  L++L+  CWK   K+R ++  +
Sbjct:   25 DIQRDDIQVGDHIGVGTFGAVFSGNWTLPDGSQRTIALKKVFVLE-KEAEILSKIRHKNIIQFYGICKATGNDF------FIVTEYAEKGSLYDFIHSEESQSFASSSGGNSFDVVVKWASQIASGIQYLHYDAVDTIIHRDLKSKNVVL-DKNLVCKICDFGTSKDLTHS-CTAPSWGGTAAWMSPEMIL----QSEGLTTATDVWSYGVVLWEILSKEVPYKDY-SEFRIFTMITQSGITLAIPPSCPAPLKQLMSNCWKMTPKDRANMRQI 284          
BLAST of AGAP013516-RB vs. Ensembl Celegans
Match: dlk-1 (Mitogen-activated protein kinase kinase kinase dlk-1 [Source:UniProtKB/Swiss-Prot;Acc:O01700])

HSP 1 Score: 107.071 bits (266), Expect = 3.304e-24
Identity = 79/264 (29.92%), Postives = 130/264 (49.24%), Query Frame = 2
Query:   86 ELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYF-RLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADS--GTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            E+  D + + ++   GS G+V R  + N   AVK   +L+E       E++ L    H+NI++  G          +  +ME+   G L  +L  +  +   L     WV + A+G+ YLH    + ++HRD+K  N+L+ +    +K+CDFGT    ++ ++T  S  GT  +MAPE++     +K   NEK DVYS  ++LWE+L R+ P+ N     +I+  V      L      P+ L  LIK C   + + RP  S +
Sbjct:  129 EIPFDAISELEWLGSGSQGAVFRGQLENRTVAVKKVNQLKE------TEIKHLRHLRHQNIIEFLGV---CSKSPCYCIVMEYCSKGQLCTVLKSRNTITRELF--AQWVKEIADGMHYLH---QNKVIHRDLKSPNILI-SAEDSIKICDFGTSHMQKKMDSTMMSFCGTVSWMAPEMI-----KKQPCNEKVDVYSFGVVLWEMLTRETPYANIAQ-MAIIFGVGTNILSLPMPEEAPKGLVLLIKQCLSQKGRNRPSFSHI 371          
BLAST of AGAP013516-RB vs. Ensembl Celegans
Match: Y105C5A.24 (pep chromosome:WBcel235:IV:15849875:15852905:1 gene:WBGene00013643.1 transcript:Y105C5A.24.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y105C5A.24)

HSP 1 Score: 106.301 bits (264), Expect = 4.081e-24
Identity = 80/295 (27.12%), Postives = 132/295 (44.75%), Query Frame = 2
Query:   80 DIELSKDIVKDPD---------FFKGGSYGSVQRISMNNIECAVKYFRLREHYQK----NFAEVESLSRC-----------NHENIVKLYGA------GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCE 874
            D+ L+ DI K P          F   G++G V++          KY + R+   +     +A    LS             NH NI+K+YG       G  L        +ME+   G + +L++++ N+ Y +    +W++Q +  V + H+      +HRD+K  N+LL +    +K+CDFGT  S+ Q+  T++ G+ + MAPE+      R   YN K D++SI II+W+++ R  P+         +  V  +  R  +I  C   L    K CW      RP  +D  E
Sbjct:   26 DLCLTSDIPKIPPNCIDELNSHFLGKGTFGVVEK---------TKYRKTRDDTYRPAAIKYASATHLSILKREAKHMWNLRNHVNIIKIYGMYESHRNGQGL--------VMEYMDCGCVADLIYDRKNIEYKMDHVASWMYQLSSAVNFFHSKDQ---IHRDLKLQNMLLSHHHRTLKICDFGTFTSIHQSM-TSNRGSPITMAPEIF-----RCEPYNMKADIFSIGIIMWQMIARDHPYTMNMPITPFLYNVATRNLRPHEI-ECNPILSNFYKRCWSDNPASRPTSADCVE 293          
BLAST of AGAP013516-RB vs. Ensembl Celegans
Match: dlk-1 (Mitogen-activated protein kinase kinase kinase dlk-1 [Source:UniProtKB/Swiss-Prot;Acc:O01700])

HSP 1 Score: 107.071 bits (266), Expect = 7.486e-24
Identity = 81/265 (30.57%), Postives = 132/265 (49.81%), Query Frame = 2
Query:   86 ELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYF-RLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTL-AQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADS--GTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            E+  D + + ++   GS G+V R  + N   AVK   +L+E       E++ L    H+NI++  G          +  +ME+   G L  +L  +  +   L AQ   WV + A+G+ YLH    + ++HRD+K  N+L+ +    +K+CDFGT    ++ ++T  S  GT  +MAPE++     +K   NEK DVYS  ++LWE+L R+ P+ N     +I+  V      L      P+ L  LIK C   + + RP  S +
Sbjct:   56 EIPFDAISELEWLGSGSQGAVFRGQLENRTVAVKKVNQLKE------TEIKHLRHLRHQNIIEFLGV---CSKSPCYCIVMEYCSKGQLCTVLKSRNTITRELFAQ---WVKEIADGMHYLH---QNKVIHRDLKSPNILI-SAEDSIKICDFGTSHMQKKMDSTMMSFCGTVSWMAPEMI-----KKQPCNEKVDVYSFGVVLWEMLTRETPYANIAQ-MAIIFGVGTNILSLPMPEEAPKGLVLLIKQCLSQKGRNRPSFSHI 298          
BLAST of AGAP013516-RB vs. Ensembl Fly
Match: Tak1 (gene:FBgn0026323 transcript:FBtr0077319)

HSP 1 Score: 189.119 bits (479), Expect = 1.254e-51
Identity = 106/265 (40.00%), Postives = 149/265 (56.23%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            GSYG V +    +   AVK F      +    EV+ LSR  H NI+ L+G      A    Y IMEFA  GSL+  LH K    Y+LA  ++W  QCAEG+ YLH     P++HRD+KP NLLL N G  +K+CDFGTV   + T  T + G+  +MAPEV    K     Y EKCD++S AI+LWE+L R++PFK   NA++I   +  K ER   +  CP++++ L+  CWK   ++RP +  +   +  I++    A + LE
Sbjct:   28 GSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKEVKQLSRVKHPNIIALHGISSYQQAT---YLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVAD-KSTMMTNNRGSAAWMAPEVFEGSK-----YTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIY-KGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGADKALE 282          
BLAST of AGAP013516-RB vs. Ensembl Fly
Match: Takl1 (gene:FBgn0046689 transcript:FBtr0083996)

HSP 1 Score: 160.614 bits (405), Expect = 1.857e-43
Identity = 95/262 (36.26%), Postives = 143/262 (54.58%), Query Frame = 2
Query:  119 FFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVE--SLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTAD-SGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPF---KNAPNAFSIMSTVV------IKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            F   GS G+V++ +  N E AVK F   E   K  AE E   LS  +HEN++++ G   +    K  Y +ME+   GSL+  L+      YT+ Q + W  QCA+ + YLH S   PI+HRDIKP N+LL+N    +K+CDFG   +   + N  D  GT  YMAPE +  +K     Y  KCDVYS  I+LWE++ RQ P+   +N  + ++IM  +       ++  R D    CPE +++L++CC     ++RP + ++
Sbjct:   16 FLGAGSGGAVRKATFQNQEIAVKIFDFLEETIKKNAEREITHLSEIDHENVIRVIGRASNG---KKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLH-SLDRPIVHRDIKPQNMLLYNQHEDLKICDFGL--ATDMSNNKTDMQGTLRYMAPEAIKHLK-----YTAKCDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSD----CPEGIKQLMECCMDINPEKRPSMKEI 262          
BLAST of AGAP013516-RB vs. Ensembl Fly
Match: Takl2 (gene:FBgn0039015 transcript:FBtr0302204)

HSP 1 Score: 157.147 bits (396), Expect = 2.065e-43
Identity = 97/266 (36.47%), Postives = 138/266 (51.88%), Query Frame = 2
Query:  104 VKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLD---DIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIIL 892
            ++  +    G YGSV R    N E A+K  R     +K   E+  L++ +H NIV+LYG     G   L   +MEF   GSL+  LH K   +Y+ A   NW HQ A+G+ YLH      ++HRDIKP N LL   G  +K+CDFGTV  + Q+  + ++GT  Y APEV+   K      +EKCDVYS AI  WEIL R++PF+     F +    + + ER D    + GCP  +  L+   W     +R  +  + + +  IL
Sbjct:   13 IQTKELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGTSRHEGCALL---LMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQS-ISCNAGTCRYKAPEVLQGNKP-----DEKCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMELISQSMGRIL 268          
BLAST of AGAP013516-RB vs. Ensembl Fly
Match: wnd (gene:FBgn0036896 transcript:FBtr0302513)

HSP 1 Score: 117.857 bits (294), Expect = 3.303e-27
Identity = 85/279 (30.47%), Postives = 146/279 (52.33%), Query Frame = 2
Query:   80 DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFR-LREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQ-TENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCA 910
            D ++  + + + ++   G+ G+V    + N   AVK  + L+E       +++ L + +HENI+K  G         +   IMEF P+G L  +L E+  +    ++ ++W  Q A G++YLH   SH I+HRD+K  N+L+ +   VVK+ DFGT +   + +   + +GT  +MAPEV+     R    +EK D++S  ++LWE+L  + P+K+  ++ +I+  V     +L     CPE  + L+K CWK + + RP           IL H+D A
Sbjct:  126 DWQIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKVKELKE------TDIKHLRKLDHENIIKFKGV---CTQSPVFCIIMEFCPYGPLQNILKEEQVM--LPSRLVSWSKQIALGMQYLH---SHKIIHRDLKSPNILI-STNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVI-----RNEPCSEKVDIWSYGVVLWEMLTCEIPYKDV-DSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQ-------ILSHLDIA 376          
BLAST of AGAP013516-RB vs. Ensembl Fly
Match: wnd (gene:FBgn0036896 transcript:FBtr0074964)

HSP 1 Score: 117.857 bits (294), Expect = 3.757e-27
Identity = 85/279 (30.47%), Postives = 146/279 (52.33%), Query Frame = 2
Query:   80 DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFR-LREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQ-TENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCA 910
            D ++  + + + ++   G+ G+V    + N   AVK  + L+E       +++ L + +HENI+K  G         +   IMEF P+G L  +L E+  +    ++ ++W  Q A G++YLH   SH I+HRD+K  N+L+ +   VVK+ DFGT +   + +   + +GT  +MAPEV+     R    +EK D++S  ++LWE+L  + P+K+  ++ +I+  V     +L     CPE  + L+K CWK + + RP           IL H+D A
Sbjct:  153 DWQIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKVKELKE------TDIKHLRKLDHENIIKFKGV---CTQSPVFCIIMEFCPYGPLQNILKEEQVM--LPSRLVSWSKQIALGMQYLH---SHKIIHRDLKSPNILI-STNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVI-----RNEPCSEKVDIWSYGVVLWEMLTCEIPYKDV-DSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQ-------ILSHLDIA 403          
BLAST of AGAP013516-RB vs. Ensembl Zebrafish
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-041001-135])

HSP 1 Score: 168.703 bits (426), Expect = 5.458e-45
Identity = 97/267 (36.33%), Postives = 148/267 (55.43%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            G++G V +      + A+K             E+  LSR +H NIVKLYG+  +   L     +ME+A  GSL  +LH  +P  +YT +  ++W  QC++GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V +  R   I   P+ ++ L+  CW     +RP + ++ + +S ++ +   ++EPL+
Sbjct:   34 GAFGVVCKAKWKGRDVAIKTIESESEKNAFIVELRQLSRVDHPNIVKLYGSCNNPVCL-----VMEYAEGGSLYNVLHGAEPLPHYTASHAMSWCLQCSQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHRGTRPPLIKNLPKAIESLMTRCWSKDPSQRPSMEEIVKIMSHLMGYFPGSEEPLK 288          
BLAST of AGAP013516-RB vs. Ensembl Zebrafish
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-041001-135])

HSP 1 Score: 168.703 bits (426), Expect = 7.899e-45
Identity = 97/267 (36.33%), Postives = 148/267 (55.43%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            G++G V +      + A+K             E+  LSR +H NIVKLYG+  +   L     +ME+A  GSL  +LH  +P  +YT +  ++W  QC++GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V +  R   I   P+ ++ L+  CW     +RP + ++ + +S ++ +   ++EPL+
Sbjct:   34 GAFGVVCKAKWKGRDVAIKTIESESEKNAFIVELRQLSRVDHPNIVKLYGSCNNPVCL-----VMEYAEGGSLYNVLHGAEPLPHYTASHAMSWCLQCSQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHRGTRPPLIKNLPKAIESLMTRCWSKDPSQRPSMEEIVKIMSHLMGYFPGSEEPLK 288          
BLAST of AGAP013516-RB vs. Ensembl Zebrafish
Match: zak (sterile alpha motif and leucine zipper containing kinase AZK [Source:ZFIN;Acc:ZDB-GENE-070912-386])

HSP 1 Score: 144.05 bits (362), Expect = 1.392e-37
Identity = 90/259 (34.75%), Postives = 129/259 (49.81%), Query Frame = 2
Query:  128 GGSYGSVQRISM--NNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSII 889
            GGS+GSV R      + E AVK         K  AE E LS  +H+NI++ YGA    P+ G       + E+A  GSL E L    +    + Q + W  + A+G+ YLH      ++HRD+K  N++L     V+K+CDFG  K V  T + +  GT+ +MAPEV+ S+       +E CD YS  ++LWE+L R+ PFK       +   VV K ER      CP     L++ CW  + KERP    +   L  +
Sbjct:   55 GGSFGSVYRAHWVPQDKEVAVKKLL------KIDAEAEILSVLSHKNIIQFYGAILEAPNYG------IVTEYASRGSLYEYLSSADSEEMDMDQVMTWAMEIAKGMHYLHAEAPLKVIHRDLKSRNVVL-TADNVLKICDFGASKMVSHTTHMSLVGTFPWMAPEVIQSLP-----VSETCDTYSYGVVLWEMLTREVPFKGF-EGLQVAWLVVEKHERPTIPSSCPASFADLMRRCWNAEPKERPQFKQILSTLETM 294          
BLAST of AGAP013516-RB vs. Ensembl Zebrafish
Match: zak (sterile alpha motif and leucine zipper containing kinase AZK [Source:ZFIN;Acc:ZDB-GENE-070912-386])

HSP 1 Score: 142.895 bits (359), Expect = 2.089e-36
Identity = 90/259 (34.75%), Postives = 129/259 (49.81%), Query Frame = 2
Query:  128 GGSYGSVQRISM--NNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSII 889
            GGS+GSV R      + E AVK         K  AE E LS  +H+NI++ YGA    P+ G       + E+A  GSL E L    +    + Q + W  + A+G+ YLH      ++HRD+K  N++L     V+K+CDFG  K V  T + +  GT+ +MAPEV+ S+       +E CD YS  ++LWE+L R+ PFK       +   VV K ER      CP     L++ CW  + KERP    +   L  +
Sbjct:   55 GGSFGSVYRAHWVPQDKEVAVKKLL------KIDAEAEILSVLSHKNIIQFYGAILEAPNYG------IVTEYASRGSLYEYLSSADSEEMDMDQVMTWAMEIAKGMHYLHAEAPLKVIHRDLKSRNVVL-TADNVLKICDFGASKMVSHTTHMSLVGTFPWMAPEVIQSLP-----VSETCDTYSYGVVLWEMLTREVPFKGF-EGLQVAWLVVEKHERPTIPSSCPASFADLMRRCWNAEPKERPQFKQILSTLETM 294          
BLAST of AGAP013516-RB vs. Ensembl Zebrafish
Match: zak (sterile alpha motif and leucine zipper containing kinase AZK [Source:ZFIN;Acc:ZDB-GENE-070912-386])

HSP 1 Score: 137.502 bits (345), Expect = 1.371e-33
Identity = 86/247 (34.82%), Postives = 128/247 (51.82%), Query Frame = 2
Query:  128 GGSYGSVQRISM--NNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERP 853
            GGS+GSV R      + E AVK     E       E E LS  +H NI+K YGA    P+ G       + E+A  GSL + L    + + ++ Q + W    A+G+ YLH+     ++HRD+K  N++L +  +V+K+CDFG  K    T + +  GT+ +MAPEV+ S+       +E CD +S  ++LWE+L ++ PFK       +   VV K ERL     CP     L++ CW  + KERP
Sbjct:   24 GGSFGSVYRARWLSQDREVAVKKLLKIE------KEAEILSVLSHRNIIKFYGAILEAPNYG------IVTEYASGGSLFDYLSSDDSEDISMQQIMTWAMDIAKGMHYLHSEAPVKVIHRDLKSRNVVL-SSDSVLKICDFGASKFHSHTTHMSLVGTFPWMAPEVIQSLP-----VSETCDTFSYGVVLWEMLTQEIPFKGL-EGLQVAWLVVEKHERLTIPSSCPASFACLMRSCWATEPKERP 251          
BLAST of AGAP013516-RB vs. Ensembl Xenopus
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:100101764])

HSP 1 Score: 169.859 bits (429), Expect = 5.105e-45
Identity = 105/307 (34.20%), Postives = 163/307 (53.09%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELK-EYPKLPSHNHSSASMSNDENNITHSTENYEVLLELID 1042
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QCA+GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++++   A   L+   +Y      N ++++ S  +   T+++   ++ +E  D
Sbjct:   34 GTFGVVCKAKWRGKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCAQGVAYLHSMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPPQRPSMEEIVKIMTHLMQYFPGADVSLQYPCQYSDEGQSNSATSTGSCIDITSTNTSNKSDINIEAGD 328          
BLAST of AGAP013516-RB vs. Ensembl Xenopus
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:100101764])

HSP 1 Score: 143.28 bits (360), Expect = 2.464e-36
Identity = 103/332 (31.02%), Postives = 161/332 (48.49%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHT-SFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPN-AFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELK-EYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVK 1114
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QCA+GV YLH  SF H                 GTV+K+CDFGT   +Q T  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++++   A   L+   +Y      N ++++ S  +   T+++   ++ +E   G+ +        +  E    QH+K
Sbjct:   34 GTFGVVCKAKWRGKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCAQGVAYLHILSFLH--------------ITGGTVLKICDFGTACDIQ-THMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPPQRPSMEEIVKIMTHLMQYFPGADVSLQYPCQYSDEGQSNSATSTGSCIDITSTNTSNKSDINIEA--GDFQASASNDTIKRIESKLAQHLK 337          
BLAST of AGAP013516-RB vs. Ensembl Xenopus
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:100101764])

HSP 1 Score: 142.895 bits (359), Expect = 8.416e-36
Identity = 99/308 (32.14%), Postives = 153/308 (49.68%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHT-SFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELK-EYPKLPSHNHSSASMSNDENNITHSTENYEVLLELID 1042
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QCA+GV YLH  SF H                 GTV+K+CDFGT   +Q T  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++++   A   L+   +Y      N ++++ S  +   T+++   ++ +E  D
Sbjct:   34 GTFGVVCKAKWRGKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCAQGVAYLHILSFLH--------------ITGGTVLKICDFGTACDIQ-THMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPPQRPSMEEIVKIMTHLMQYFPGADVSLQYPCQYSDEGQSNSATSTGSCIDITSTNTSNKSDINIEAGD 315          
BLAST of AGAP013516-RB vs. Ensembl Xenopus
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:100101764])

HSP 1 Score: 142.895 bits (359), Expect = 1.103e-35
Identity = 99/308 (32.14%), Postives = 153/308 (49.68%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHT-SFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELK-EYPKLPSHNHSSASMSNDENNITHSTENYEVLLELID 1042
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QCA+GV YLH  SF H                 GTV+K+CDFGT   +Q T  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++++   A   L+   +Y      N ++++ S  +   T+++   ++ +E  D
Sbjct:   34 GTFGVVCKAKWRGKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCAQGVAYLHILSFLH--------------ITGGTVLKICDFGTACDIQ-THMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPPQRPSMEEIVKIMTHLMQYFPGADVSLQYPCQYSDEGQSNSATSTGSCIDITSTNTSNKSDINIEAGD 315          
BLAST of AGAP013516-RB vs. Ensembl Xenopus
Match: MAP3K7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:100101764])

HSP 1 Score: 142.895 bits (359), Expect = 1.240e-35
Identity = 103/332 (31.02%), Postives = 161/332 (48.49%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHT-SFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPN-AFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELK-EYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVK 1114
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QCA+GV YLH  SF H                 GTV+K+CDFGT   +Q T  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++++   A   L+   +Y      N ++++ S  +   T+++   ++ +E   G+ +        +  E    QH+K
Sbjct:   34 GTFGVVCKAKWRGKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCAQGVAYLHILSFLH--------------ITGGTVLKICDFGTACDIQ-THMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPPQRPSMEEIVKIMTHLMQYFPGADVSLQYPCQYSDEGQSNSATSTGSCIDITSTNTSNKSDINIEA--GDFQASASNDTIKRIESKLAQHLK 337          
BLAST of AGAP013516-RB vs. Ensembl Mouse
Match: Map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346877])

HSP 1 Score: 175.252 bits (443), Expect = 8.844e-48
Identity = 101/267 (37.83%), Postives = 147/267 (55.06%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL+
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQ 299          
BLAST of AGAP013516-RB vs. Ensembl Mouse
Match: Map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346877])

HSP 1 Score: 175.252 bits (443), Expect = 1.371e-47
Identity = 101/267 (37.83%), Postives = 147/267 (55.06%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL+
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQ 299          
BLAST of AGAP013516-RB vs. Ensembl Mouse
Match: Map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346877])

HSP 1 Score: 175.252 bits (443), Expect = 3.386e-47
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. Ensembl Mouse
Match: Map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346877])

HSP 1 Score: 175.252 bits (443), Expect = 5.216e-47
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. Ensembl Mouse
Match: Map3k20 (mitogen-activated protein kinase kinase kinase 20 [Source:MGI Symbol;Acc:MGI:2443258])

HSP 1 Score: 130.568 bits (327), Expect = 3.398e-32
Identity = 87/262 (33.21%), Postives = 129/262 (49.24%), Query Frame = 2
Query:  110 DPDFFK---GGSYGSVQR---ISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            D  FF+   GGS+GSV R   IS +  E AVK     E       E E LS  +H NI++ YG     P+ G       + E+A  GSL + ++   +    +   + W    A+G+ YLH      ++HRD+K  N+++   G V+K+CDFG  +    T + +  GT+ +MAPEV+ S+       +E CD YS  ++LWE+L R+ PFK       +   VV K ERL     CP     L+  CW+   K+RP    +
Sbjct:   15 DLQFFENCGGGSFGSVYRAKWISQDK-EVAVKKLLKIEK------EAEILSVLSHRNIIQFYGVILEPPNYG------IVTEYASLGSLYDYINSNRSEEMDMEHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADG-VLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLP-----VSETCDTYSYGVVLWEMLTREVPFKGL-EGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQI 256          
BLAST of AGAP013516-RB vs. UniProt/SwissProt
Match: sp|Q9V3Q6|M3K7_DROME (Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster OX=7227 GN=Tak1 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.257e-50
Identity = 106/265 (40.00%), Postives = 149/265 (56.23%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE 925
            GSYG V +    +   AVK F      +    EV+ LSR  H NI+ L+G      A    Y IMEFA  GSL+  LH K    Y+LA  ++W  QCAEG+ YLH     P++HRD+KP NLLL N G  +K+CDFGTV   + T  T + G+  +MAPEV    K     Y EKCD++S AI+LWE+L R++PFK   NA++I   +  K ER   +  CP++++ L+  CWK   ++RP +  +   +  I++    A + LE
Sbjct:   28 GSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKEVKQLSRVKHPNIIALHGISSYQQAT---YLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVAD-KSTMMTNNRGSAAWMAPEVFEGSK-----YTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIY-KGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGADKALE 282          
BLAST of AGAP013516-RB vs. UniProt/SwissProt
Match: sp|Q62073|M3K7_MOUSE (Mitogen-activated protein kinase kinase kinase 7 OS=Mus musculus OX=10090 GN=Map3k7 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.368e-46
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. UniProt/SwissProt
Match: sp|A2VDU3|M3K7_BOVIN (Mitogen-activated protein kinase kinase kinase 7 OS=Bos taurus OX=9913 GN=MAP3K7 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.392e-46
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. UniProt/SwissProt
Match: sp|O43318|M3K7_HUMAN (Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 3.372e-46
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. UniProt/SwissProt
Match: sp|Q5RFL3|M3K7_PONAB (Mitogen-activated protein kinase kinase kinase 7 OS=Pongo abelii OX=9601 GN=MAP3K7 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.833e-46
Identity = 103/272 (37.87%), Postives = 149/272 (54.78%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYP 940
            G++G V +      + A+K        +    E+  LSR NH NIVKLYGA      L     +ME+A  GSL  +LH  +P   YT A  ++W  QC++GV YLH+     ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + ++ ++R+   A EPL   +YP
Sbjct:   45 GAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPL---QYP 301          
BLAST of AGAP013516-RB vs. TrEMBL
Match: A0A5S6QFL9 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.479e-58
Identity = 139/359 (38.72%), Postives = 191/359 (53.20%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPD-LGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAK--------EPLELKE------------YPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVKLLERYVYLN 1141
            G YG+V R     ++ AVKYF+  E  +   AE++ LSR  HENIV+L+G   D  G + L   + E+A  G L  +LH  P VNYT    L+W  QCA+GV YLH+    PI+HRD+K  NLLL   GT+VK+CDFGT   + QT  T + G+  +MAPEV    K     YNEKCDVYS  IILWE+L R+ PF+  A +A+ IM   V  K+R  DI GCPE+L +L+K CW      RP + +V + LS  L               EPL + E            + +LP     +  +  D N         E +   ++ +L+P  P+   +ES  +Y+QHV L +R + L 
Sbjct:   20 GGYGTVYRAHWRGVDVAVKYFQTFEEKKSLKAEIDQLSRVKHENIVRLHGICVDERGPICL---VTEYAECGCLYYILHFWPAVNYTRTHALHWALQCAKGVSYLHSMEPKPIVHRDLKTPNLLLCQRGTLVKICDFGTACDL-QTIMTNNKGSAAWMAPEVFEGSK-----YNEKCDVYSWGIILWELLARRIPFEEMAKSAYQIM-WAVHNKQRPPDISGCPEELNQLMKRCWDADPLARPAMFEVVDALSSFLEAASSVAFPQPLDFDEPLAVDEPVSCCKFITDGHFSQLP----EAPGLVADMNCPIEEDRTVE-MFPTLERHLQPVLPIPGNKESVALYEQHVALCQRLIGLR 363          
BLAST of AGAP013516-RB vs. TrEMBL
Match: A0A087T3N7 (Mitogen-activated protein kinase kinase kinase 7 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_12968 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 4.701e-57
Identity = 117/268 (43.66%), Postives = 156/268 (58.21%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNA--PNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLEL 928
            GS+G+V++    NI+ AVK     +  +    EV+ LSR NH NIVKLYGA            IME+A  GSL ++LH    V YT A  ++W+ Q A GV YLH     P++HRD+KP NLLL N GTV+K+CDFGT    + T  T   G+  +MAPEV        + Y+EKCD++S +IILWE+L RQKPF +     AF IM  V   K R   I GCP+ L+ L+  CW    K+RPD+ +V   LS I ++M  A +P+ L
Sbjct:   24 GSFGTVRKGKWRNIDVAVKVIETEQEKKAFIVEVQQLSRVNHPNIVKLYGASTKQPVC----LIMEYAEGGSLYDVLHVMKQVQYTAAHAISWLLQTANGVAYLHNMKPRPLIHRDLKPPNLLLVNGGTVLKICDFGTACD-KHTNMTNSKGSAAWMAPEVFEG-----SQYSEKCDIFSWSIILWEVLTRQKPFHDGERATAFCIMWAVHNGK-RPPLIQGCPKPLESLMTRCWAKNAKDRPDMIEVQSELSEIFKYMKGADQPITL 280          
BLAST of AGAP013516-RB vs. TrEMBL
Match: A0A1B0DBN5 (Protein kinase domain-containing protein OS=Phlebotomus papatasi OX=29031 PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.258e-53
Identity = 115/284 (40.49%), Postives = 157/284 (55.28%), Query Frame = 2
Query:   86 ELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFA-EVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKE 934
            E++ D +   +    GS+G+V +        AVKY   +EH +  FA EV  LSR  H NIV LYGA      + L   +ME+A  GSL  +LH  P   YT A  ++W  QCA GV YLH     P++HRD+KP NLLL   GTV+K+CDFGTV   + T  T + G+  +MAPEV  S     + Y EKCDV+S  IILWE+L R++PFK   + F+IM + V K  R   I GCP+ ++ L+  CW      RP +S V   +  + +       PLE ++
Sbjct:   15 EVNYDEIDHLEIVGKGSFGTVYKAKWREHFVAVKYIE-QEHERNAFAVEVRQLSRVAHPNIVALYGACTKKPHVCL---VMEYAEGGSLYAVLHCTPKPTYTAAHAMSWARQCALGVAYLHDMSPKPLIHRDLKPPNLLLVQGGTVLKICDFGTVTD-KATLMTNNKGSAAWMAPEVFES-----STYTEKCDVFSWGIILWEVLSREQPFKEIEHTFTIMWS-VHKGHRPPLIEGCPKPIENLMTSCWNPDPSLRPSMSKVVATMEGLCKFFPGGDVPLEYED 287          
BLAST of AGAP013516-RB vs. TrEMBL
Match: A0A2R5LA27 (Putative mitogen-activated protein kinase kinase kinase 7 isoform 1 (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.277e-53
Identity = 122/289 (42.21%), Postives = 165/289 (57.09%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNF-AEVESLSRCNHENIVKLYGAGPDLGALKLHY---YIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSN 982
            G++G V+R      + AVK     +H +K F  EV  LSR  H NIVKL+GA       ++H     +ME+A  GSL  +LH   ++ YT A  ++WV QCA+GV YLH      ++HRD+KP NLLL N GT++K+CDFGT   V QT  T + G+  +MAPEV  SV      Y EKCDV+S  IILWE+L RQKPF++  P AFSIM  V   K R   I GCP  L+ L+  CW     +RP +S+V   + +I ++   A EPL    YP       + +S+ +
Sbjct:   26 GTFGLVRRGRWKGQDVAVKSIE-SDHEKKAFLVEVRQLSRVCHPNIVKLHGA-------RVHCPVCLVMEYAEGGSLYNVLHTMKDIQYTAAHAISWVLQCAKGVAYLHNMKPKALVHRDLKPPNLLLVNGGTILKICDFGTACDV-QTVMTNNKGSAAWMAPEVFESVN-----YTEKCDVFSWGIILWEVLTRQKPFEDCGPPAFSIMWAVHTGK-RPPLIKGCPMSLETLMTRCWLKDPTKRPSMSEVEHKMELISQYFPGADEPL---SYPTPEDSGEAGSSLGS 296          
BLAST of AGAP013516-RB vs. TrEMBL
Match: A0A1B0BHS9 (Protein kinase domain-containing protein OS=Glossina palpalis gambiensis OX=67801 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.446e-53
Identity = 116/285 (40.70%), Postives = 162/285 (56.84%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLH-YYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLE---LKEYPKLPSHNHSSAS 973
            GSYG V +    +   AVK F  +   +    EV+ LSR  H NI+ LYG    L A ++  Y IME+A  GSL + LH K    Y+ A  ++W  QCAEGV YLH     P++HRD+KP NLLL N G ++K+CDFGTV   + T  T + G+  +MAPEV    K     Y EKCD++S  I+LWE+L RQKPFK+  N +SIM  +  K ER   I  CP  ++ L+  CW  + + RP +  V E ++ ++     A+EPLE   + +    P+ N S+A+
Sbjct:   72 GSYGVVYKAIWRDHYVAVKEFGPKAEQKAIETEVKQLSRVQHPNIIALYG----LAANQMSTYLIMEYAEGGSLYDFLHGKAKPYYSTAHAMSWARQCAEGVAYLHAMKPKPLIHRDLKPLNLLLTNRGRLLKICDFGTVAD-KSTLMTNNKGSAAWMAPEVFEGSK-----YTEKCDIFSWGIVLWEVLSRQKPFKDVDNTYSIMWKIH-KGERPPLIADCPRPIENLMTSCWATKPELRPSMQHVVEVMNELVLGFPGAEEPLEYEFVNQQIISPTSNQSTAN 345          
BLAST of AGAP013516-RB vs. Ensembl Cavefish
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:103039333])

HSP 1 Score: 172.555 bits (436), Expect = 2.449e-46
Identity = 108/309 (34.95%), Postives = 164/309 (53.07%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNL 1051
            G++G V +      + A+K             E+  LSR NH NIVKLYG+  +   L     +ME+A  GSL  +LH  +P  +YT +  ++W  QCA+GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V +  R   I   P+ ++ L+  CW     +RP + ++ + +  ++++   ++EPL   +YP    + +S    SN   + T S  +Y       DG++
Sbjct:   34 GAFGVVCKAKWKGKDVAIKTIESESERTAFIVELRQLSRVNHPNIVKLYGSCDNPVCL-----VMEYAEGGSLYNVLHGAEPLPHYTASHAMSWCLQCAQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHRGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMMHLMKYFPGSEEPL---QYP----YQYSDEGQSNSATS-TGSIVDYTSTGNRNDGSM 322          
BLAST of AGAP013516-RB vs. Ensembl Cavefish
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:103039333])

HSP 1 Score: 172.94 bits (437), Expect = 2.944e-46
Identity = 108/309 (34.95%), Postives = 164/309 (53.07%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNL 1051
            G++G V +      + A+K             E+  LSR NH NIVKLYG+  +   L     +ME+A  GSL  +LH  +P  +YT +  ++W  QCA+GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V +  R   I   P+ ++ L+  CW     +RP + ++ + +  ++++   ++EPL   +YP    + +S    SN   + T S  +Y       DG++
Sbjct:   34 GAFGVVCKAKWKGKDVAIKTIESESERTAFIVELRQLSRVNHPNIVKLYGSCDNPVCL-----VMEYAEGGSLYNVLHGAEPLPHYTASHAMSWCLQCAQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHRGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMMHLMKYFPGSEEPL---QYP----YQYSDEGQSNSATS-TGSIVDYTSTGNRNDGSM 322          
BLAST of AGAP013516-RB vs. Ensembl Cavefish
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:103039333])

HSP 1 Score: 172.555 bits (436), Expect = 3.603e-46
Identity = 108/309 (34.95%), Postives = 164/309 (53.07%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNL 1051
            G++G V +      + A+K             E+  LSR NH NIVKLYG+  +   L     +ME+A  GSL  +LH  +P  +YT +  ++W  QCA+GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V +  R   I   P+ ++ L+  CW     +RP + ++ + +  ++++   ++EPL   +YP    + +S    SN   + T S  +Y       DG++
Sbjct:   34 GAFGVVCKAKWKGKDVAIKTIESESERTAFIVELRQLSRVNHPNIVKLYGSCDNPVCL-----VMEYAEGGSLYNVLHGAEPLPHYTASHAMSWCLQCAQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHRGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMMHLMKYFPGSEEPL---QYP----YQYSDEGQSNSATS-TGSIVDYTSTGNRNDGSM 322          
BLAST of AGAP013516-RB vs. Ensembl Cavefish
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:103039333])

HSP 1 Score: 159.073 bits (401), Expect = 1.245e-41
Identity = 101/308 (32.79%), Postives = 162/308 (52.60%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNL 1051
            G++G V +      + A+K             E+  LSR NH NIVKLYG+  +   + L+   ++ + + ++  L   +P  +YT +  ++W  QCA+GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V +  R   I   P+ ++ L+  CW     +RP + ++ + +  ++++   ++EPL   +YP    + +S    SN   + T S  +Y       DG++
Sbjct:   34 GAFGVVCKAKWKGKDVAIKTIESESERTAFIVELRQLSRVNHPNIVKLYGSCDNPVIVLLYDCPVDCSLYSTV--LHGAEPLPHYTASHAMSWCLQCAQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHRGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMMHLMKYFPGSEEPL---QYP----YQYSDEGQSNSATS-TGSIVDYTSTGNRNDGSM 324          
BLAST of AGAP013516-RB vs. Ensembl Cavefish
Match: ENSAMXT00000013527.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:9094339:9106059:-1 gene:ENSAMXG00000013141.2 transcript:ENSAMXT00000013527.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.490e-34
Identity = 86/247 (34.82%), Postives = 124/247 (50.20%), Query Frame = 2
Query:  128 GGSYGSVQRISM--NNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERP 853
            GGS+GSV R      + E AVK         K   E E LS  +H+NI++ YGA    P+      +  + E+A  GSL E L    +    + Q + W    A+G+ YLH      ++HRD+K  N++L     V+K+CDFG  K +  T + +  GT+ +MAPEV+ S+       +E CD YS  ++LWE+L R+ PFK       +   VV K ER      CP     L++ CW  + KERP
Sbjct:   24 GGSFGSVYRARWVPQDKEVAVKKLL------KIDKEAEILSVLSHKNIIQFYGAVLEAPN------YAIVTEYASGGSLYEYLSSPDSEEMDMGQVMTWALDIAKGIHYLHAEAPVKVIHRDLKSRNVVL-AADNVLKICDFGASKFLSHTTHMSLVGTFPWMAPEVIQSLP-----VSETCDTYSYGVVLWEMLTREVPFKGF-EGLQVAWLVVEKNERPTIPSSCPASFAELMRSCWVAEPKERP 251          
BLAST of AGAP013516-RB vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006100.1 (pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 gene:ENSPMAG00000005510.1 transcript:ENSPMAT00000006100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 7.470e-47
Identity = 97/263 (36.88%), Postives = 140/263 (53.23%), Query Frame = 2
Query:   86 ELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPN-AFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            E+  D +   +    G++G V +     ++ A+K        +    E+  LSR NH NIV+LYGA      L     +ME+A  GSL  +LH  +P   YT A  + W  QCA+GV YLH      ++HRD+KP NLLL + GT++K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM  V     R   I   P+ ++ L+  CW  +   RP + ++
Sbjct:   20 EIDSDEIIVEEVVGRGAFGVVCKAKWRGMDVAIKQIESESERKAFIVELRQLSRVNHPNIVRLYGA-----CLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMRWCLQCAQGVAYLHCMKPKALIHRDLKPPNLLLISGGTILKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVH-NGTRPPLIKNLPKPIEGLMTRCWDKEPALRPSMEEI 270          
BLAST of AGAP013516-RB vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010293.1 (pep scaffold:Pmarinus_7.0:GL485008:4096:12057:1 gene:ENSPMAG00000009322.1 transcript:ENSPMAT00000010293.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 8.039e-28
Identity = 63/173 (36.42%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  326 EFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYK 844
            EFA  GSL + L    + +  + Q L W    A+G+ YLHT     ++HRD+K  N+L+ +  T +K+CDFG  +    T N    GT+ +MAPEV+ S        +E CD YS  ++LWE+L R+ PFK       +   VV K ER      CP     L++ CW+ Q K
Sbjct:    1 EFACRGSLYDYLCGDESDDMDIDQVLPWAMDIAKGMNYLHTEAPVKVIHRDLKSRNVLITSDNT-LKICDFGASRFHGHTTNMTMVGTFPWMAPEVIQSQP-----ISETCDTYSFGVVLWEMLTREVPFKGF-EGLQVAWLVVEKNERPTIPSSCPASFAILMRQCWEAQPK 166          
BLAST of AGAP013516-RB vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002906.1 (pep scaffold:Pmarinus_7.0:GL477988:62521:69772:1 gene:ENSPMAG00000002654.1 transcript:ENSPMAT00000002906.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 3.344e-26
Identity = 91/288 (31.60%), Postives = 130/288 (45.14%), Query Frame = 2
Query:   83 IELSKDIVKDPDFFKGGSYGSVQRISMNN------IECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTL--AQGLNW------VHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQT-------ENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKER--LDDIPGC----PEKLQRLIKCCWKHQYKERPDISD 865
            + +S + + D  F   G +G V + +         ++CA K      H      E + +     + I+ L G   D      H  +M + P GSL+ LL      + T   +  L W      V Q A G+ YLH    HP+LH D+KP N+LL +    VK+CDFG  K  + T       E+T   GT  Y+ PE +     RK ++    DVYS AI++WEIL    P+ NA N+F ++  VV   +R   DDIP       + L RL+  CW    K RP   D
Sbjct:    9 LAVSPEDLTDISFIGSGGFGIVFKATHKRWCVQVALKCA-KSTHAPSHEADLLKEAQKMKMAQFDFILPLRGYVHDFSFR--HALVMPYMPCGSLHGLLQRCGQASGTRGDSSALPWPLRCRFVDQIAHGMNYLHGLKPHPLLHLDLKPQNVLLDD-DYHVKICDFGLSKWREVTGSKWSDGESTKLFGTLPYVPPEYLRDTH-RKPHHT--FDVYSFAIVVWEILTLTTPYANAVNSFHVVECVVKGNQRPSTDDIPEDRPREADSLIRLMTSCWDCNPKARPSFYD 289          
BLAST of AGAP013516-RB vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 3.541e-24
Identity = 93/364 (25.55%), Postives = 158/364 (43.41%), Query Frame = 2
Query:  104 VKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSV-QQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVKLLER----YVYLNLDCQQLKMRNSEI 1180
            + +  +   G+ G+V          AVK  R     ++   +++ L +  H NI+   G          +  IME+   G L E+L     ++  L  G  W    A G+ YLH    H I+HRD+K  N+L+      VK+ DFGT K + +++   + +GT  +MAPEV+     R    +EK D++S  ++LWE+L  + P+++  ++ +I+  V      L     CPE  + L+  CW  + + RP    +   L I     D    PLE        +  HS A    +  +           +  +D  L  R+  ++ R +  I + + + LER    Y  L+    QL+ R  E+
Sbjct:   14 ISELQWLGSGAQGAVFLGKFRGEHVAVKKVR-----EQKETDIKHLHKLRHPNIITFKGV---CTHAPCYCIIMEYCAQGQLYEVLRAGRRISPELLVG--WTRGIARGMSYLHL---HKIIHRDLKSPNVLI-THDDEVKISDFGTSKEMREKSTRMSFAGTVAWMAPEVI-----RNEPVSEKVDIWSFGVVLWELLTGEIPYRDV-DSSAIIWGVGSNSLHLPIPASCPEGFKILLTQCWNSKPRNRPSFRQILLHLEIAA--ADVLSTPLE--------TFFHSQAEWREEVRSQFEKIRTEGASIHRLDEELISRR-RQELRHALDIREHYEQKLERANGLYAELSTLMLQLETREKEL 346          
BLAST of AGAP013516-RB vs. Ensembl Sea Lamprey
Match: map3k9 (mitogen-activated protein kinase kinase kinase 9 [Source:ZFIN;Acc:ZDB-GENE-081113-5])

HSP 1 Score: 103.605 bits (257), Expect = 2.779e-23
Identity = 76/277 (27.44%), Postives = 122/277 (44.04%), Query Frame = 2
Query:  116 DFFKGGSYGSVQRISMNNIECAVKYFR------LREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNF----------GTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSII 889
            +    G +G V R +    E AVK  R      +    +    E +  S   H NI+ L       P+L        IME+A  G+LN  L  +    + L   L+W  Q A G+KYLH      I+HRD+K  N++                 +K+ DFG  +   +T   + +GTY +MAPEV+ S     + +++  DV+S  ++LWE+L  + P++   +  ++   V + K  L     CPE   +L+  CW      RP  S + + L  +
Sbjct:   94 EIIGAGGFGKVYRGTWRGEEVAVKAARQDPDEDISVTMENVRQEGKLFSMLRHPNIIALKAVCLQAPNL------CLIMEYARGGALNRALAGRRIHPHIL---LDWAVQIARGMKYLHDEAIVNIIHRDLKSCNVVKVLLQERVENDDLEAKTLKITDFGLAREWYKTTMMSAAGTYAWMAPEVIKS-----STFSKGSDVWSYGVLLWELLTGEVPYRGI-DGLAVAYGVAVNKLTLPIPSTCPEPFSKLMTECWDPDPHSRPPFSRILDELVAV 355          
BLAST of AGAP013516-RB vs. Ensembl Yeast
Match: PBS2 (MAP kinase kinase of the HOG signaling pathway; activated under severe osmotic stress; mitophagy-specific regulator; plays a role in regulating Ty1 transposition [Source:SGD;Acc:S000003664])

HSP 1 Score: 90.5077 bits (223), Expect = 1.574e-19
Identity = 75/270 (27.78%), Postives = 123/270 (45.56%), Query Frame = 2
Query:  116 DFFKGGSYGSVQRI--SMNNIECAVKYFRLR---EHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCA-EGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPF--KNAPNAFSIMSTVVIKKERLDDIPGCPEKL---------QRLIKCCWKHQYKERPDISDVCE 874
            D    G+YG+V ++     N+  A K  RL      +++   E+E L +CN   IV  YGA    GA+   Y  ME+   GSL+++  E   +       L ++      G+K L     H I+HRD+KP N+L       VKLCDFG   ++  +    + G   YMAPE + S+   +A Y  + D++S+ + + E+ + + P+  +   N FS +S +V          G P +L         Q  +  C +   + RP  + + E
Sbjct:  364 DELGHGNYGNVSKVLHKPTNVIMATKEVRLELDEAKFRQILMELEVLHKCNSPYIVDFYGAFFIEGAV---YMCMEYMDGGSLDKIYDESSEIGGIDEPQLAFIANAVIHGLKELKEQ--HNIIHRDVKPTNILCSANQGTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDRATYTVQSDIWSLGLSILEMALGRYPYPPETYDNIFSQLSAIV---------DGPPPRLPSDKFSSDAQDFVSLCLQKIPERRPTYAALTE 619          
BLAST of AGAP013516-RB vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 87.0409 bits (214), Expect = 3.183e-18
Identity = 63/221 (28.51%), Postives = 112/221 (50.68%), Query Frame = 2
Query:  251 NHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADS-------------GTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCE 874
            N  ++V+L+    D  +L   Y+++E+AP+G    L+ +  +++ T A+   +  Q  + + YLH   S+ I+HRDIKP N+LL +    +KL DFGT K +  T N+                GT  Y++PE++N      ++ + +CD+++   IL++++  + PFK A N +     V+  K +    PG P  ++ L+K         R  IS + E
Sbjct:  236 NSPSVVRLFSTFQDESSL---YFLLEYAPNGDFLSLMKKYGSLDETCAR--YYAAQIIDAIDYLH---SNGIIHRDIKPENILL-DGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSPELLND-----SFTDYRCDIWAFGCILFQMIAGKPPFK-ATNEYLTFQKVM--KVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKE 439          
BLAST of AGAP013516-RB vs. Ensembl Yeast
Match: PKH1 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh2p; PKH1 has a paralog, PKH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002898])

HSP 1 Score: 85.1149 bits (209), Expect = 1.023e-17
Identity = 82/276 (29.71%), Postives = 135/276 (48.91%), Query Frame = 2
Query:   86 ELSKDIVKD--PDFFKG-----GSYGSVQRISMNN------IECAVKYFRLREHYQKNFAEVESLS--RCN-HENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSV-QQTENTADS--------------GTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIK 820
            EL+K +VK    DF  G     GSY SV   +  +      ++   K + +R+   K +  VE L+  + N  + I KL+    D  +L   Y+++E+APHG    L+ +  ++N T A+   +  Q  + V  LH   +  I+HRDIKP N+LL +    VKL DFGT K + ++  NTAD               GT  Y++PE++N       Y + +CD+++   IL+++L  + PFK A    +    + I+        G P+ ++ L+K
Sbjct:  112 ELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVK-YVTVEKLALQKLNGTKGIFKLFFTFQDEASL---YFLLEYAPHGDFLGLIKKYGSLNETCAR--YYASQIIDAVDSLH---NIGIIHRDIKPENILL-DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLND-----NYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAF---TAGFPQIVKDLVK 369          
BLAST of AGAP013516-RB vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 80.1073 bits (196), Expect = 1.063e-16
Identity = 70/240 (29.17%), Postives = 113/240 (47.08%), Query Frame = 2
Query:  176 CAVKYFRLRE----HYQKNFA-EVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFG-TVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDI---PGCPEKLQRLIKCCWKHQYKERPDISDV 868
            CA+K     E    + QK F  EVE  +  NH N+ K YG   D   +   Y +ME+  +G + +LL      N  LA   ++++Q A  + Y+H      I+HRDIKP N+L+  F  V+KL DFG ++ +  +       GT  Y++PE++ S +     Y+   D +++ ++ +E+L    PF+        M     K+    DI       +  Q LI    K+  K+R  + DV
Sbjct:  130 CALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRV---YLLMEYLVNGEMYKLLRLHGPFNDILAS--DYIYQIANALDYMHKKN---IIHRDIKPENILI-GFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESRE-----YDHTIDAWALGVLAFELLTGAPPFEEE------MKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDV 349          
BLAST of AGAP013516-RB vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 80.8777 bits (198), Expect = 2.972e-16
Identity = 76/256 (29.69%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  119 FFKGGSYGSV-QRISMNNIEC-AVKYFRLREH--YQKNFA----EVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSV-----QQTENTADS-------------GTYVYMAPEVM--NSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEK 802
            F  GG++G V   I++ N E  AVK  ++ +    +K F     E+  L   NH NIV+ YG   ++   K++ + ME+   GSL  LL      +  + Q   +  +  EG+ YLH S    ++HRDIKP N+LL +F  ++K  DFGT ++V     +   N A               GT +YMAPE +  ++VK +        DV+++  ++ E+   ++P+ N  N ++IM  V   +     IP  P +
Sbjct: 1039 FIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYYGV--EVHRDKVNIF-MEYCEGGSLASLLDHGRIEDEMVTQV--YTFELLEGLAYLHQS---GVVHRDIKPENILL-DFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLG----ADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGR-----IPQLPNR 1276          
BLAST of AGAP013516-RB vs. Ensembl Nematostella
Match: EDO47144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMS1])

HSP 1 Score: 162.155 bits (409), Expect = 1.186e-45
Identity = 104/264 (39.39%), Postives = 141/264 (53.41%), Query Frame = 2
Query:  131 GSYGSVQRISMN-NIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVN----YTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNA--FSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHM 901
            G++G V +         AVK        +    EV+ LSR +H NI+KLYGA      + L   +ME+A  GSL  LLH K + +    YT +  ++W  QCA GV+YLH+     I+HRD+KP NLLL   GTVVK+CDFGT   + +T  T + G+  +MAPEV          Y EKCDVYS  IILWE++ R+KPF +   +  F IM  V I + R   I   P+ ++ LI  CW     +RP  S +     I L H+
Sbjct:   17 GAFGVVYKARWREKFIVAVKTIESEAEKKAFIVEVQQLSRVSHRNIIKLYGAVTKHEPVCL---VMEYAEGGSLYNLLHWKKSTSRAPIYTASHVISWALQCASGVEYLHSMKPKAIIHRDLKPPNLLLTRCGTVVKICDFGTACDL-KTYMTNNKGSAAWMAPEVFEGNN-----YTEKCDVYSFGIILWEMISRRKPFDDMAGSPPFRIMWAVHIGR-RPPLIKNIPKPIEELITSCWDKDPDKRPSFSRIV----IFLNHL 266          
BLAST of AGAP013516-RB vs. Ensembl Nematostella
Match: EDO36442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN7])

HSP 1 Score: 126.331 bits (316), Expect = 4.211e-31
Identity = 85/270 (31.48%), Postives = 130/270 (48.15%), Query Frame = 2
Query:  116 DFFKGGSYGSVQRISMNNIECAVKYFRLR--EHYQKNFAEVESLSRC----NHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLF------NFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSII 889
            D    G++G V R    + E AVK  R    E + +    V+  +R      H+NIV L G   +   L L   ++E+A  G+L+  L    N N   +  LNW  Q A+G+ YLH+     I+HRD+K  N+LL       +F  ++K+ DFG  + +  T   + +GTY +MAPEV+     R   ++   DV+S  ++LWE+L  Q P+K+   A ++   V +    L     CPE  + L+  CW     +RP    V E L  I
Sbjct:   79 DVIGVGAFGKVYRGIWRDEEVAVKVARTDNYEDFTQTLDSVKKEARIFSMLRHQNIVGLLGVSLEQPNLCL---VLEYARGGALSRALSSY-NRNIPPSVLLNWAIQIAQGMFYLHSEAPVTIVHRDLKSGNILLHYKINESDFNNILKITDFGLAREIANTTRMSAAGTYAWMAPEVI-----RTNTFSFASDVWSYGVVLWELLTGQVPYKDV-EALAVAYGVAMNSLTLPIPTTCPEVFKNLMADCWNQDPHKRPTFKAVLEALEEI 338          
BLAST of AGAP013516-RB vs. Ensembl Nematostella
Match: EDO37575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG8])

HSP 1 Score: 120.168 bits (300), Expect = 1.146e-29
Identity = 103/363 (28.37%), Postives = 178/363 (49.04%), Query Frame = 2
Query:  119 FFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSV-QQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSAS---MSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVKLLER----YVYLNLDCQQLKMRNSEIL 1183
            +   G+ G+V     ++ + AVK  R    ++K+  +++ L   NH NI++  G         ++  +ME+ P+G L E+L +   +   L  G  W  Q A+G+ YLH    + I+HRD+K  N+L+ +   ++K+ DFGT K   +++     +GT  +MAPEV+     R    +EK DV+S  ++LWE+L  + P+K   ++ +I+  V     +L     CPE +Q L+K CW  + K RP    V   + I +   D  + P       ++   +  S     M N+  N+ +  E   +  ELI    + ++ LK  R+    Y++    LER    Y  LNL  +QL++R  E++
Sbjct:   40 WLGSGAQGAVFLGVYSDEQVAVKKVR----HEKD-TDIKHLRNLNHPNIIRFKGV---CNQAPVYCVVMEYCPYGQLFEVLRDGREITPELLVG--WTTQIADGMHYLH---GNKIIHRDLKSPNILVSS-NDILKISDFGTCKEFNEKSAKMTFAGTVAWMAPEVI-----RNEPCSEKVDVWSFGVLLWELLTGELPYKGV-DSSAIIWGVGSNNLQLPVPSTCPEGIQLLMKLCWNSKPKNRPSFRQVL--MHIEIAATDVLRTPPNTFHDQQVGWRSEISVEFEKMRNESANLQNLHELRRLDEELIQ---RRKEELKHARDIRMHYEEK---LERANSLYHELNLCMEQLELREKELV 374          
BLAST of AGAP013516-RB vs. Ensembl Nematostella
Match: EDO41796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S358])

HSP 1 Score: 89.7373 bits (221), Expect = 5.659e-20
Identity = 65/244 (26.64%), Postives = 121/244 (49.59%), Query Frame = 2
Query:  179 AVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHY-YIMEFAPHGSLNELLHEKPNVNYTLAQGL-NWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTE--NTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEIL-VRQKPFKNAPNAFSIMSTVVIKKER-LDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIIL 892
            ++K   L +H +    E +++   +H NI++LYG         +    + E+A  GSL+E+L       +     L  +  Q A+G++YL       ++HRD+   N+L+     +V++ DFG  K++ Q +           + APEV+   K R+ +   KCDV+S  ++LWE+    ++P+   P    +M  V  + E+ L+    CP +L  L+  CW H+ ++RP  +++   +S +L
Sbjct:   40 SIKGNFLEDHLEDVLREADTMMSLDHRNIIRLYGIALITSKTPMGIKLVTEYAVFGSLSEILKNPNKPEFLQVTRLRKFSLQIADGMEYLANRH---LVHRDLAARNVLVVE-PELVRISDFGLAKALDQGQEITAGREMAIAWCAPEVL---KGREVH--PKCDVWSYGVLLWEMYSFGKRPWDGIP-IMQVMKIVTQQPEKKLEQPKACPSELYELMLHCWVHEPQDRPGFAEIRSSISKVL 273          
BLAST of AGAP013516-RB vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 87.4261 bits (215), Expect = 3.047e-19
Identity = 62/171 (36.26%), Postives = 92/171 (53.80%), Query Frame = 2
Query:  224 AEVESLSRCNHENIVKLYGAGPDLGALKLHYYI-MEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQ----QTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN 721
             E+E +    +E IV+ YG   D     LH YI ME+ P GS++E + +   +N +L +   +  Q  EG+ YLHT   + I+HRDIK AN+L   +G  VKL DFG  K +Q    +T   +  GT  +MAPEV+N        Y  K DV+S+   + E+L  + P+ +
Sbjct:   53 GEIEFMKAFRNERIVQYYGIETD----DLHIYIFMEYLPGGSIHEHIKQHGALNESLTR--KYSRQILEGILYLHT---NRIVHRDIKGANILRDLYGN-VKLADFGASKRLQTIRSKTGFRSVHGTPYWMAPEVINGEG-----YGRKADVWSVGCTVVEMLTTKPPWAD 208          
BLAST of AGAP013516-RB vs. Ensembl Medaka
Match: ENSORLT00000030607.1 (mitogen-activated protein kinase kinase kinase 7-like [Source:NCBI gene;Acc:105356874])

HSP 1 Score: 172.94 bits (437), Expect = 4.955e-47
Identity = 102/257 (39.69%), Postives = 143/257 (55.64%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILR 895
            G++G V +        A+K             E+  LSR NH NIVKLYG+  +   L     +MEFA  GSL   LH  +P   YT A  ++W  QCAEGV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S +IILWE++ R+KPF     +AF IM   V +  R   I   PE ++ L+  CW  +  +RP +S+V + +S +++
Sbjct:   34 GTFGVVFKAVWRGKVVAIKSIESDSERSAFLVELRQLSRVNHPNIVKLYGSCDNPVCL-----VMEFAECGSLYNFLHGAEPQPRYTAAHAMSWCLQCAEGVAYLHAMKPKALIHRDLKPPNLLLVAQGTVLKICDFGTACDI-QTYMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWSIILWEVMTRKKPFDEIGGSAFCIM-WAVHRGTRPPLIRDLPEPIETLMTRCWDKEPSQRPPMSEVRDTMSHLMK 278          
BLAST of AGAP013516-RB vs. Ensembl Medaka
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:101164271])

HSP 1 Score: 166.777 bits (421), Expect = 1.610e-44
Identity = 100/274 (36.50%), Postives = 149/274 (54.38%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKL 946
            G++G V +      + A+K        +    E+  LSR NH NIVKLYG+  +   L     +ME+A  GSL  +LH  +P   YT +  ++W  QC++GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + +S ++++   +  PL   +YP L
Sbjct:   36 GAFGVVCKAKWKGNDVAIKTIESESERKAFIVELRQLSRVNHPNIVKLYGSCSNPVCL-----VMEYAEGGSLYNVLHGAEPLPCYTASHAMSWCLQCSQGVAYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMSHLMKYFPESDVPL---QYPYL 294          
BLAST of AGAP013516-RB vs. Ensembl Medaka
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:101164271])

HSP 1 Score: 166.777 bits (421), Expect = 2.533e-44
Identity = 100/274 (36.50%), Postives = 149/274 (54.38%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKL 946
            G++G V +      + A+K        +    E+  LSR NH NIVKLYG+  +   L     +ME+A  GSL  +LH  +P   YT +  ++W  QC++GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + +S ++++   +  PL   +YP L
Sbjct:   36 GAFGVVCKAKWKGNDVAIKTIESESERKAFIVELRQLSRVNHPNIVKLYGSCSNPVCL-----VMEYAEGGSLYNVLHGAEPLPCYTASHAMSWCLQCSQGVAYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMSHLMKYFPESDVPL---QYPYL 294          
BLAST of AGAP013516-RB vs. Ensembl Medaka
Match: map3k7 (mitogen-activated protein kinase kinase kinase 7 [Source:NCBI gene;Acc:101164271])

HSP 1 Score: 167.162 bits (422), Expect = 3.048e-44
Identity = 100/274 (36.50%), Postives = 149/274 (54.38%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLH-EKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKN-APNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKL 946
            G++G V +      + A+K        +    E+  LSR NH NIVKLYG+  +   L     +ME+A  GSL  +LH  +P   YT +  ++W  QC++GV YLH      ++HRD+KP NLLL   GTV+K+CDFGT   + QT  T + G+  +MAPEV        + Y+EKCDV+S  IILWE++ R+KPF      AF IM   V    R   I   P+ ++ L+  CW     +RP + ++ + +S ++++   +  PL   +YP L
Sbjct:   36 GAFGVVCKAKWKGNDVAIKTIESESERKAFIVELRQLSRVNHPNIVKLYGSCSNPVCL-----VMEYAEGGSLYNVLHGAEPLPCYTASHAMSWCLQCSQGVAYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEG-----SNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM-WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMSHLMKYFPESDVPL---QYPYL 294          
BLAST of AGAP013516-RB vs. Ensembl Medaka
Match: ENSORLT00000018073.2 (mitogen-activated protein kinase kinase kinase 21 [Source:NCBI gene;Acc:101168074])

HSP 1 Score: 143.28 bits (360), Expect = 9.671e-36
Identity = 92/253 (36.36%), Postives = 130/253 (51.38%), Query Frame = 2
Query:  128 GGSYGSVQR---ISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGA---GPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDV 868
            GGS+GSV R   +S +  E AVK         K   E E LS  +H+NI++ YGA    P+ G       + EFA  GSL E L  + +    + Q + W  Q A+G+ YLH      ++HRD+K  N+++     V+K+CDFG  K +  T +    GT+ +MAPEV+ S+       +E CD YS  ++LWE+L R+ PFK       +   VV K+ERL     CP     L+K CW+   KERP    V
Sbjct:   24 GGSFGSVYRAFWVSQDK-EVAVKKL------LKIDKEAEILSVLSHKNIIQFYGAVLESPNYG------IVTEFASGGSLYEYLSSEHSEEMDMKQIMTWALQIAKGMHYLHAEAPVKVIHRDLKSRNVVI-TADKVLKICDFGASKFLSHTTHMTVVGTFPWMAPEVIQSLP-----VSETCDTYSYGVVLWEMLTREVPFKGF-EGLQVAWLVVEKQERLTIPTSCPASFAELMKKCWQADPKERPQFKQV 256          
BLAST of AGAP013516-RB vs. Planmine SMEST
Match: SMESG000056770.1 (SMESG000056770.1)

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 394/397 (99.24%), Postives = 394/397 (99.24%), Query Frame = 2
Query:   80 DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVKLLERYVYLNLDCQQLKMRNSEILMELASDPQERERITRYCQLKLKEQVNMNI 1270
            DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVKLLERYVYLNLDCQQLKMRNSEILMELASDPQERERITRYCQLKLKEQ   NI
Sbjct:    8 DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQHVKLLERYVYLNLDCQQLKMRNSEILMELASDPQERERITRYCQLKLKEQKQSNI 404          
BLAST of AGAP013516-RB vs. Planmine SMEST
Match: SMESG000056770.1 (SMESG000056770.1)

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 394/400 (98.50%), Postives = 394/400 (98.50%), Query Frame = 2
Query:   80 DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGN---LKPRQPLKDCRESERIYQQHVKLLERYVYLNLDCQQLKMRNSEILMELASDPQERERITRYCQLKLKEQVNMNI 1270
            DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGN   LKPRQPLKDCRESERIYQQHVKLLERYVYLNLDCQQLKMRNSEILMELASDPQERERITRYCQLKLKEQ   NI
Sbjct:    8 DIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFNFGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHNHSSASMSNDENNITHSTENYEVLLELIDGNLKVLKPRQPLKDCRESERIYQQHVKLLERYVYLNLDCQQLKMRNSEILMELASDPQERERITRYCQLKLKEQKQSNI 407          
BLAST of AGAP013516-RB vs. Planmine SMEST
Match: SMESG000003943.1 (SMESG000003943.1)

HSP 1 Score: 102.834 bits (255), Expect = 1.862e-22
Identity = 73/262 (27.86%), Postives = 122/262 (46.56%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLL---FNFGT--------VVKLCDFGTV-KSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGL 880
            G++G V        E A+K F +  +    + E   L    H+NIV+L+G             IME+A  G+L+ LLH +PN+  +    L    Q A G++YLH      I HRD+K +N+L+    + G          + + DFG   ++V+     +  GT  Y APEV      ++  ++ K DV+S  ++LWE+L  + P+++      ++  +  K + L    G P  L +L+  CW    + RPD   + + L
Sbjct:  235 GAFGIVYHGRWQEKEVAMKTFSINANEVHIYQEAGHLGCLLHKNIVRLFGISIFNETSHQIALIMEYAKGGALHNLLHFRPNIKLSPRTLLILSRQVALGMRYLHQDAG--ICHRDLKSSNVLIKEAISDGATDAQISKCTLLITDFGMARRTVELVSQQSKLGTLAYAAPEVCK----QQGVFSTKSDVWSYGVLLWELLTMEIPYRDVEQPH-LLYKIAFKNQTLHIPDGIPNLLVKLLTNCWAEDKQVRPDFEQIVQVL 489          
BLAST of AGAP013516-RB vs. Planmine SMEST
Match: SMESG000003943.1 (SMESG000003943.1)

HSP 1 Score: 102.449 bits (254), Expect = 2.659e-22
Identity = 73/263 (27.76%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  128 GGSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLL---FNFGT--------VVKLCDFGTV-KSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGL 880
             G++G V        E A+K F +  +    + E   L    H+NIV+L+G             IME+A  G+L+ LLH +PN+  +    L    Q A G++YLH      I HRD+K +N+L+    + G          + + DFG   ++V+     +  GT  Y APEV      ++  ++ K DV+S  ++LWE+L  + P+++      ++  +  K + L    G P  L +L+  CW    + RPD   + + L
Sbjct:  234 SGAFGIVYHGRWQEKEVAMKTFSINANEVHIYQEAGHLGCLLHKNIVRLFGISIFNETSHQIALIMEYAKGGALHNLLHFRPNIKLSPRTLLILSRQVALGMRYLHQDAG--ICHRDLKSSNVLIKEAISDGATDAQISKCTLLITDFGMARRTVELVSQQSKLGTLAYAAPEVCK----QQGVFSTKSDVWSYGVLLWELLTMEIPYRDVEQPH-LLYKIAFKNQTLHIPDGIPNLLVKLLTNCWAEDKQVRPDFEQIVQVL 489          
BLAST of AGAP013516-RB vs. Planmine SMEST
Match: SMESG000003943.1 (SMESG000003943.1)

HSP 1 Score: 101.679 bits (252), Expect = 4.579e-22
Identity = 73/262 (27.86%), Postives = 122/262 (46.56%), Query Frame = 2
Query:  131 GSYGSVQRISMNNIECAVKYFRLREHYQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNELLHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLL---FNFGT--------VVKLCDFGTV-KSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKCDVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQRLIKCCWKHQYKERPDISDVCEGL 880
            G++G V        E A+K F +  +    + E   L    H+NIV+L+G             IME+A  G+L+ LLH +PN+  +    L    Q A G++YLH      I HRD+K +N+L+    + G          + + DFG   ++V+     +  GT  Y APEV      ++  ++ K DV+S  ++LWE+L  + P+++      ++  +  K + L    G P  L +L+  CW    + RPD   + + L
Sbjct:  235 GAFGIVYHGRWQEKEVAMKTFSINANEVHIYQEAGHLGCLLHKNIVRLFGISIFNETSHQIALIMEYAKGGALHNLLHFRPNIKLSPRTLLILSRQVALGMRYLHQDAG--ICHRDLKSSNVLIKEAISDGATDAQISKCTLLITDFGMARRTVELVSQQSKLGTLAYAAPEVCK----QQGVFSTKSDVWSYGVLLWELLTMEIPYRDVEQPH-LLYKIAFKNQTLHIPDGIPNLLVKLLTNCWAEDKQVRPDFEQIVQVL 489          
The following BLAST results are available for this feature:
BLAST of AGAP013516-RB vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K71.075e-4737.83mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K72.164e-4737.83mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K74.422e-4737.87mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K77.021e-4737.87mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K205.018e-3233.21mitogen-activated protein kinase kinase kinase 20 ... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mom-48.737e-2933.49Mitogen-activated protein kinase kinase kinase mom... [more]
zak-13.629e-2728.47Mammalian ZAK kinase homolog [Source:UniProtKB/Tr... [more]
dlk-13.304e-2429.92Mitogen-activated protein kinase kinase kinase dlk... [more]
Y105C5A.244.081e-2427.12pep chromosome:WBcel235:IV:15849875:15852905:1 gen... [more]
dlk-17.486e-2430.57Mitogen-activated protein kinase kinase kinase dlk... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tak11.254e-5140.00gene:FBgn0026323 transcript:FBtr0077319[more]
Takl11.857e-4336.26gene:FBgn0046689 transcript:FBtr0083996[more]
Takl22.065e-4336.47gene:FBgn0039015 transcript:FBtr0302204[more]
wnd3.303e-2730.47gene:FBgn0036896 transcript:FBtr0302513[more]
wnd3.757e-2730.47gene:FBgn0036896 transcript:FBtr0074964[more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k75.458e-4536.33mitogen-activated protein kinase kinase kinase 7 [... [more]
map3k77.899e-4536.33mitogen-activated protein kinase kinase kinase 7 [... [more]
zak1.392e-3734.75sterile alpha motif and leucine zipper containing ... [more]
zak2.089e-3634.75sterile alpha motif and leucine zipper containing ... [more]
zak1.371e-3334.82sterile alpha motif and leucine zipper containing ... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K75.105e-4534.20mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K72.464e-3631.02mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K78.416e-3632.14mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K71.103e-3532.14mitogen-activated protein kinase kinase kinase 7 [... [more]
MAP3K71.240e-3531.02mitogen-activated protein kinase kinase kinase 7 [... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k78.844e-4837.83mitogen-activated protein kinase kinase kinase 7 [... [more]
Map3k71.371e-4737.83mitogen-activated protein kinase kinase kinase 7 [... [more]
Map3k73.386e-4737.87mitogen-activated protein kinase kinase kinase 7 [... [more]
Map3k75.216e-4737.87mitogen-activated protein kinase kinase kinase 7 [... [more]
Map3k203.398e-3233.21mitogen-activated protein kinase kinase kinase 20 ... [more]
back to top
BLAST of AGAP013516-RB vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V3Q6|M3K7_DROME1.257e-5040.00Mitogen-activated protein kinase kinase kinase 7 O... [more]
sp|Q62073|M3K7_MOUSE2.368e-4637.87Mitogen-activated protein kinase kinase kinase 7 O... [more]
sp|A2VDU3|M3K7_BOVIN2.392e-4637.87Mitogen-activated protein kinase kinase kinase 7 O... [more]
sp|O43318|M3K7_HUMAN3.372e-4637.87Mitogen-activated protein kinase kinase kinase 7 O... [more]
sp|Q5RFL3|M3K7_PONAB3.833e-4637.87Mitogen-activated protein kinase kinase kinase 7 O... [more]
back to top
BLAST of AGAP013516-RB vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5S6QFL92.479e-5838.72Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A087T3N74.701e-5743.66Mitogen-activated protein kinase kinase kinase 7 (... [more]
A0A1B0DBN51.258e-5340.49Protein kinase domain-containing protein OS=Phlebo... [more]
A0A2R5LA271.277e-5342.21Putative mitogen-activated protein kinase kinase k... [more]
A0A1B0BHS91.446e-5340.70Protein kinase domain-containing protein OS=Glossi... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k72.449e-4634.95mitogen-activated protein kinase kinase kinase 7 [... [more]
map3k72.944e-4634.95mitogen-activated protein kinase kinase kinase 7 [... [more]
map3k73.603e-4634.95mitogen-activated protein kinase kinase kinase 7 [... [more]
map3k71.245e-4132.79mitogen-activated protein kinase kinase kinase 7 [... [more]
ENSAMXT00000013527.21.490e-3434.82pep primary_assembly:Astyanax_mexicanus-2.0:13:909... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006100.17.470e-4736.88pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 g... [more]
ENSPMAT00000010293.18.039e-2836.42pep scaffold:Pmarinus_7.0:GL485008:4096:12057:1 ge... [more]
ENSPMAT00000002906.13.344e-2631.60pep scaffold:Pmarinus_7.0:GL477988:62521:69772:1 g... [more]
ENSPMAT00000008193.13.541e-2425.55pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
map3k92.779e-2327.44mitogen-activated protein kinase kinase kinase 9 [... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PBS21.574e-1927.78MAP kinase kinase of the HOG signaling pathway; ac... [more]
PKH23.183e-1828.51Serine/threonine protein kinase; involved in sphin... [more]
PKH11.023e-1729.71Serine/threonine protein kinase; involved in sphin... [more]
IPL11.063e-1629.17Aurora kinase of chromosomal passenger complex; me... [more]
SSK222.972e-1629.69MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471441.186e-4539.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364424.211e-3131.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375751.146e-2928.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417965.659e-2026.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414103.047e-1936.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AGAP013516-RB vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000030607.14.955e-4739.69mitogen-activated protein kinase kinase kinase 7-l... [more]
map3k71.610e-4436.50mitogen-activated protein kinase kinase kinase 7 [... [more]
map3k72.533e-4436.50mitogen-activated protein kinase kinase kinase 7 [... [more]
map3k73.048e-4436.50mitogen-activated protein kinase kinase kinase 7 [... [more]
ENSORLT00000018073.29.671e-3636.36mitogen-activated protein kinase kinase kinase 21 ... [more]
back to top
BLAST of AGAP013516-RB vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056770.10.000e+099.24SMESG000056770.1[more]
SMESG000056770.10.000e+098.50SMESG000056770.1[more]
SMESG000003943.11.862e-2227.86SMESG000003943.1[more]
SMESG000003943.12.659e-2227.76SMESG000003943.1[more]
SMESG000003943.14.579e-2227.86SMESG000003943.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014989 ID=SMED30014989|Name=AGAP013516-RB|organism=Schmidtea mediterranea sexual|type=transcript|length=1775bp
AAATTTTCAAAATTGATTCACATAATCTAAATGATATTTTATAAATAATA
ATTTTGCCATGAATTTGATAAACAATATTGATATTGAATTATCAAAGGAT
ATTGTGAAAGATCCAGATTTTTTCAAAGGTGGTTCATACGGTTCTGTACA
GAGGATCTCCATGAACAATATCGAATGTGCTGTGAAATATTTTCGTTTAC
GAGAACATTATCAAAAAAACTTTGCTGAAGTAGAGAGCTTGAGTAGATGT
AATCATGAGAATATAGTAAAGCTGTATGGTGCAGGTCCAGATCTAGGAGC
GCTAAAATTGCATTACTATATTATGGAATTCGCGCCTCATGGGTCATTGA
ATGAATTGCTTCATGAGAAACCGAATGTGAATTACACGCTGGCACAAGGA
TTGAATTGGGTCCACCAATGCGCTGAAGGTGTCAAATATCTCCACACGAG
TTTCAGTCATCCGATTCTCCACCGGGATATCAAGCCAGCAAATCTGCTGC
TGTTCAATTTTGGAACTGTTGTGAAATTGTGCGATTTCGGCACCGTCAAA
TCGGTTCAGCAAACGGAAAATACCGCAGATAGCGGCACATATGTCTACAT
GGCACCGGAGGTGATGAATTCCGTGAAAGACAGGAAGGCATATTACAATG
AGAAATGCGACGTGTACAGCATTGCCATTATCCTATGGGAAATACTTGTG
CGACAAAAACCGTTCAAGAATGCTCCCAACGCCTTCTCAATCATGTCCAC
AGTCGTCATCAAGAAGGAGCGGCTCGATGATATTCCTGGGTGTCCTGAGA
AATTGCAGCGGTTGATAAAATGCTGCTGGAAACATCAATACAAGGAGCGA
CCGGACATTTCCGATGTGTGTGAAGGTCTCAGCATTATCCTCAGGCACAT
GGACTGCGCCAAGGAGCCGTTGGAGTTGAAGGAGTATCCCAAGCTGCCCA
GTCACAATCATTCGAGCGCCTCGATGAGCAACGATGAAAACAATATTACT
CACAGCACAGAGAATTATGAGGTGCTACTAGAACTAATAGACGGGAATCT
AAAGCCTAGGCAACCACTGAAAGATTGCAGAGAATCGGAAAGGATATATC
AACAACACGTAAAGCTGCTTGAACGATACGTGTACCTAAATTTGGATTGC
CAGCAGCTGAAAATGCGCAACAGTGAAATCCTGATGGAACTGGCGAGCGA
TCCGCAGGAACGAGAAAGGATTACGCGTTATTGTCAACTGAAACTGAAGG
AACAGGTAAATATGAATATAGAGAATTGCTGTGCTCAATCAGCTGCCTGG
GTTTCCCTCTCGCGCTGTCATCAAGTTATACATTGTAATTGGTATTGGTA
TTATTTCCCTTGTTGCGGGGTTCCCTGGATTTTTGTGTCTGGACCCGGGC
GCACGAATGATGGGGGAATGAGTAACTATGATTGTTGATTGACCAATGGG
ATCCATATAATTGTTGATTAAACGATACCGGCCACCTCATGCATGATAAT
CGTGAAGGTCACGTGCCTCTGAATCGAACATTACTTATTAATTAATTAAT
TTGTTCAGAAACAATCAAATATTCCCTAGCTCTCATGGAGCAATCATCGA
GTTTCCAATTTGAGCGCCATTCAATAGATTTGTTGGCAAATTTAGATTTT
AATTATATTTATATTTTGTTTGAATTAATGATTTCTAACTGCAATTGACT
TTTTCTTTCTTATAGATTTTGTACCTGGGATTCATGTCCTCGCCTCATTC
ATTAATATAATTGCTTTGTAAATTA
back to top

protein sequence of SMED30014989-orf-1

>SMED30014989-orf-1 ID=SMED30014989-orf-1|Name=SMED30014989-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=460bp
MNLINNIDIELSKDIVKDPDFFKGGSYGSVQRISMNNIECAVKYFRLREH
YQKNFAEVESLSRCNHENIVKLYGAGPDLGALKLHYYIMEFAPHGSLNEL
LHEKPNVNYTLAQGLNWVHQCAEGVKYLHTSFSHPILHRDIKPANLLLFN
FGTVVKLCDFGTVKSVQQTENTADSGTYVYMAPEVMNSVKDRKAYYNEKC
DVYSIAIILWEILVRQKPFKNAPNAFSIMSTVVIKKERLDDIPGCPEKLQ
RLIKCCWKHQYKERPDISDVCEGLSIILRHMDCAKEPLELKEYPKLPSHN
HSSASMSNDENNITHSTENYEVLLELIDGNLKPRQPLKDCRESERIYQQH
VKLLERYVYLNLDCQQLKMRNSEILMELASDPQERERITRYCQLKLKEQV
NMNIENCCAQSAAWVSLSRCHQVIHCNWYWYYFPCCGVPWIFVSGPGRTN
DGGMSNYDC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000287magnesium ion binding
GO:0004709MAP kinase kinase kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000165MAPK cascade
GO:0000186activation of MAPKK activity
GO:0007165signal transduction
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular