Gelsolin-like protein

Overview
NameGelsolin-like protein
Smed IDSMED30014981
Length (bp)1397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gelsolin-like protein (SMED30014981) t-SNE clustered cells

Violin plots show distribution of expression levels for Gelsolin-like protein (SMED30014981) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gelsolin-like protein (SMED30014981) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gelsolin-like protein (SMED30014981) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014981

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 35

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30014981SMESG000015924.1 SmedASXL_019070SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014981SMESG000015924.1 Contig37970newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014981SMESG000015924.1 Contig37970uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014981SMESG000015924.1 Contig32714newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014981SMESG000015924.1 Contig32714uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014981SMESG000015924.1 Contig7953newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014981SMESG000015924.1 Contig7953uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
embryonic pharynxSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynxSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
embryonic pharynxSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynxSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
primitive ectodermSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
primitive ectodermSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
primitive ectodermSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
primitive ectodermSMED30014981SMESG000015924.1 gelsolin-likesmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
pharynxSMED30014981SMESG000015924.1 dd_Smed_v6_1673_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30014981SMESG000015924.1 Contig37970newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30014981SMESG000015924.1 Contig37970uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014981SMESG000015924.1 Contig37970newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014981SMESG000015924.1 Contig37970uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014981SMESG000015924.1 Contig37970newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014981SMESG000015924.1 Contig37970uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ovarySMED30014981SMESG000015924.1 PL06023B1G06ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30014981SMESG000015924.1 PL030007A10H01ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Category 4 cellSMED30014981SMESG000015924.1 dd_Smed_v4_1673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 215.698 bits (548), Expect = 1.637e-64
Identity = 124/335 (37.01%), Postives = 188/335 (56.12%), Query Frame = 2
Query:  341 TTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLD-EGQM-SP------NHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            T  L IWRIE  ++V  P   FG FF+GD YI+L I++    L YDIH+WIG+ S+ DE G AA  T ++D  L  + +QHREVQ  ES+ F+ YF   ++  KGG  SG +HV T  Y+  RLLHV+G K N++  EV  + K+ N  DVF+ D G  I QW G  + + ER +    A+++ + +R G+  + V+D E ++ SP      NH    +      + D     +L A   KL+ +SD  G+L   +VA+    +  +   D +I+D G + IYV+ G+KA++ E+K A+ +A N++KA  YP  P T V+    G  +  F ++ 
Sbjct:   16 TPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKA-ALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP--PSTQVEVQNDGAESAVFQQLF 346          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 213.772 bits (543), Expect = 1.012e-60
Identity = 124/335 (37.01%), Postives = 188/335 (56.12%), Query Frame = 2
Query:  341 TTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLD-EGQM-SP------NHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            T  L IWRIE  ++V  P   FG FF+GD YI+L I++    L YDIH+WIG+ S+ DE G AA  T ++D  L  + +QHREVQ  ES+ F+ YF   ++  KGG  SG +HV T  Y+  RLLHV+G K N++  EV  + K+ N  DVF+ D G  I QW G  + + ER +    A+++ + +R G+  + V+D E ++ SP      NH    +      + D     +L A   KL+ +SD  G+L   +VA+    +  +   D +I+D G + IYV+ G+KA++ E+K A+ +A N++KA  YP  P T V+    G  +  F ++ 
Sbjct:   16 TPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKA-ALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP--PSTQVEVQNDGAESAVFQQLF 346          

HSP 2 Score: 145.206 bits (365), Expect = 1.309e-36
Identity = 99/311 (31.83%), Postives = 154/311 (49.52%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNP--RLLHVRGE-KNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDY---PQAPITVVKK 1267
            +WRIE  ++V    +  G F+ GD Y++L  Y   ++  Y ++ W G  ++QDE   +AY+ V LD   + +P+Q R     E     S F   + +  G   G    N  E  P  RL  V+G   NN    EV +    LNS+DVF+  + SC Y W GKG + DER  A+  A     D   + + +V+ EGQ   N  F+  L    P A+ K   +       +LF  S++TG  +F      +FN+ ++ E+DVF++D    ++ ++G+ A++ E+K A   A  YLK       P+ PI VVK+
Sbjct:  402 VWRIENLELVPVDSKWLGHFYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMSIFKGRMVVYQG---GTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVA-----DTISRTEKQVVVEGQEPAN--FWMALGGKAPYANTKRLQEENLVITPRLFECSNKTG--RFLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: AVIL (advillin [Source:HGNC Symbol;Acc:HGNC:14188])

HSP 1 Score: 198.364 bits (503), Expect = 3.988e-55
Identity = 115/311 (36.98%), Postives = 170/311 (54.66%), Query Frame = 2
Query:  347 ALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNN-------EPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIID-NGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQA 1246
             + +WRIEK ++   P    G F+EGD Y++L+  +    L  DIHFWIGK S+QDE   AA  T +LD  L   P+QHREVQ +ESD F+ YF   IIY +GG  SG +HV T  Y+  RLLHV+G K NI  +EV  +  + N  DVF+ D G  I QW G  +N  ER KA   A+ + + +R G+ KI V++  + + + E    L +        +P   D+           L+ ISD  G L   +VA+    +  ++ +D +I+D +G  IYV+ G+ A+  E++ A+  A  ++K   YP +
Sbjct:   15 GIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVASGMKHVETNTYDVKRLLHVKG-KRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAKIGVIEGDKEAASPELMKVLQDTLGRRSIIKPTVPDEIIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKAEKQAAMSKALGFIKMKSYPSS 324          

HSP 2 Score: 139.428 bits (350), Expect = 9.692e-35
Identity = 90/311 (28.94%), Postives = 159/311 (51.13%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNP-RLLHVRG-EKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYL---KATDYPQAPITVVKK 1267
            +WRIE  ++V    Q +G F+ GD Y+VL  Y+   +  + ++ W G++++QDE   +AY+ VE+D   D   +Q R     E   F + F   ++  +GG     R  N     P RL  + G +K+N    EV +   +LNS+DVF+  + +  Y W GKG++ DER  A++ A  L       +      EGQ     EF++ L    P A+DK   + +   + +LF  S++TG     ++   +F + +++  DV ++D    +++++G +A+  E+++AL  A  YL    +   P  PI ++K+
Sbjct:  399 VWRIENLELVPVEYQWYGFFYGGDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTS---RKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSNDVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTVA-----EGQEPA--EFWDLLGGKTPYANDKRLQQEILDVQSRLFECSNKTGQFVVTEIT--DFTQDDLNPTDVMLLDTWDQVFLWIGAEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQ 697          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 193.356 bits (490), Expect = 8.254e-54
Identity = 116/321 (36.14%), Postives = 181/321 (56.39%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ-KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEK--KLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYP-QAPITVV 1261
            K  K   L IWR+EKF +V  P   +G+FF GD+Y++L   Q +   L YD+H+W+G   +QDE G AA  TV+LD  L+ + +QHREVQ +ES  F  YF   + Y KGG  SGF+HV   E    RL  V+G +  +  +EV  + ++ N+ D FI D G+ I+QW G  +N+ ER KA Q ++ + +++R+G+ ++ V +EG                P   +   K   A+ K  KL+++S+  G +    VA  N F +  +   D FI+D+G+   I+V+ G++A+  ERK AL  A +++   DYP Q  ++V+
Sbjct:   10 KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKG-RRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVL 329          

HSP 2 Score: 132.494 bits (332), Expect = 1.627e-32
Identity = 95/313 (30.35%), Postives = 144/313 (46.01%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEP--IADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE    V      +G+F+ GDSYI+L  Y+        I+ W G  STQDE   +A  T +LD  L   P+Q R VQ  E     S F   P IIY  G    G +   T   + RL  VR        + EV      LNS+D F+  + S  Y W+G GA++ E+  AQ+  +         L+ + +   + S    F+  L        +     K + AH  +LF  S++ G    E+V  G   + ++  +DV ++D    ++V+VG+ + + E+  AL  A  Y++   A    + PITVVK+
Sbjct:  398 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQ---TAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLR--------VLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQ 698          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 193.356 bits (490), Expect = 1.031e-53
Identity = 116/323 (35.91%), Postives = 182/323 (56.35%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ-KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEK--KLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYP-QAPITVVKK 1267
            K  K   L IWR+EKF +V  P   +G+FF GD+Y++L   Q +   L YD+H+W+G   +QDE G AA  TV+LD  L+ + +QHREVQ +ES  F  YF   + Y KGG  SGF+HV   E    RL  V+G +  +  +EV  + ++ N+ D FI D G+ I+QW G  +N+ ER KA Q ++ + +++R+G+ ++ V +EG                P   +   K   A+ K  KL+++S+  G +    VA  N F +  +   D FI+D+G+   I+V+ G++A+  ERK AL  A +++   DYP Q  ++V+ +
Sbjct:   27 KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKG-RRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPE 348          

HSP 2 Score: 132.88 bits (333), Expect = 1.615e-32
Identity = 95/313 (30.35%), Postives = 144/313 (46.01%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEP--IADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE    V      +G+F+ GDSYI+L  Y+        I+ W G  STQDE   +A  T +LD  L   P+Q R VQ  E     S F   P IIY  G    G +   T   + RL  VR        + EV      LNS+D F+  + S  Y W+G GA++ E+  AQ+  +         L+ + +   + S    F+  L        +     K + AH  +LF  S++ G    E+V  G   + ++  +DV ++D    ++V+VG+ + + E+  AL  A  Y++   A    + PITVVK+
Sbjct:  415 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQ---TAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLR--------VLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQ 715          
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Match: gsnl-1 (Gelsolin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21253])

HSP 1 Score: 197.208 bits (500), Expect = 1.800e-57
Identity = 119/320 (37.19%), Postives = 177/320 (55.31%), Query Frame = 2
Query:  326 AKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNT--REYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIA-------DDKNHKSLTAHEKKLFRISDETGHLKFEQVASG-NFNKSNIHENDVFIID--NGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            A+  K   L +WRI KF +   P+   G F+ GD+YI L  YQK  +  +D+HFW+GK ++ DE G AA KTVE+D  L   P QHRE+Q+YES +F SYFP+ I Y+ GG ESG+RHV+   + + P L H +G K N+  +EV     +LN  DVFI D G  +Y W+   + + ER K    A+ + + +R G  K+ +LD+ +   +  F++       +        DD N+      +  L+++SD +G  K   V+ G N  K  +   D FI+D  NG  I+V++G + +  ER  ALI+  NYLK    P+
Sbjct:   11 AEIGKKNGLLVWRINKFVLEPVPEVDHGVFYIGDAYIAL--YQK-YDGCWDVHFWLGKNASTDEIGVAAIKTVEIDDSLGGIPTQHREIQNYESPLFLSYFPDGIRYVSGGYESGYRHVDDQFKNWKPHLFHCKG-KRNVRCTEVECEVNSLNLGDVFILDLGKDLYVWMPPESGRLERIKGMARAKNIADHERMGIPKVHILDDVEWDNDSTFWSYFGGVSSVRKVSKGKDDDDNYWKRLTEQITLWKVSDASGAAKVSMVSQGENIRKEQLDPKDAFILDAINGG-IFVWIGHECTLEERSKALIWGQNYLKQHHLPR 325          

HSP 2 Score: 72.7886 bits (177), Expect = 1.351e-13
Identity = 57/186 (30.65%), Postives = 92/186 (49.46%), Query Frame = 2
Query:  761 KKNLNSDDVFIFDS-GSCIYQWIGKGANKDERFKA----QQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNK 1303
            K+ L+  D FI D+    I+ WIG     +ER KA    Q + +Q +  R  ++   VL+  + +   +++          D+K   + T     LF++SDE+G L  E++A  NF + ++  +DV I+D    IYV+VG  A+ NE+K AL  A  YL+    P+   T +    +GK    F K
Sbjct:  276 KEQLDPKDAFILDAINGGIFVWIGHECTLEERSKALIWGQNYLKQHHLPRWTQV-TRVLESAESTQFTQWFRDW------VDEKKKNTFTP---LLFQVSDESGLLHVEEIA--NFTQEDLDGDDVMILDALNSIYVWVGANANANEKKEALNTAKLYLEKDKLPRHKKTAIDTIFQGKEPPTFKK 449          
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Match: fli-1 (pep chromosome:WBcel235:III:8675297:8683732:-1 gene:WBGene00001443.1 transcript:B0523.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fli-1)

HSP 1 Score: 102.064 bits (253), Expect = 1.053e-22
Identity = 80/313 (25.56%), Postives = 151/313 (48.24%), Query Frame = 2
Query:  347 ALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEK-ELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGG-CESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLN-SDRNGKLKIEVLDEGQMSPNHEFYNKLSNN--EPIADDKNH--KSLTAHEKKLFRISDETGHLKFEQV--ASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNER---KNALIYAHNYLKATDYPQA 1246
             +++W IE F      +   G+F++ D+Y+VL   ++   +L + I +W+G++++ D+   +A   V L   L+      RE  + E++ F + F   I+Y++GG   SGF       +  RL         + +  V  + ++L+    F+ D+G  I+ W G  +      KA+ FA++LN  DR GK +IE   + +  P  EF+  L+ N  +P      H  +   A  KKL++++   G L+  QV    G   +  +    VF++D+   I++++G+KA+   +   +  ++  H  +   DY Q 
Sbjct:  509 GMWVWEIENFYPSIMDEAFHGQFYDADAYLVLKTTREASGQLRHAIFYWLGEHASLDKGMCSAVHAVGLRNHLNATCRTQREEMNDETEEFLTLFGEEIVYIEGGRTISGFYTTEKPAHLTRLYRAGVNGTAVEMEPVPLSVESLDPRFCFLLDAGETIWIWSGYKSRITVSNKARLFAERLNKRDRKGKSEIETCRQARCPP--EFWQALTGNPDKPQGAIVEHVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKANRLLKMAGQKLVVELHQMIDRPDYAQV 819          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0336707)

HSP 1 Score: 218.009 bits (554), Expect = 4.975e-63
Identity = 122/343 (35.57%), Postives = 203/343 (59.18%), Query Frame = 2
Query:  326 AKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTR-EYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHE-FYNKLSN-------NEPIAD-DKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLN 1312
            A   +T  L IWRIE F+ V +PK  +G+F+ GDS+IVLN  +  K+K+L +D+HFW+G  ++ DE G AA  TV+LD LL+  P+QHREVQD+ES +F SYF N I Y +GG  +GF+HV T  +   RL  V+G K N+ + +V+ +  ++N+ D FI D+GS IY ++G  A + E+ KA   A Q+ + D NG+ +++++D+     + + F++ L +       +E  AD D   +   A    L+++SD +G LK + +      ++ +   + FI+D G  I+V+VG+ A+  E+ +A+  A  +L+   YP    T + + ++G  +  F +  +
Sbjct:    6 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFD 345          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078971)

HSP 1 Score: 218.009 bits (554), Expect = 4.975e-63
Identity = 122/343 (35.57%), Postives = 203/343 (59.18%), Query Frame = 2
Query:  326 AKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTR-EYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHE-FYNKLSN-------NEPIAD-DKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLN 1312
            A   +T  L IWRIE F+ V +PK  +G+F+ GDS+IVLN  +  K+K+L +D+HFW+G  ++ DE G AA  TV+LD LL+  P+QHREVQD+ES +F SYF N I Y +GG  +GF+HV T  +   RL  V+G K N+ + +V+ +  ++N+ D FI D+GS IY ++G  A + E+ KA   A Q+ + D NG+ +++++D+     + + F++ L +       +E  AD D   +   A    L+++SD +G LK + +      ++ +   + FI+D G  I+V+VG+ A+  E+ +A+  A  +L+   YP    T + + ++G  +  F +  +
Sbjct:    6 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFD 345          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078973)

HSP 1 Score: 218.779 bits (556), Expect = 4.984e-63
Identity = 122/340 (35.88%), Postives = 202/340 (59.41%), Query Frame = 2
Query:  326 AKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNT-REYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHE-FYNKLSN-------NEPIAD-DKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNK 1303
            A   +T  L IWRIE F+ V +PK  +G+F+ GDS+IVLN  +  K+K+L +D+HFW+G  ++ DE G AA  TV+LD LL+  P+QHREVQD+ES +F SYF N I Y +GG  +GF+HV T  +   RL  V+G K N+ + +V+ +  ++N+ D FI D+GS IY ++G  A + E+ KA   A Q+ + D NG+ +++++D+     + + F++ L +       +E  AD D   +   A    L+++SD +G LK + +      ++ +   + FI+D G  I+V+VG+ A+  E+ +A+  A  +L+   YP    T + + ++G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309256)

HSP 1 Score: 218.779 bits (556), Expect = 4.984e-63
Identity = 122/340 (35.88%), Postives = 202/340 (59.41%), Query Frame = 2
Query:  326 AKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNT-REYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHE-FYNKLSN-------NEPIAD-DKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNK 1303
            A   +T  L IWRIE F+ V +PK  +G+F+ GDS+IVLN  +  K+K+L +D+HFW+G  ++ DE G AA  TV+LD LL+  P+QHREVQD+ES +F SYF N I Y +GG  +GF+HV T  +   RL  V+G K N+ + +V+ +  ++N+ D FI D+GS IY ++G  A + E+ KA   A Q+ + D NG+ +++++D+     + + F++ L +       +E  AD D   +   A    L+++SD +G LK + +      ++ +   + FI+D G  I+V+VG+ A+  E+ +A+  A  +L+   YP    T + + ++G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078969)

HSP 1 Score: 218.779 bits (556), Expect = 4.984e-63
Identity = 122/340 (35.88%), Postives = 202/340 (59.41%), Query Frame = 2
Query:  326 AKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNT-REYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHE-FYNKLSN-------NEPIAD-DKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNK 1303
            A   +T  L IWRIE F+ V +PK  +G+F+ GDS+IVLN  +  K+K+L +D+HFW+G  ++ DE G AA  TV+LD LL+  P+QHREVQD+ES +F SYF N I Y +GG  +GF+HV T  +   RL  V+G K N+ + +V+ +  ++N+ D FI D+GS IY ++G  A + E+ KA   A Q+ + D NG+ +++++D+     + + F++ L +       +E  AD D   +   A    L+++SD +G LK + +      ++ +   + FI+D G  I+V+VG+ A+  E+ +A+  A  +L+   YP    T + + ++G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 210.305 bits (534), Expect = 4.721e-60
Identity = 116/314 (36.94%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYNP-RLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKK---LFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNG--QVIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            K  K + L IWRIEK ++V  P+  +G F+ GD+Y+VL+  +++    YD+HFW+GK  +QDE   AA  + ++D  L  KP+Q+RE+Q +ES +F SYF   I Y  GG  SGF+HV T +    RL H++G +  +  +EV  +  + N+ D FI D G  IYQW G   NK ER KA Q    + +++R+G+ K+ V++EGQ          +    P  DD          +K   L+ +SD TG ++   V+  N F++SN+  ++ FI+D+G  ++I+V+ G  A+ +ERK A+  A +++K   YPQ
Sbjct:   10 KAGKYSGLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSSFYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKGGIKYKSGGVASGFQHVITNDLTARRLFHIKG-RRTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYPQ 322          

HSP 2 Score: 111.309 bits (277), Expect = 1.312e-25
Identity = 97/319 (30.41%), Postives = 151/319 (47.34%), Query Frame = 2
Query:  356 IWRIEKFKV-----VEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNII-ISEVSSTKKNLNSDDVFIF--DSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLT-AHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQ---APITVVKK 1267
            IWR+E         V    + +G+F+ GD YI+L  Y K  E++Y    W G  ST DE   +A+ TVELD  L    +Q R  Q  E     S F   P I+Y  G    G +         RL  V      I  ISEV +   +LNS+D ++     G   Y W GKGA+++E   A+   ++LN       K +++ EG+      F+  L            +S T AH  +LF  S++TG    E+V  G FN+ ++ E+DV ++D    ++V++G+ A++ ER  ++  A  Y++     +    P+ VVK+
Sbjct:  398 IWRVECGATKGDTKVPVDPETYGQFYGGDCYIILYRYSK-GEIIYT---WQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPPHLLSLFKDKPLIVYKDGTSRKGGQAPAAPT---RLFQVHKNLGTITRISEVDAKASSLNSNDAYLLKLPQGDG-YIWKGKGASEEEEKAAKYMTEKLNC------KTKMVVEGKEP--EAFWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVP-GEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYIETDPSGRDKGTPLVVVKQ 699          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 210.305 bits (534), Expect = 4.867e-60
Identity = 116/314 (36.94%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYNP-RLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKK---LFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNG--QVIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            K  K + L IWRIEK ++V  P+  +G F+ GD+Y+VL+  +++    YD+HFW+GK  +QDE   AA  + ++D  L  KP+Q+RE+Q +ES +F SYF   I Y  GG  SGF+HV T +    RL H++G +  +  +EV  +  + N+ D FI D G  IYQW G   NK ER KA Q    + +++R+G+ K+ V++EGQ          +    P  DD          +K   L+ +SD TG ++   V+  N F++SN+  ++ FI+D+G  ++I+V+ G  A+ +ERK A+  A +++K   YPQ
Sbjct:   10 KAGKYSGLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSSFYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKGGIKYKSGGVASGFQHVITNDLTARRLFHIKG-RRTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYPQ 322          

HSP 2 Score: 115.546 bits (288), Expect = 5.975e-27
Identity = 100/319 (31.35%), Postives = 156/319 (48.90%), Query Frame = 2
Query:  356 IWRIEKFKV-----VEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNII-ISEVSSTKKNLNSDDVFIF--DSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLT-AHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQ---APITVVKK 1267
            IWR+E         V    + +G+F+ GD YI+L  Y K  E++Y    W G  ST DE   +A+ TVELD  L    +Q R  Q  E     S F   P I+Y  G    G +         RL  VR     I  ISEV +   +LNS+DV++     G   Y W GKGA+++E   A+  +++LN       K +++ EG+  P+  F+  L            +S T AH  +LF  S++TG    E+V  G FN+ ++ E+DV ++D    ++V++G+ A++ ER  ++  A  Y++     +    P+ VVK+
Sbjct:  398 IWRVECGATKGDTKVPVDPETYGQFYGGDCYIILYRYSK-GEIIYT---WQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPPHLLSLFKDKPLIVYKDGTSRKGGQAPAAPT---RLFQVRKNLGTITRISEVDAKASSLNSNDVYLLKLPQGDG-YIWKGKGASEEEEKAAKYMSEKLNC------KTKMVVEGK-EPDV-FWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVP-GEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYIETDPSGRDKGTPLVVVKQ 699          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: vill (villin-like [Source:ZFIN;Acc:ZDB-GENE-081222-1])

HSP 1 Score: 209.149 bits (531), Expect = 4.126e-59
Identity = 122/314 (38.85%), Postives = 180/314 (57.32%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSN---------NEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYP 1240
            +   L IW I K ++V  P+Q FG FFEGD YI+LN+     + + DIH+WIG  S+QDE G AA    +LD      P+Q+REVQ +ES  FKSYF N +IY KGG  SGF HV T  YN  RLLHV+G K ++   EV  +  + N  DVF+ D G  I QW G  +N+ E+ KA   AQ + + +R G+ +I V++  Q   + E    + +          E I DDK  ++  ++  KL+++SD +G L  ++VA     +  +  +D +I+D G   I V+ G+ AS+ ER++A+  A  ++KA +YP
Sbjct:   13 RKPGLQIWTINKMQMVAVPEQAFGNFFEGDCYIILNVSNNPAQSI-DIHYWIGNSSSQDEQGAAAIYVTQLDENFGGSPVQYREVQGHESVKFKSYFKNGLIYKKGGVASGFTHVETNVYNIQRLLHVKGTK-HVTGREVEVSWNSFNLGDVFLLDLGKAIIQWNGPQSNRQEKLKAVMLAQDIRDRERGGRAQIGVIEGAQEEASPELMKVMVSVLGQRIGQMKEAIPDDKPGQNQISN-VKLYQVSDASGQLLVQEVAVSPLTQDLLCSSDCYILDQGGTSIMVWKGKGASNEERRSAMGRAVGFIKAKNYP 323          

HSP 2 Score: 147.132 bits (370), Expect = 1.828e-37
Identity = 99/310 (31.94%), Postives = 159/310 (51.29%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNPRLLHVRGEKN-NIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            +WRIE  ++ E  +  +G+F+ GD Y+VL  Y +  +  Y ++ W G+++TQDE   +AY+ V LD   +  P Q R V   E   F + F   +I  +GG  +G   V   +   RL  VRG    N   +EV +   +LN++DVF+  +   ++ W GKG + DER   +  A  L    +G+ K  V+ EGQ      F+  L    P A DK   + ++ HE +LF  S++TG     +VA  +F + ++ E+DV ++D    I++++G  A+  E + +   A  YLK   A      PIT VK+
Sbjct:  400 VWRIENLELKEVDRSTYGQFYGGDCYLVLYTYNRANKPQYILYIWQGRHATQDEVTASAYQAVNLDNKYNGAPTQVRVVMGKEPRHFMAIFKGRLIIFEGG--TGRSGVVNPDPAARLFQVRGTHELNTKATEVPARASSLNTNDVFLLKTYQTVFLWYGKGCSGDEREMGKAVADLL----SGQDKQTVM-EGQEPA--AFWVPLGGKAPYASDKRLEEEVSLHEPRLFECSNQTGRFLMTEVA--DFTQDDLDEDDVMLLDTWDEIFLWIGNSANQYEIQESSSSAVEYLKTHPAGRDAGTPITTVKQ 698          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 204.527 bits (519), Expect = 4.609e-58
Identity = 120/314 (38.22%), Postives = 181/314 (57.64%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIY-QKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEG--QMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            +  K   L +WRIEKF +V  P+  +G F+ GD+Y+VL    Q    L YD+HFW+G Y TQDE G+AA  TV++D  L  KPIQ+REVQ +ES  F  YF   + Y++GG  SGF+HV T E    R+L V+G +  +  +EV  +  + N  D FI D G+ IYQW G  +N+ E+ KA Q A+ + +++R+G+ ++ V DEG  +         K    E  +DD    +      KL+++SD +G +    VA+ N F +S +  +D FI+D+G    I+V+ G+ A+  ERK A+  A  ++K   YP+
Sbjct:    9 RAGKEPGLQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKG-RRVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCDEGVEREKMLEVLGEKPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 134.035 bits (336), Expect = 4.046e-33
Identity = 91/320 (28.44%), Postives = 145/320 (45.31%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHK-SLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFN 1300
            IWRIE    V      +G+F+ GDSYI+L  Y+      + I+ W G  STQDE G +A    +LD  L   P+Q R VQ  E     S F   P +++  G    G +   T     RL  VR        + E+ +   NLNS+D F+  + +  + W+G+GA+  E+  AQQ          G L +   +  +   +  F++ L            K  + AH  +LF  S++TG    E+V  G   + ++  +DV I+D    ++V++G +A D E+  A+  A  Y++     + P T + K  +G     F 
Sbjct:  397 IWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGQPMVVHKGGTSREGGQ---TAPAETRLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLC--------GILGVSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEV-PGEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFT 704          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 204.527 bits (519), Expect = 4.609e-58
Identity = 120/314 (38.22%), Postives = 181/314 (57.64%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIY-QKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEG--QMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            +  K   L +WRIEKF +V  P+  +G F+ GD+Y+VL    Q    L YD+HFW+G Y TQDE G+AA  TV++D  L  KPIQ+REVQ +ES  F  YF   + Y++GG  SGF+HV T E    R+L V+G +  +  +EV  +  + N  D FI D G+ IYQW G  +N+ E+ KA Q A+ + +++R+G+ ++ V DEG  +         K    E  +DD    +      KL+++SD +G +    VA+ N F +S +  +D FI+D+G    I+V+ G+ A+  ERK A+  A  ++K   YP+
Sbjct:    9 RAGKEPGLQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKG-RRVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCDEGVEREKMLEVLGEKPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 134.035 bits (336), Expect = 4.046e-33
Identity = 91/320 (28.44%), Postives = 145/320 (45.31%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHK-SLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFN 1300
            IWRIE    V      +G+F+ GDSYI+L  Y+      + I+ W G  STQDE G +A    +LD  L   P+Q R VQ  E     S F   P +++  G    G +   T     RL  VR        + E+ +   NLNS+D F+  + +  + W+G+GA+  E+  AQQ          G L +   +  +   +  F++ L            K  + AH  +LF  S++TG    E+V  G   + ++  +DV I+D    ++V++G +A D E+  A+  A  Y++     + P T + K  +G     F 
Sbjct:  397 IWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGQPMVVHKGGTSREGGQ---TAPAETRLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLC--------GILGVSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEV-PGEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFT 704          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 216.853 bits (551), Expect = 1.376e-61
Identity = 132/347 (38.04%), Postives = 195/347 (56.20%), Query Frame = 2
Query:  320 NAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSD-RNGKLKIEVLDEGQMSPN---------HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG*R 1321
            N    C+   L IW +EK K+V  P++ +G FFEGD YI+L   Q    L+ DIH+WIGK S+QDE G+AA+   ++D LL   PIQHREVQ +ES  FKSYF N +IY KGG  SGF+HV T  YN  RLLHV+G+K ++  +EV+ +  + N  DVF+ D G  I QW G  +NK ER +A   AQ +  D R G+ +I V+D  Q SP+              +L ++ P  D+K  +   A+  +L+ + ++  +L  +++A+    +  +   D  I+D G V IYV+ G+ +S  E+  A   A  +++A  YP  P T V+    G  +  F ++    R
Sbjct:    4 NLENICRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKGKK-HVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVP--DEKADEQQKAN-VRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP--PTTNVEVVNDGAESAMFKQLFQNWR 344          

HSP 2 Score: 152.91 bits (385), Expect = 2.564e-39
Identity = 97/313 (30.99%), Postives = 163/313 (52.08%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN--IIYLKGGCESGFRHVNTREYNPRLLHVRGEKN-NIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQA-----PITVVKK 1267
            +WRIEK ++ E   + +G+F+ GD Y++L  Y K     Y ++ W+G++++QDE    A++ V+LD    D+P+Q R     E    ++ F    IIY  G    G   V+  E   +L  V+G    N   +EV +   +LNS+DVF+  + S  Y W GKG + DER  A+  A  ++     K   + + EGQ     EF+  L    P A DK   +    +  +LF  S++TG     +V   +F +S++ E+DV ++D  + I+++VG+ A+D E+  ++  +  YL+A  +P       PI +VK+
Sbjct:  396 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLG---VHEPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDEREMAKTVANIIS-----KQDKQTILEGQEP--AEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTGRFVMTEVV--DFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HPAGRDLATPIILVKQ 694          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 216.468 bits (550), Expect = 1.506e-61
Identity = 132/347 (38.04%), Postives = 195/347 (56.20%), Query Frame = 2
Query:  320 NAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSD-RNGKLKIEVLDEGQMSPN---------HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG*R 1321
            N    C+   L IW +EK K+V  P++ +G FFEGD YI+L   Q    L+ DIH+WIGK S+QDE G+AA+   ++D LL   PIQHREVQ +ES  FKSYF N +IY KGG  SGF+HV T  YN  RLLHV+G+K ++  +EV+ +  + N  DVF+ D G  I QW G  +NK ER +A   AQ +  D R G+ +I V+D  Q SP+              +L ++ P  D+K  +   A+  +L+ + ++  +L  +++A+    +  +   D  I+D G V IYV+ G+ +S  E+  A   A  +++A  YP  P T V+    G  +  F ++    R
Sbjct:    4 NLENICRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKGKK-HVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVP--DEKADEQQKAN-VRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP--PTTNVEVVNDGAESAMFKQLFQNWR 344          

HSP 2 Score: 152.91 bits (385), Expect = 3.160e-39
Identity = 97/313 (30.99%), Postives = 163/313 (52.08%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN--IIYLKGGCESGFRHVNTREYNPRLLHVRGEKN-NIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQA-----PITVVKK 1267
            +WRIEK ++ E   + +G+F+ GD Y++L  Y K     Y ++ W+G++++QDE    A++ V+LD    D+P+Q R     E    ++ F    IIY  G    G   V+  E   +L  V+G    N   +EV +   +LNS+DVF+  + S  Y W GKG + DER  A+  A  ++     K   + + EGQ     EF+  L    P A DK   +    +  +LF  S++TG     +V   +F +S++ E+DV ++D  + I+++VG+ A+D E+  ++  +  YL+A  +P       PI +VK+
Sbjct:  396 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLG---VHEPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDEREMAKTVANIIS-----KQDKQTILEGQEPA--EFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTGRFVMTEVV--DFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HPAGRDLATPIILVKQ 694          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 211.46 bits (537), Expect = 8.448e-60
Identity = 131/347 (37.75%), Postives = 194/347 (55.91%), Query Frame = 2
Query:  320 NAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSD-RNGKLKIEVLDEGQMSPN---------HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG*R 1321
            N    C+   L IW +EK K+V  P++ +G FFEGD YI+L        L+ DIH+WIGK S+QDE G+AA+   ++D LL   PIQHREVQ +ES  FKSYF N +IY KGG  SGF+HV T  YN  RLLHV+G+K ++  +EV+ +  + N  DVF+ D G  I QW G  +NK ER +A   AQ +  D R G+ +I V+D  Q SP+              +L ++ P  D+K  +   A+  +L+ + ++  +L  +++A+    +  +   D  I+D G V IYV+ G+ +S  E+  A   A  +++A  YP  P T V+    G  +  F ++    R
Sbjct:   30 NLENICRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYT---PNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKGKK-HVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVP--DEKADEQQKAN-VRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP--PTTNVEVVNDGAESAMFKQLFQNWR 367          

HSP 2 Score: 152.91 bits (385), Expect = 3.000e-39
Identity = 97/313 (30.99%), Postives = 163/313 (52.08%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN--IIYLKGGCESGFRHVNTREYNPRLLHVRGEKN-NIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQA-----PITVVKK 1267
            +WRIEK ++ E   + +G+F+ GD Y++L  Y K     Y ++ W+G++++QDE    A++ V+LD    D+P+Q R     E    ++ F    IIY  G    G   V+  E   +L  V+G    N   +EV +   +LNS+DVF+  + S  Y W GKG + DER  A+  A  ++     K   + + EGQ     EF+  L    P A DK   +    +  +LF  S++TG     +V   +F +S++ E+DV ++D  + I+++VG+ A+D E+  ++  +  YL+A  +P       PI +VK+
Sbjct:  419 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLG---VHEPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDEREMAKTVANIIS-----KQDKQTILEGQEPA--EFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTGRFVMTEVV--DFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HPAGRDLATPIILVKQ 717          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 201.06 bits (510), Expect = 1.091e-56
Identity = 123/311 (39.55%), Postives = 179/311 (57.56%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYNP-RLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNE--PIADDKNHKSLTAHEK--KLFRISDETGHLKFEQVA-SGNFNKSNIHENDVFIIDNG--QVIYVYVGEKASDNERKNALIYAHNYLKATDYP 1240
            ++T L IWRIE   +V  PK  +G F+ GD+Y+VLN   K     YD+H+W+GK  +QDE   AA  TV+LD  L  KP+Q+RE+Q +ES  F  YF   I Y  GG  SGF+HV T E    RLLH++G +  +  +EV  +  N NS D FI D G+ IYQW G   NK ER KA Q A  + ++++NG+ +I V++EG   PN E    L      P  DD +  +   + K  KL+ +SD +G +K   VA    F+K+ +   + FI+D+   + I+V+ G+ A+  ERK A+  A  +++  +YP
Sbjct:   13 QSTGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGRR-VVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVVEEGS-EPN-ELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 320          

HSP 2 Score: 97.4413 bits (241), Expect = 6.621e-21
Identity = 95/316 (30.06%), Postives = 149/316 (47.15%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNII-ISEVSSTKKNLNSDDVFIF----DSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLT-AHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQ---APITVVKK 1267
            I+R+E    V      FG+F+ GD YI+L  Y K       I+ W G  +T+DE   +A+ TV+LD  L D+ +Q R  Q  E     S F   P IIY  G    G +   T     RL  +R   + I  I EV +    LNS+DVF+     +SG   Y+WIGKGA+ +E   A+  A  L      + K+  + EGQ  P+ EF++ L+  +        +S +  +  +LF  S++TG     QV    F         +F +     +++++G+ A++ E+K +L  A  Y++     +    PI  VK+
Sbjct:  398 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAKG----LIIYTWQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFKDKPLIIYKDGTSRKGGQ---TPPSAVRLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSG---YKWIGKGASGEEEKAAEYIANVL------RCKVSKIAEGQ-EPD-EFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRF-LVQVLMIRF---------LFHLK----VFLWIGKDANEQEKKESLKSAKQYIETDPSGRDKGIPIVSVKQ 681          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 201.06 bits (510), Expect = 1.127e-56
Identity = 123/311 (39.55%), Postives = 179/311 (57.56%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYNP-RLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNE--PIADDKNHKSLTAHEK--KLFRISDETGHLKFEQVA-SGNFNKSNIHENDVFIIDNG--QVIYVYVGEKASDNERKNALIYAHNYLKATDYP 1240
            ++T L IWRIE   +V  PK  +G F+ GD+Y+VLN   K     YD+H+W+GK  +QDE   AA  TV+LD  L  KP+Q+RE+Q +ES  F  YF   I Y  GG  SGF+HV T E    RLLH++G +  +  +EV  +  N NS D FI D G+ IYQW G   NK ER KA Q A  + ++++NG+ +I V++EG   PN E    L      P  DD +  +   + K  KL+ +SD +G +K   VA    F+K+ +   + FI+D+   + I+V+ G+ A+  ERK A+  A  +++  +YP
Sbjct:   13 QSTGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGRR-VVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVVEEGS-EPN-ELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 320          

HSP 2 Score: 120.168 bits (300), Expect = 1.847e-28
Identity = 93/291 (31.96%), Postives = 149/291 (51.20%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNII-ISEVSSTKKNLNSDDVFIF----DSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLT-AHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNAL 1201
            I+R+E    V      FG+F+ GD YI+L  Y K       I+ W G  +T+DE   +A+ TV+LD  L D+ +Q R  Q  E     S F   P IIY  G    G +   T     RL  +R   + I  I EV +    LNS+DVF+     +SG   Y+WIGKGA+ +E   A+  A  L      + K+  + EGQ  P+ EF++ L+  +        +S +  +  +LF  S++TG    E+V  G F + ++ E+DV ++D  + +++++G+ A++ E+K +L
Sbjct:  397 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAKG----LIIYTWQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFKDKPLIIYKDGTSRKGGQ---TPPSAVRLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSG---YKWIGKGASGEEEKAAEYIANVL------RCKVSKIAEGQ-EPD-EFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEVP-GEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESL 668          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Vil1 (villin 1 [Source:MGI Symbol;Acc:MGI:98930])

HSP 1 Score: 207.223 bits (526), Expect = 1.925e-58
Identity = 124/336 (36.90%), Postives = 184/336 (54.76%), Query Frame = 2
Query:  341 TTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLD---EGQMSP------NHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            T  + IWRIE  ++V  P   FG FF+GD Y+VL I++    L YDIH+WIG+ S+QDE G AA  T ++D  L  + +QHREVQ  ES+ F+SYF   ++  KGG  SG +HV T   +  RLLHV+G K N++  EV  + K+ N  DVF+ D G  I QW G  +N+ ER +    A+++ + +R G+  + V+D   EG  SP      NH    +      I+D     +  A   KL+ +SD  G L   +VA+    +  +   D +I+D G + I+V+ G+ A+  ER  A+  A N++KA  YP  P T V+    G  +  F ++ 
Sbjct:   16 TPGIQIWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHKTSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFKQGLVIRKGGVASGMKHVETNSCDVQRLLHVKG-KRNVLAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGD-SPQLMAIMNHVLGPRKELKAAISDSVVEPAAKA-ALKLYHVSDSEGKLVVREVATRPLTQDLLKHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYP--PSTQVEVQNDGAESPIFQQLF 346          

HSP 2 Score: 144.821 bits (364), Expect = 1.054e-36
Identity = 100/313 (31.95%), Postives = 156/313 (49.84%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNP--RLLHVRGE-KNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYP-----QAPITVVKK 1267
            +WRIE  ++V    +  G F+ GD Y++L  Y   ++  Y ++ W G  ++QDE   +AY+ V LD   +D+P+Q R     E     S F   + +  G   G    N  E  P  RL  VRG   +N    EV++   +LNS+DVFI  + SC Y W GKG + DER  A+  A     D   + + +V+ EGQ   N  F+  L    P A+ K   +       +LF  S++TG  +F      +FN+ ++ E DVF++D    ++ ++G+ A++ E+K A      YLK   +P     + PI VVK+
Sbjct:  402 VWRIEDLELVPVESKWLGHFYGGDCYLLLYTYLIGEKQHYLLYIWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQG---GTSRKNNLEPVPSTRLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSCCYLWCGKGCSGDEREMAKMVA-----DTISRTEKQVVVEGQEPAN--FWMALGGKAPYANTKRLQEENQVITPRLFECSNQTG--RFLATEIFDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKKAAATTVQEYLKT--HPGNRDLETPIIVVKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 195.667 bits (496), Expect = 7.715e-56
Identity = 117/323 (36.22%), Postives = 180/323 (55.73%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ-KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPN--HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYP-QAPITVVKK 1267
            K  K   L IWR+EKF +V  P   +G+FF GD+Y++L   Q +   L YD+H+W+G   +QDE G AA  TV+LD  L+ + +QHREVQ +ES  F  YF   + Y KGG  SGF+HV   E    RL  V+G +  +  +EV  +  + N+ D FI D G+ IYQW G G+NK ER KA Q ++ + +++R+G+ ++ V +EG            K +  E   D     +      KL+++S+  G +    VA  N F +  +   D FI+D+G+   I+V+ G++A+  ERK AL  A +++    YP Q  ++V+ +
Sbjct:   21 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRR-VVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPE 342          

HSP 2 Score: 88.9669 bits (219), Expect = 2.244e-18
Identity = 58/162 (35.80%), Postives = 75/162 (46.30%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIG 829
            IWRIE    V      +G+F+ GDSYI+L  Y+        I+ W G  STQDE   +A  T +LD  L   P+Q R VQ  E     S F   P IIY  G    G +   T   + RL  VR   +    + EV      LNS+D F+  + S  Y W+G
Sbjct:  409 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQ---TAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVG 567          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 196.052 bits (497), Expect = 7.930e-55
Identity = 117/323 (36.22%), Postives = 180/323 (55.73%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ-KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPN--HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYP-QAPITVVKK 1267
            K  K   L IWR+EKF +V  P   +G+FF GD+Y++L   Q +   L YD+H+W+G   +QDE G AA  TV+LD  L+ + +QHREVQ +ES  F  YF   + Y KGG  SGF+HV   E    RL  V+G +  +  +EV  +  + N+ D FI D G+ IYQW G G+NK ER KA Q ++ + +++R+G+ ++ V +EG            K +  E   D     +      KL+++S+  G +    VA  N F +  +   D FI+D+G+   I+V+ G++A+  ERK AL  A +++    YP Q  ++V+ +
Sbjct:   10 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKG-RRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPE 331          

HSP 2 Score: 133.265 bits (334), Expect = 6.031e-33
Identity = 100/316 (31.65%), Postives = 149/316 (47.15%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSN-----NEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE    V      +G+F+ GDSYI+L  Y+        I+ W G  STQDE   +A  T +LD  L   P+Q R VQ  E     S F   P IIY  G    G +   T   + RL  VR   +    + EV      LNS+D F+  + S  Y W+G GA++ E+  AQ+  + L   R+  +++E   EG  S    F+  L         P   DK    + AH  +LF  S+  G    E+V  G   + ++  +DV ++D    ++V+VG+ + + E+  AL  A  Y++   A    + PITVV++
Sbjct:  398 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQ---TAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVL---RSQHVQVE---EG--SEPDAFWEALGGKTAYRTSPRLKDKK---MDAHPPRLFACSNRIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQ 698          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 196.438 bits (498), Expect = 8.713e-55
Identity = 117/323 (36.22%), Postives = 180/323 (55.73%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ-KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPN--HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYP-QAPITVVKK 1267
            K  K   L IWR+EKF +V  P   +G+FF GD+Y++L   Q +   L YD+H+W+G   +QDE G AA  TV+LD  L+ + +QHREVQ +ES  F  YF   + Y KGG  SGF+HV   E    RL  V+G +  +  +EV  +  + N+ D FI D G+ IYQW G G+NK ER KA Q ++ + +++R+G+ ++ V +EG            K +  E   D     +      KL+++S+  G +    VA  N F +  +   D FI+D+G+   I+V+ G++A+  ERK AL  A +++    YP Q  ++V+ +
Sbjct:   59 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKG-RRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPE 380          

HSP 2 Score: 134.035 bits (336), Expect = 4.654e-33
Identity = 100/316 (31.65%), Postives = 149/316 (47.15%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSN-----NEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE    V      +G+F+ GDSYI+L  Y+        I+ W G  STQDE   +A  T +LD  L   P+Q R VQ  E     S F   P IIY  G    G +   T   + RL  VR   +    + EV      LNS+D F+  + S  Y W+G GA++ E+  AQ+  + L   R+  +++E   EG  S    F+  L         P   DK    + AH  +LF  S+  G    E+V  G   + ++  +DV ++D    ++V+VG+ + + E+  AL  A  Y++   A    + PITVV++
Sbjct:  447 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQ---TAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVL---RSQHVQVE---EG--SEPDAFWEALGGKTAYRTSPRLKDKK---MDAHPPRLFACSNRIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQ 747          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Avil (advillin [Source:MGI Symbol;Acc:MGI:1333798])

HSP 1 Score: 195.667 bits (496), Expect = 2.541e-54
Identity = 116/310 (37.42%), Postives = 170/310 (54.84%), Query Frame = 2
Query:  350 LFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLD-------EGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIID-NGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQA 1246
            +  WRIEK ++   P    G F+EGD YIVL+  +    L  +IHFWIGK S+QDE   AA  T +LD  L   P+QHREVQ +ESD F+ YF   IIY KGG  SG +HV T  Y+  RLLHV+G K NI  +EV  +  + N  DVF+ D G  I QW G  +N  ER KA   A+ + + +R G+ +I V++        G M+   +   + S  +P   D+           L+ +SD  G L   +VA+    +  ++ +D +I+D +G  IYV+ G+ A+  E++ A+  A +++K   YP +
Sbjct:   16 IITWRIEKMELALVPLSAHGNFYEGDCYIVLSTRRVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKKGGVASGMKHVETNTYDVKRLLHVKG-KRNIQATEVEMSWDSFNRGDVFLLDLGMVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPGLMTVLQDTLGRRSMIKPAVSDEIMDQQQKSSIMLYHVSDTAGQLSVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKVEKQAAMSKALDFIKMKGYPSS 324          

HSP 2 Score: 133.265 bits (334), Expect = 8.147e-33
Identity = 97/313 (30.99%), Postives = 160/313 (51.12%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN--IIYLKGGCESGFRHVNTREYNP--RLLHVRG-EKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAH-EKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYL---KATDYPQAPITVVKK 1267
            +WRIE  ++V    Q  G F+ GD Y+VL  Y    +  Y ++ W G+++++DE   +AY+ VE+D   D  P+Q R     E   F + F    +IY     E G       E +P  RL  + G +K+N    EVS++  +LNS+DVF+  + +  Y W GKG++ DER  A++    L  D N     + + EGQ  P  EF++ L      A+DK  +  T   + +LF  S++TG     +V   +F + ++   DV ++D    +++++G +A+  E+K AL  A  YL    +   P  PI ++K+
Sbjct:  399 VWRIENLELVPVEYQWHGFFYGGDCYLVLYTYDVNGKPHYILYIWQGRHASRDELAASAYRAVEVDQQFDGAPVQVRVSMGKEPRHFMAIFKGKLVIY-----EGGTSRKGNEEPDPPVRLFQIHGNDKSNTKAVEVSASASSLNSNDVFLLRTQAEHYLWYGKGSSGDERAMAKELVDLL-CDGNA----DTVAEGQEPP--EFWDLLGGKTAYANDKRLQQETLDVQVRLFECSNKTGRFLVTEVT--DFTQEDLSPGDVMLLDTWDQVFLWIGAEANATEKKGALSTAQEYLVTHPSGRDPDTPILIIKQ 697          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q8MPM1|GELS2_LUMTE (Gelsolin-like protein 2 OS=Lumbricus terrestris OX=6398 GN=gelsolin PE=1 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 3.927e-110
Identity = 174/370 (47.03%), Postives = 233/370 (62.97%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSN-NEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            + KA++YDWKDSN+ + GS+ D+SVKK SA  E AW      +   L IWRI  FKV EWP++ +G FF GDSYI+LN Y+    +EL YD+HFWIG  STQDEY  AAYKTVELD  LDD  IQHR+ +  ESD+F SYF N +  ++GG E GF +V   EY  RLLH  G K +I++ EV    + L SDDVFI D G  +YQW G G+NKDERFKA Q+ Q L ++R G    + L+E  +  +HEFY  L+  +E + +D+     +A  K L R+SD  GH K   V +G+   S++   DVFI+DNG   +V+VG  AS  E++N L YAH++L  T +P  PI    +  +G+ ++ FN  L
Sbjct:    4 LVKAKRYDWKDSNLAMFGSALDKSVKKESALKEAAWKG--VGEKVGLKIWRIVNFKVTEWPEKDYGSFFSGDSYIILNTYKLKGREELAYDVHFWIGSKSTQDEYCVAAYKTVELDAYLDDAAIQHRDAEGNESDLFLSYFENGLTIMEGGAEMGFNNVKPEEYKARLLHFSGLKKHIVVKEVPLCPQRLKSDDVFILDLGRTLYQWNGTGSNKDERFKAMQYLQNLKAER-GAATSKTLEEEHIDKSHEFYTSLTGEDEDLPEDQTD---SAAVKTLLRVSDAAGHFKSTVVKTGHIAASDLDSKDVFILDNGSTCFVWVGNGASAQEKRNGLGYAHSHLMKTPHPLIPIL---RHQRGQASKCFNAAL 364          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q7JQD3|GELS1_LUMTE (Gelsolin-like protein 1 OS=Lumbricus terrestris OX=6398 GN=AM PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.137e-105
Identity = 172/368 (46.74%), Postives = 229/368 (62.23%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ---KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNH-KSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFN 1300
            + KA++YDWKDSN+ L GS  ++ VKK SA TE AW  A   +   L IWRI  FKV EWP+ + G+F+ GDSYI+LN Y+   K  EL YD+HFWIG  S+QDEYGTAAYKTVELDT LDDKP+QHREVQ YES++F++YF   +  L+GG E+GF HV   EY PRLLH  G+K  I + EV   K+ L+  DVFI D G  +YQW GK ++K+E FKA Q+   + S+R  K + E L++     +H+FY  L+      D+ N  K L   E +L ++SD  GHLK  +V  G  N  +   NDVFI+D G   +V+VG+             +H +L  T +P API V+K   +G+  + FN
Sbjct:    5 LIKAKEYDWKDSNLALFGSDTEKQVKKDSAATEPAWKGA--GQKEGLKIWRIVNFKVTEWPQNQHGKFYNGDSYIILNTYKPDPKSNELAYDVHFWIGSQSSQDEYGTAAYKTVELDTFLDDKPVQHREVQGYESELFRNYFKQGLTILEGGAETGFHHVKPTEYKPRLLHFSGQKQQIYVHEVPLVKERLDHKDVFILDLGLTLYQWNGKESSKEEGFKAMQYLGLMRSERP-KAEAETLEDESTPESHKFYTSLTGT----DEPNLVKPLVKEENQLLKVSDAGGHLKTTEVKRGAVNSKDFSSNDVFILDTGDQCFVWVGKGRFAVGEAEWTRISHAHLMKTCHPLAPIHVIK---EGQLCKAFN 362          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q24800|SEVE_ECHGR (Severin OS=Echinococcus granulosus OX=6210 GN=AG8 PE=2 SV=3)

HSP 1 Score: 295.434 bits (755), Expect = 2.518e-95
Identity = 162/374 (43.32%), Postives = 224/374 (59.89%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEK--ELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNI----IYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPN----HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNK 1303
            + KA+ YDWKDSN+EL GSS+DR VKK SA TEK W       +  L +WR+ +F +   P    G F+ GDSY++    +     +LLY++HFWIGK+ST DEYGTAAYKTVELDT LDD  +QHREV+ YES +FKSYF  +    + LKGG  SGFRHV   EY PRLL    E     + +V+ +K++++S DVFI D GS  YQ+ G   +  E+  A  F Q L S RNG+    VLDE     +    HEF+  L +  P+ + +  K +    K L+++SD +G L+   V+ G+ +K +I  +DV+II   + ++VY+G+  S  E++NAL  AH +L+    P  PITVV  +     AE F K
Sbjct:    4 LVKAKDYDWKDSNMELFGSSKDRQVKKESAMTEKCWEPVGRATSPFLMVWRVNQFTLEPVPSDEIGNFYNGDSYVICKATRSPGGDKLLYNVHFWIGKHSTADEYGTAAYKTVELDTFLDDAAVQHREVEGYESQLFKSYFDKLVILKVILKGGYASGFRHVKPDEYRPRLLRFCKEGKTTYMRQVAFSKQSVHSGDVFILDLGSRAYQFNGSKCSAFEKSSAAAFLQDLESKRNGRCNTSVLDEADTPQDVGVLHEFWTALPDV-PVKELEPPKEVI---KSLYKLSDSSGKLELTIVSEGSASKHDIKPDDVYIILTKEGLFVYIGKDCSVLEKRNALSNAHKFLQTCPNPFLPITVVTDE----QAESFLK 369          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|P10733|SEVE_DICDI (Severin OS=Dictyostelium discoideum OX=44689 GN=sevA PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.397e-90
Identity = 148/337 (43.92%), Postives = 205/337 (60.83%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYL 1222
            M K  K D   +NV  IG+  D+  +  +A TE  W      +   L IWRIE FKVV  P+  +G+F++GDSYI+L+ +++   L +DIHF++G ++TQDE GTAAYKTVELD  L   PIQ+R+ Q YES  F S FP    L GG ESGF HV   EY PRLLH+ G+K N  ++EV     +LNS D F+ D+G  IYQ+ G  ++  E+ KA + A+ ++++R G  K+EV  E       EF+  L     IA  K+  + T  EK L+++SD +G LKF +V+ G  NKS++   DVFIID G  IY ++G K+S NE+K A  +A  YL
Sbjct:    1 MIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVG--QAPGLKIWRIENFKVVPVPESSYGKFYDGDSYIILHTFKEGNSLKHDIHFFLGTFTTQDEAGTAAYKTVELDDFLGGAPIQYRQCQSYESPSFLSLFPKYFILSGGVESGFNHVKPTEYKPRLLHISGDK-NAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLLGGKGAIA-AKHETAPTKSEKVLYKLSDASGSLKFSEVSRGKINKSSLKSEDVFIIDLGNEIYTWIGSKSSPNEKKTAFSHATQYL 333          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q07171|GELS_DROME (Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 4.996e-62
Identity = 122/340 (35.88%), Postives = 202/340 (59.41%), Query Frame = 2
Query:  326 AKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNT-REYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHE-FYNKLSN-------NEPIAD-DKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNK 1303
            A   +T  L IWRIE F+ V +PK  +G+F+ GDS+IVLN  +  K+K+L +D+HFW+G  ++ DE G AA  TV+LD LL+  P+QHREVQD+ES +F SYF N I Y +GG  +GF+HV T  +   RL  V+G K N+ + +V+ +  ++N+ D FI D+GS IY ++G  A + E+ KA   A Q+ + D NG+ +++++D+     + + F++ L +       +E  AD D   +   A    L+++SD +G LK + +      ++ +   + FI+D G  I+V+VG+ A+  E+ +A+  A  +L+   YP    T + + ++G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1W6I1A3 (Gelsolin-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 6.565e-178
Identity = 243/244 (99.59%), Postives = 243/244 (99.59%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSP 943
            MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDER KAQQFAQQLNSDRNGKLKIEVLDEGQMSP
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERXKAQQFAQQLNSDRNGKLKIEVLDEGQMSP 244          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8FYV1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.835e-141
Identity = 199/366 (54.37%), Postives = 253/366 (69.13%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            M K ++YDWKDSN+ L GS  +R VKK SA+ E AW      +   L++WRIE FKVVEWP+  +G+F+ GDSYI+LN Y +  +L YD+HFWIGK ST DEYGTAAYKTVELDTLLDD P+QHREVQ +ES + +SYFP I YL GGC SGFR+V TREY PRLLHVRGE+ NI+++EV  ++K L++ DV+I D G    QW G GANK+E+FKA Q+   L S+RNG+L    L+E      HEFY  L++ E   D  +  S  A +K++ ++SD TG L F+ V++ + +KSNI E+DVFIIDNG  +YVYVGE AS  ER NAL YAHNYL+ +  P  P+TVV      K    FN V 
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSYFPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVERDSASGGSPGA-QKRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASMTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8GIF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 2.306e-141
Identity = 199/366 (54.37%), Postives = 253/366 (69.13%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            M K ++YDWKDSN+ L GS  +R VKK SA+ E AW      +   L++WRIE FKVVEWP+  +G+F+ GDSYI+LN Y +  +L YD+HFWIGK ST DEYGTAAYKTVELDTLLDD P+QHREVQ +ES + +SYFP I YL GGC SGFR+V TREY PRLLHVRGE+ NI+++EV  ++K L++ DV+I D G    QW G GANK+E+FKA Q+   L S+RNG+L    L+E      HEFY  L++ E   D  +  S  A +K++ ++SD TG L F+ V++ + +KSNI E+DVFIIDNG  +YVYVGE AS  ER NAL YAHNYL+ +  P  P+TVV      K    FN V 
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSYFPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVERDSASGGSPGA-QKRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASLTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8GFK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019412g3 PE=4 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 8.976e-139
Identity = 202/370 (54.59%), Postives = 258/370 (69.73%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEK--ELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKS-LTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLN 1312
            M+K +KYDWKDSN+ L GS  ++ VKK++++ E AW   K C +  LF+WRIEKFKV  WPK+ +G+FF GDSYIVLN+Y+     ELLYD+HFWIGK+STQDEYGTAAYKTVELDT LDDK +QHREVQ++ES MFKSYF  I YLKGGC +GFR V   EY PRLLH  G + NI + EV  T+K LNS+DVFI D G   YQW GK  NKDER KA  F QQL ++R+GK +   LDE  +   H+FY  L +          KS + + +K +FR+SDE+G L++  V+ GN  +S I+E+DV+IID G  I+VYVG +ASD E+ NAL YAH+YLK T +P  P+T  + ++K    E   KVL+
Sbjct:    1 MQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVYKDPDGDELLYDVHFWIGKHSTQDEYGTAAYKTVELDTFLDDKAVQHREVQEHESSMFKSYFKTITYLKGGCATGFRQVKPEEYKPRLLHFCGVRRNIEVKEVKLTRKALNSNDVFILDLGRTAYQWNGKTCNKDERIKAAAFLQQLENERHGKTQTFTLDENSIGSEHKFYQSLPDVPYAKKSSEVKSDVRSGKKAMFRLSDESGKLQYSLVSEGNCPRSMINEDDVYIIDTGVEIFVYVGARASDAEKMNALQYAHDYLKTTQHPLIPVTACRGNMKNPQME---KVLD 367          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8IV51 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 6.939e-137
Identity = 195/360 (54.17%), Postives = 254/360 (70.56%), Query Frame = 2
Query:  218 KAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEF 1297
            KA++YDWKDSN+ L GS  DR VKK SA+ E+AW      +   L++WRIE   +VEWPK+ +G+F+ GDSYI+LN Y ++ +L YD+HFWIGK ST DEYGTAAYKTVELDTLLDD P+QHREVQ +ES + +SYFP I YL GGC SGFR V TREY PRLLH +GE+ NI++ EVS ++K+L++ DV+I D G    QW   GANK+ERFKA Q+ Q L S+RNG+L  EV++E    PNHEFY+ L+  E    D N             +SDE+G+L+F+Q+ S + ++  I E DVFIIDNG  +YVYVG++AS  ER+NAL YAHNYL++++ P AP+TVV  +   K    F
Sbjct:    1 KAKQYDWKDSNLALFGSDLDRQVKKESAEKERAWAPVLENRRPQLYVWRIEA--IVEWPKELYGKFYSGDSYIILNAYMEQDKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESRLMRSYFPEITYLAGGCPSGFRSVKTREYKPRLLHFKGERQNIVVWEVSKSRKSLDNTDVYILDLGDRAIQWNSSGANKNERFKAAQYLQGLKSERNGRLSCEVIEEDSADPNHEFYSSLTEEEADPADSNP------------LSDESGNLQFDQIQSESLDRGGITEEDVFIIDNGFEVYVYVGKEASVAERRNALSYAHNYLQSSENPFAPVTVVTPEAPSKTKAAF 346          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: vill (villin like [Source:NCBI gene;Acc:103022178])

HSP 1 Score: 212.616 bits (540), Expect = 1.729e-60
Identity = 123/313 (39.30%), Postives = 179/313 (57.19%), Query Frame = 2
Query:  347 ALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKL---------SNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQA 1246
             L IW I   K+V  P+Q FG FFEGD YI+L     + + + DIH+WIG  S+QDE G AA    +LD  L   P+QHR+VQ YES  F+ YF   IIY KGG  SGF+HV +  YN  RLLHV+G+K N+  +EV  + K+ NS DVF+ D G  I QW G  +N+ ER K    AQ + + +R G+ +I V++  +   + E    +         S  + + DD   +   +H  KL+++SD +G L  ++VAS    +  +H  D +I D G + + V+ G+KA+  ER+ AL  A  ++KA +YP +
Sbjct:   17 GLQIWTINNLKMVPVPEQAFGSFFEGDCYIILYGSNDDTQSM-DIHYWIGNGSSQDEQGAAAIYVTQLDEYLGGSPVQHRDVQGYESAKFRGYFKQGIIYKKGGVASGFKHVESNVYNILRLLHVKGKK-NVTATEVEVSWKSFNSGDVFLLDMGKSIVQWNGPQSNRGERLKGCLLAQDIRDRERGGRARIGVVEGDREEASSELIKMMISVLGQRTGSLRDAVPDDTPDQFQVSH-VKLYQVSDTSGQLMVQEVASSPLTQDLLHSEDCYIADVGGLSLAVWKGKKATVEERRAALERAVGFIKAKNYPAS 326          

HSP 2 Score: 150.214 bits (378), Expect = 1.138e-38
Identity = 93/310 (30.00%), Postives = 157/310 (50.65%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNPRLLHVRGEKN-NIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE  ++ E P+  +G+F+ GD Y+VL  Y +  +  Y ++ W+G+++TQDE    AY+ V +D   +  P+Q R     E   F + F   +I  +GG  +G   V   +   RL  VRG    N   +EV +   +LNS+D+F+  +    Y W GKG + DER        ++ SD   K   +++ EGQ  P  +F+  L      + DK   + +  H  +LF  S++ G  +  +VA   F + ++ E+DV ++D    +++++G  A+  E + +   A  YLK   A   P+ P+  VK+
Sbjct:  401 IWRIENLELQEVPRGTYGQFYGGDCYLVLYTYNRANKPQYILYMWLGRHATQDEITACAYQAVNVDNRYNGAPVQVRVTMGKEPRHFLAIFKGRLIIYEGG--TGKPGVVNPDPGARLFQVRGTNEINTKATEVPARASSLNSNDIFLLKTDLVTYTWYGKGCSGDEREMG-----KVVSDVLSKQDKQIVMEGQEPP--QFWVALGGKGAYSSDKRFEREVALHSPRLFNCSNQVGQFRMTEVA--QFTQDDLDEDDVMLLDTWDELFLWIGNSANQYETQESYRCAVEYLKTHPAKRDPETPVITVKQ 699          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: vill (villin like [Source:NCBI gene;Acc:103022178])

HSP 1 Score: 212.616 bits (540), Expect = 2.553e-60
Identity = 123/313 (39.30%), Postives = 179/313 (57.19%), Query Frame = 2
Query:  347 ALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKL---------SNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYPQA 1246
             L IW I   K+V  P+Q FG FFEGD YI+L     + + + DIH+WIG  S+QDE G AA    +LD  L   P+QHR+VQ YES  F+ YF   IIY KGG  SGF+HV +  YN  RLLHV+G+K N+  +EV  + K+ NS DVF+ D G  I QW G  +N+ ER K    AQ + + +R G+ +I V++  +   + E    +         S  + + DD   +   +H  KL+++SD +G L  ++VAS    +  +H  D +I D G + + V+ G+KA+  ER+ AL  A  ++KA +YP +
Sbjct:   17 GLQIWTINNLKMVPVPEQAFGSFFEGDCYIILYGSNDDTQSM-DIHYWIGNGSSQDEQGAAAIYVTQLDEYLGGSPVQHRDVQGYESAKFRGYFKQGIIYKKGGVASGFKHVESNVYNILRLLHVKGKK-NVTATEVEVSWKSFNSGDVFLLDMGKSIVQWNGPQSNRGERLKGCLLAQDIRDRERGGRARIGVVEGDREEASSELIKMMISVLGQRTGSLRDAVPDDTPDQFQVSH-VKLYQVSDTSGQLMVQEVASSPLTQDLLHSEDCYIADVGGLSLAVWKGKKATVEERRAALERAVGFIKAKNYPAS 326          

HSP 2 Score: 150.214 bits (378), Expect = 1.218e-38
Identity = 93/310 (30.00%), Postives = 157/310 (50.65%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNPRLLHVRGEKN-NIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE  ++ E P+  +G+F+ GD Y+VL  Y +  +  Y ++ W+G+++TQDE    AY+ V +D   +  P+Q R     E   F + F   +I  +GG  +G   V   +   RL  VRG    N   +EV +   +LNS+D+F+  +    Y W GKG + DER        ++ SD   K   +++ EGQ  P  +F+  L      + DK   + +  H  +LF  S++ G  +  +VA   F + ++ E+DV ++D    +++++G  A+  E + +   A  YLK   A   P+ P+  VK+
Sbjct:  401 IWRIENLELQEVPRGTYGQFYGGDCYLVLYTYNRANKPQYILYMWLGRHATQDEITACAYQAVNVDNRYNGAPVQVRVTMGKEPRHFLAIFKGRLIIYEGG--TGKPGVVNPDPGARLFQVRGTNEINTKATEVPARASSLNSNDIFLLKTDLVTYTWYGKGCSGDEREMG-----KVVSDVLSKQDKQIVMEGQEPP--QFWVALGGKGAYSSDKRFEREVALHSPRLFNCSNQVGQFRMTEVA--QFTQDDLDEDDVMLLDTWDELFLWIGNSANQYETQESYRCAVEYLKTHPAKRDPETPVITVKQ 699          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 207.994 bits (528), Expect = 2.408e-59
Identity = 120/314 (38.22%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLN-IYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPN--HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            +  K   L +WRIEKF +V  P+  +G F+ GD+Y++LN I Q+   L YD+HFW+G + TQDE G+AA  TV++D  L  KPIQ+REVQ +ES  F  YF   + Y+KGG  SGF+HV T E    R+L V+G +  +  +EV  +  + N+ D FI D G+ IYQW G  +N+ E+ K+ Q A+ + +++R+G+ ++ V DEG            K    E   DD    +      KL+++SD +G +    VA  N F++S +   D FI+D+G    I+V+ G+ A+  ERK A+  A  ++K   YP+
Sbjct:    9 RAGKQPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKG-RRVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDEGVEREKILEVLGEKPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 128.642 bits (322), Expect = 2.169e-31
Identity = 93/312 (29.81%), Postives = 142/312 (45.51%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKS-LTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE    V       G+F+ GDSYI+L  Y+      + I+ W G  STQDE G +A    +LD  L   P+Q R VQ  E     S F   P ++Y  G    G +         RL  VR        + EV +   NLNS+D FI  + +  + W+G GA+  E+  AQ     L     G    E+ + G+   + +F+  L            K  +  H  +LF  S++TG    E+V  G   + ++  +DV I+D    ++V+VG +A + E+  A+  A  Y++   A   P+ PI  +K+
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEKQGAQGLCDIL-----GVSASEITEGGE---SDDFWAALGGKAAYRTSTRLKDKMDVHPPRLFACSNKTGRFIIEEV-PGEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQ 696          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 207.994 bits (528), Expect = 2.444e-59
Identity = 120/314 (38.22%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLN-IYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTRE-YNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPN--HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            +  K   L +WRIEKF +V  P+  +G F+ GD+Y++LN I Q+   L YD+HFW+G + TQDE G+AA  TV++D  L  KPIQ+REVQ +ES  F  YF   + Y+KGG  SGF+HV T E    R+L V+G +  +  +EV  +  + N+ D FI D G+ IYQW G  +N+ E+ K+ Q A+ + +++R+G+ ++ V DEG            K    E   DD    +      KL+++SD +G +    VA  N F++S +   D FI+D+G    I+V+ G+ A+  ERK A+  A  ++K   YP+
Sbjct:    9 RAGKQPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKG-RRVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDEGVEREKILEVLGEKPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 120.939 bits (302), Expect = 7.403e-29
Identity = 93/321 (28.97%), Postives = 142/321 (44.24%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPI---------QHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIIS-EVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHK-SLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWRIE    V       G+F+ GDSYI+L  Y+      + I+ W G  STQDE G +A    +LD  L   P+         Q R VQ  E     S F   P ++Y  G    G +         RL  VR        + EV +   NLNS+D FI  + +  + W+G GA+  E+  AQ     L     G    E+ + G+   + +F+  L            K  +  H  +LF  S++TG    E+V  G   + ++  +DV I+D    ++V+VG +A + E+  A+  A  Y++   A   P+ PI  +K+
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVAGVPITTQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEKQGAQGLCDIL-----GVSASEITEGGE---SDDFWAALGGKAAYRTSTRLKDKMDVHPPRLFACSNKTGRFIIEEV-PGEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQ 705          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: scin (scinderin [Source:NCBI gene;Acc:103042167])

HSP 1 Score: 199.904 bits (507), Expect = 2.364e-56
Identity = 110/312 (35.26%), Postives = 182/312 (58.33%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYNP-RLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTA-----HEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNG--QVIYVYVGEKASDNERKNALIYAHNYLKATDYP 1240
            K T L IWRIE  ++   P+   G F+ GD+Y++L   +++    YD+HFW+GK  TQDE   AA  TV++D  L  KP+Q+RE+Q  ES  F SYF   I Y  GG  SGF+HV T + +  RL H++G +  +  ++V     + N+ D FI D G+ IYQW G   N+ ER KA Q A  + +++RNG+ ++ ++++G   P  +  + L +   + D+ ++  + A        KL+ +SD +G ++   V+  N F+++++  ++ FI+D+G  ++IYV+ G  A+ NERK A+  A  +++   YP
Sbjct:   13 KRTGLQIWRIENMELAPVPESLHGNFYVGDAYLILRTVKQKDVSFYDLHFWLGKECTQDESTAAAIFTVQMDDYLGGKPVQYRELQGCESTAFTSYFKGGITYKTGGVSSGFQHVVTNDLSAQRLFHIKG-RRTVRATQVPLDWNSFNTGDCFIVDLGAIIYQWCGSKCNRFERLKATQVANSIRDNERNGRAQVVIVEDGH-EPG-QLTSVLGDKPTLPDEDDNDDIAADMSNRRMAKLYMVSDASGKMQVSLVSEENPFSQTHLLSDECFILDHGKSKMIYVWKGRNANPNERKEAMKTAEGFIQQMGYP 321          

HSP 2 Score: 114.775 bits (286), Expect = 7.285e-27
Identity = 93/318 (29.25%), Postives = 154/318 (48.43%), Query Frame = 2
Query:  356 IWRIEKF-----KVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNII-ISEVSSTKKNLNSDDVFIFDSGSC-IYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLT-AHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQ---APITVVKK 1267
            IWR+E       K+   PK  +G+F+ GD YI+L  Y++ +     I+ W G  ST DE   +A+ TVELD  L    +Q R  Q  E     S F   P ++Y  G    G +         RL  VR     I  ISEV +   +LNS+D ++        Y W+GKGA+++E    +  ++ L      + K++ + EGQ  P  +F+  L         +  +S T  H  +LF  S++TG    E+V  G FN+ ++ E+DV ++D    ++V++G+ A++ E+  ++  A  Y+      +    P+ +VK+
Sbjct:  398 IWRVETCNKGESKIPVDPKT-YGQFYGGDCYIILYTYKRGQ----IIYTWQGSCSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPAHLLSLFKAKPLVVYKNGTSREGGQ---APAAPTRLFQVRRNLGTITRISEVDAVASSLNSNDAYLLKVPEGEGYMWVGKGASEEEEHGVKYMSELL------QCKMKRITEGQ-EPG-DFWKALGGKTEYQTSERLESKTITHAPRLFGCSNKTGRFIIEEVP-GEFNQDDLAEDDVMLLDVWDQVFVWIGKDANEVEKMESVKSAKMYIDTDPSGRDKGTPMVIVKQ 698          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 200.29 bits (508), Expect = 1.196e-56
Identity = 115/318 (36.16%), Postives = 180/318 (56.60%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLD--EGQMSPN---------HEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYP 1240
            K+  L IWR+EK ++   P++ +G FFEGD YI+L+  +        YD+H+W+G+ S+QDE   AA  T +LD  L   P+QHRE Q +ES++F+ YF   ++Y KGG  SGF H  T  YN  RLLH++G K  +  +EV+ +  + +  DVF+ D G  I QW G  +N+ E+ K  Q A  + + +R G+ +I V++  +   SP           E +  LS   P  D+    S  A+  KL+ +S++ G+L  E+VA+    +  ++ +D +I+D G + IYV+ G  +S  ER+ A+  A  Y+KA  YP
Sbjct:   10 KSAGLHIWRVEKMELAAVPQKAYGSFFEGDCYIILSAKKAGSSPTPTYDVHYWVGQESSQDEQAAAAMYTTQLDDALGGFPVQHREYQGHESEVFRGYFKSGVVYKKGGVASGFHHTETNSYNVQRLLHIKGRK-AVTATEVNLSWDSFSRGDVFLLDLGKVIIQWNGPDSNRVEKIKGMQLASDIRDRERGGRAQIGVVEGNDEDSSPELMAVLTAALGERHGDLSPGSP--DEPTDHSRKAN-VKLYHVSEKGGNLMVEEVATRPLTQDLLNHDDCYILDQGGIKIYVWKGRGSSKEERQAAMKRALGYIKAKGYP 323          

HSP 2 Score: 149.828 bits (377), Expect = 3.388e-39
Identity = 102/317 (32.18%), Postives = 165/317 (52.05%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN--IIY---LKGGC-ESGFRHV-NTREYNPRLLHVRG-EKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAH-EKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK----ATDYPQAPITVVKK 1267
            ++RIE  ++    K+  G+F+ GD Y+VL  Y    +L Y ++ W G+++TQDE   +AY+ V LD     +P+Q R V   E   F + F    IIY    +GG   +G   +        RL  VRG ++ N    EV +    LNS+DVF+ ++    + W GKG + DER  A+  A  L   R  K   + + EGQ  P  EF+  L    P A +K  +   A  + +LF  S +TG     +++  +F++ ++ E+DV ++D    ++++VG+ ASD E+K ++  A +YL+    A D P  PI +VK+
Sbjct:  400 MFRIEDLELKPVEKRLHGQFYGGDCYLVLYTYTSNNKLAYLLYMWQGRHATQDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHFLAIFHGKLIIYEMVAQGGTSRAGGNDIGGAAPPTTRLFQVRGTDEFNTKAVEVPARASALNSNDVFVLNAEVACFLWCGKGCSGDEREMARSLADGLT--RRDK---QTVLEGQEPP--EFWAALGGKAPYASEKRMQVEEAEVQPRLFECSTQTGRFVVTEIS--DFSQDDLDEDDVMLLDTWDQVFLWVGQGASDAEKKESMTTAADYLRTHPGARD-PDTPIIIVKQ 706          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 170.244 bits (430), Expect = 3.492e-50
Identity = 87/207 (42.03%), Postives = 131/207 (63.29%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVL-NIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPN 946
            +   L +WR+EK  +V  PK+ +G F+ GD+Y++L ++  +   + YD+HFW+G   +QDE G AA  TV++D  L  +P+QHREVQ +ES  F  YF N I Y  GG  SGFRHV     +  RLLHV+G +  +  +EV  +  + N  D FI D G+ IYQW G  +N+ ER KA Q A+ + +++R+G+ +++VL+EG M P+
Sbjct:   12 RQPGLQVWRVEKLDLVAVPKELYGSFYTGDAYVLLFSVRNRAGNMQYDLHFWLGNECSQDESGAAAIFTVQMDDHLGGQPVQHREVQGFESTAFSGYFKNGIKYKPGGVASGFRHVVPNLVDVKRLLHVKGRR-TVRATEVPLSWASFNQGDCFIVDLGANIYQWCGSKSNRFERLKATQVAKGIRDNERSGRARVDVLEEG-MQPD 216          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 6.708e-11
Identity = 41/127 (32.28%), Postives = 63/127 (49.61%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEK-ELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGGCESGFRHVNTREYNPRLLHVRGEKN 730
            +W IE F      +   G+F++ D YIVL  +  E   + ++I++WIG  +T D+   AA   V L   L  +    RE  D ES+ F + F  +I Y++GG  SGF  V    +  RL    G ++
Sbjct:  502 VWHIENFVPQLTEEYYHGKFYDADCYIVLRTFIDENGAIAWEIYYWIGAKATLDKKACAAIHAVNLRNFLGAEGRSQREEMDDESEEFLAVFDGSISYIEGGTSSGFFTVEENAHIIRLYRCHGTQS 628          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003626.1 (pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 gene:ENSPMAG00000003299.1 transcript:ENSPMAT00000003626.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.056e-7
Identity = 58/231 (25.11%), Postives = 95/231 (41.13%), Query Frame = 2
Query:  623 YFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLK---IEVLDEG-QMSPN--HEFYNKLS------NNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSN-IHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHN-YLKATDYPQAPITVVKKDI 1273
            Y P ++     CE G RHV TR   PR +                   +LNS D F+  +    Y WIG+ AN  E+ KA   A  + + R+   +   I +++EG   S N    F++ L          P  +D+ +++        FR+  E   L  +    G   +   ++  DV + D G  +YV+ G++ +  +RK A   A   ++   DY    I  +  DI
Sbjct:  262 YKPVMLLQVKACE-GRRHVQTRLVEPRAI-------------------SLNSGDCFLLLTHQHCYLWIGEFANVIEKAKASDLATYIQTKRDLGCRASSITIIEEGINCSSNRARSFWDLLGGRVSYKGTGPPEEDELYENDVVATNCAFRLQGE--RLVPDDECWGKVPRCTMLNPCDVVVFDFGSEVYVWHGKEVTLAQRKVAFQLAKQLWVGPYDYNTCRINPLGSDI 470          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO49235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV0])

HSP 1 Score: 338.961 bits (868), Expect = 1.211e-113
Identity = 177/371 (47.71%), Postives = 244/371 (65.77%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQK--EKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEK-NNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHK--SLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            ++K ++ +WKD+N+ L GS  +++VK+ +A TE AW  A T     L IWRIEKFKV  W ++ +G F++GDSYI+LN Y++  E EL YD+HFWIGK STQDEYGTAAYKTVELD  L+DKPIQHREVQ +ES +FKSYF ++  LKGG +SGFRHV  +EY PRLL VRG   +N ++ EV   + +L S+DVFI D G  +Y W+G   +KDE+F+  Q   ++ S+RNGK K EV DE  M P+ +FY  L N     +D +       + E +L+RISD +G ++  Q+  G  ++ +  E DVF+ D G+ ++VY G KAS +ER+ AL   HN+L  TD+P A I+ V     G+   EF + L
Sbjct:    4 LRKQKQPEWKDTNLALFGSDIEKNVKREAAATEIAWKNAGT--REGLQIWRIEKFKVKVWSREDYGSFYDGDSYIILNTYKESGEDELKYDVHFWIGKDSTQDEYGTAAYKTVELDIHLNDKPIQHREVQGFESKLFKSYFKSLTILKGGVDSGFRHVKPQEYKPRLLRVRGTTVSNCVVEEVLLARSSLCSEDVFILDKGLNLYLWVGVKCDKDEKFRGMQEILKIKSERNGKPKSEVNDESSMKPDDDFYKLLPNVSKDCEDSSFPKGDYDSFEPELYRISDASGKIQKTQIKKGRISRKDFDEQDVFLFDTGRHLFVYTGNKASIDERRLALQIGHNHLMRTDHPFAAISTV---YHGREPGEFLEAL 369          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO40348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K4])

HSP 1 Score: 338.576 bits (867), Expect = 1.408e-113
Identity = 171/364 (46.98%), Postives = 236/364 (64.84%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDE-------------GQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASG-NFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVV 1261
            ++K ++YDWKDSN+ L GS  +++VKK SA TE AW  A   +   + IWRI KFKV +WP++ +G F+ GDSYI+L   ++ +EL++D+HFWIGK ST DEYGTAAYKTVELDT LDDKP+QHREV+ +ESD+FKSYF  +  L GG ESGF+HV  +EY PRL  VRG K N+ ++ +   K NL +DD FI D G  ++QW G  ANK+E++KA +  +   S R GK +  VLD+             G +      + K + +EP             EK LF +SD TG L+  ++A G    +S + E+DV+I D+G+  YVYVG+ AS +ER+NA+ YAHNYL  T++P  P+TV+
Sbjct:    4 LRKQKEYDWKDSNLALFGSDTEKNVKKESAQTETAWIGAG--EKPGMKIWRIVKFKVTKWPEENYGSFYNGDSYIILRTKKENEELVHDVHFWIGKKSTADEYGTAAYKTVELDTFLDDKPVQHREVEGHESDLFKSYFSEMTLLDGGAESGFKHVGPKEYTPRLFLVRGNKKNVTLTNIELVKGNLTNDDCFIIDLGLELFQWNGIDANKEEKWKAGEICRDWRSKRGGKPRHIVLDDCTVEKIEELEELEGILPDGENSFKKQAGSEP------------SEKVLFSLSDRTGQLQCNEIARGKEVKRSLLKEDDVYIFDSGRHCYVYVGKAASIDERRNAMTYAHNYLMRTEHPLLPVTVI 353          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO43190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ87])

HSP 1 Score: 319.701 bits (818), Expect = 3.566e-106
Identity = 173/379 (45.65%), Postives = 239/379 (63.06%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEK------ELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFA---QQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKL---FRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            + KA+KYDWKDSN+ L GS  +++VKK SA+ E AW  A   K   + +WRI KFKV  WPKQ +G F+ GDSYIVLN Y+K+       EL YD+HFWIG++S+QDEYGTAAYKTVELD  LDDKP++HREV+ +ES +FKSYF  +I LKGG E+GFR VN   Y PRLLH   +   I ++E S  + N+N+ DVFI D G  +YQW G   + DE+F A  F    Q+  S   G+  ++      +    EF + LS +EP+A+      L   +  +     +SD +GHL F +V+ G+   +S ++ NDVFI+D+G   YV+ G+ +S +ER+ A+ +AHNYL  +D P  PIT V   ++G   ++FNK  
Sbjct:    4 LVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAG--KEVGVQVWRIVKFKVTHWPKQDYGHFYNGDSYIVLNTYKKDPSSEACGELSYDVHFWIGRFSSQDEYGTAAYKTVELDHFLDDKPVEHREVEGHESTLFKSYFDALITLKGGAETGFRRVNPEAYKPRLLHFCKKNKKIEVTEKSLKRANMNNGDVFIVDLGLTLYQWNGSRCSPDEKFSAAHFMDIIQKEISTNKGRKSVKSGILKLLLERVEFNSTLS-SEPVAE-----CLVLCQSNIICFMVLSDASGHLVFSEVSRGSAVKRSQLNTNDVFIMDSGDHCYVWSGKGSSVDERRRAMEFAHNYLMKSDSPFLPITCV---VEGNETDDFNKAF 371          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO49234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU9])

HSP 1 Score: 315.464 bits (807), Expect = 3.036e-104
Identity = 164/357 (45.94%), Postives = 232/357 (64.99%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ--KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRG-EKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQ--MSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQV--ASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVV 1261
            ++K E+  W+D+N+ L GS  +++VK+ +A  E+AW+ A   K   L IWR+E+FKV    +  +G+F++GDSYI+LN Y+  +E E  YD+HFWIG+ STQDEYGTAAYKTVELD  L+DKP+QHREVQ +ES +F SYF ++  LKGG +SGF+HV    Y PRLL V G    ++ + EV   +K+LNSDDVFI D G  IYQW GK  +KDE+F+A Q A +L S+R G+  IEV+DEG+   +P + F   L   E   D  + + +      L R+SD +G +K  ++    G   +++  E DVF+ D G V++VY G KAS +ER+ AL    NYL  T++P A I+ +
Sbjct:    4 LRKQEQPKWQDTNLALFGSDIEKNVKREAAGQERAWSGA--GKREGLQIWRVEQFKVKSVLRDDYGKFYDGDSYIILNTYKDPEEDEFKYDVHFWIGQDSTQDEYGTAAYKTVELDIYLNDKPVQHREVQGHESKLFMSYFDSLTILKGGVKSGFKHVRPEVYQPRLLRVYGTTPKSVKVEEVPFVRKSLNSDDVFILDKGKTIYQWNGKDCDKDEKFRAAQEANRLKSERGGRPVIEVIDEGEDRSAPFYRFLPDLPCKEEKGDYDDFEPV------LLRVSDASGQMKLTEMKKGKGRITRNDFDEKDVFLFDTGNVLFVYSGNKASIDERRLALQIGTNYLNGTNHPFASISAI 352          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO43191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ88])

HSP 1 Score: 293.508 bits (750), Expect = 3.240e-96
Identity = 165/375 (44.00%), Postives = 219/375 (58.40%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKE--KELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKS------LTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            + KA+KYDWKDSN+ L GS  +++VKK SA+ E AW  A   K   + +WRI KFKV  WPK+ +G+FF GDSYIVLN Y++   + LLYD+HFWIGK+S+QDEYGTAAYKTVELD  L+D P+QHREV+ +ES +FK YF  +  +KGG +SGF+HV    Y PRL HV  E   +I+ +    + N+ + DVFI D G  IYQW               ++  LN+            E Q   N  F  KL+   P    K  K       L   E +   +SD +G L  E+V+ G+  ++S +  NDVF+ D G   YV+VG  AS +ER  A+ YAHNYL  TD+P  P+TVV    +GK   +FN   
Sbjct:    4 LVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAG--KEVGVQVWRIVKFKVEHWPKEDYGKFFNGDSYIVLNTYKEPSTENLLYDVHFWIGKFSSQDEYGTAAYKTVELDHFLNDVPVQHREVEGHESKLFKGYFSTLTIMKGGADSGFKHVLPEAYTPRLFHVFKEGKCVIVRQKQMKRTNMCNSDVFIVDLGLVIYQW---------------YSVLLNA--------VFYTENQTVEN--FNPKLAKTIPEGKPKKDKVQALLSLLIKAEMEQMEVSDASGSLNCEEVSRGSAISRSQLDSNDVFLFDTGCHCYVWVGAGASIDERGKAMTYAHNYLGQTDHPFLPVTVVA---EGKETNDFNSAF 348          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 211.46 bits (537), Expect = 3.979e-60
Identity = 124/320 (38.75%), Postives = 188/320 (58.75%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLN-IYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQ--------MSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            +  K   L +WR+EKF +V  P+  +G F+ GD+Y+VLN I Q+  +L YD+HFW+G   +QDE G+AA  TV++D  L  KPIQ+REVQ +ES  F  YF   I Y++GG  SGF+HV T E +  RLL ++G +  +  +EV+    + N DD FI D G  IYQW G  +N+ E+ KA Q A+ + +++R+G+ ++ V DEG         + P  +     S++   AD  N KS      KL+++S+ +G +    VA+ N F +S +   D FI+D G    I+V+ G+ A+ +ERK AL  A  ++K   YP+
Sbjct:  106 RAGKNPGLQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKG-RRVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEGMEREQMLKVLGPKPDLPAGASDDIH-ADVSNRKS-----AKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 117.087 bits (292), Expect = 1.381e-27
Identity = 88/324 (27.16%), Postives = 141/324 (43.52%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQH------------REVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRG-EKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHK-SLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWR+E           +G+F+ GDSYI+L  Y+      + I+ W G  S+QDE G  A    +LD  L   P+Q             R +Q  E     S F   P ++Y  G    G +         RL  VR     +    E+ +   NLNS+D F+  + +    W+G GA++ E+  AQQ    L       +    L EG      +F+  L            K  + AH  +LF  S++TG+   E+V  G   + ++  +DV I+D    ++V++G +A + E+  A+  A  Y++   A   P+ PI  +K+
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQFSQVVGAPITTQVRVIQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSAPAET---RLFQVRSNSTGHTRAVELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDILG------VSASELSEG--GETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEV-PGELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQ 805          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 211.46 bits (537), Expect = 3.986e-60
Identity = 124/320 (38.75%), Postives = 188/320 (58.75%), Query Frame = 2
Query:  329 KTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLN-IYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQ--------MSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGN-FNKSNIHENDVFIIDNGQ--VIYVYVGEKASDNERKNALIYAHNYLKATDYPQ 1243
            +  K   L +WR+EKF +V  P+  +G F+ GD+Y+VLN I Q+  +L YD+HFW+G   +QDE G+AA  TV++D  L  KPIQ+REVQ +ES  F  YF   I Y++GG  SGF+HV T E +  RLL ++G +  +  +EV+    + N DD FI D G  IYQW G  +N+ E+ KA Q A+ + +++R+G+ ++ V DEG         + P  +     S++   AD  N KS      KL+++S+ +G +    VA+ N F +S +   D FI+D G    I+V+ G+ A+ +ERK AL  A  ++K   YP+
Sbjct:  106 RAGKNPGLQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKG-RRVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEGMEREQMLKVLGPKPDLPAGASDDIH-ADVSNRKS-----AKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 125.561 bits (314), Expect = 2.398e-30
Identity = 88/312 (28.21%), Postives = 141/312 (45.19%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF---PNIIYLKGGCESGFRHVNTREYNPRLLHVRG-EKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHK-SLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            IWR+E           +G+F+ GDSYI+L  Y+      + I+ W G  S+QDE G  A    +LD  L   P+Q R +Q  E     S F   P ++Y  G    G +         RL  VR     +    E+ +   NLNS+D F+  + +    W+G GA++ E+  AQQ    L       +    L EG      +F+  L            K  + AH  +LF  S++TG+   E+V  G   + ++  +DV I+D    ++V++G +A + E+  A+  A  Y++   A   P+ PI  +K+
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQVRVIQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSAPAET---RLFQVRSNSTGHTRAVELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDILG------VSASELSEG--GETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEV-PGELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQ 793          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: avil (advillin [Source:NCBI gene;Acc:101170835])

HSP 1 Score: 206.068 bits (523), Expect = 2.888e-58
Identity = 119/313 (38.02%), Postives = 180/313 (57.51%), Query Frame = 2
Query:  347 ALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLD---EGQMSPNHEFYN--------KLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQV-IYVYVGEKASDNERKNALIYAHNYLKATDYP 1240
             + IWR+EK ++V   ++  G F+EGD Y++L+ ++ +  L YDIH+WIG  S+QDE G AA  TV+LD  L   PIQHREVQ++ESD FK YF N IIY KGG  +G RHV T  Y+  RLLHV+G+K  +I  EV  + K+ N  DVF+ D+G  I QW G  +NK ER K    A+ + + +R G+ ++  ++   E Q     E  N        KL++  P   D+        +  L+ +SD  G +K  +VA+    +  +     +++D G   I+V+ G+KA+  ER+ A+  A +++K  +YP
Sbjct:   13 GIIIWRVEKMELVLVSEKTHGNFYEGDCYVLLSTHKVKNVLSYDIHYWIGSESSQDEQGAAAVYTVQLDEYLGSSPIQHREVQNHESDTFKGYFKNGIIYKKGGVATGMRHVETNTYDVKRLLHVKGKK-RVIAQEVELSWKSFNLGDVFLLDTGKTIIQWNGPKSNKQERHKGLLLAKDIRDRERGGRAEVRTVEGEAEKQSPQEMEIMNSFLGERTFKLTDGPP---DETFDQEQMGKLSLYCVSDADGQMKVTEVATRPLVQDLLDHESCYLLDQGGAKIFVWKGKKANKAERQAAMARALDFIKTKNYP 321          

HSP 2 Score: 152.91 bits (385), Expect = 1.262e-39
Identity = 96/312 (30.77%), Postives = 167/312 (53.53%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNPRLLHVRG-EKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQ--LNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDY---PQAPITVVKK 1267
            +WRIE  + V   +Q +G F+ GD Y++L  Y    +  Y ++ W G+++TQDE    A++ V LD   +D+P+Q R     E   F + F   ++  +GG     +  +  E   RL  V G + +N    EV +   +LNS+DVF+  S + IY W GKG++ DER  A++ +    L+S R+ +   E++ EGQ     EF+  L    P A  K   + L  ++ +LF  S++TG     +V   +FN+ +++E+DV ++D    ++++VG+ A++ ERK ++  +  YL+       P  PI ++K+
Sbjct:  398 VWRIENLEPVPVDRQWYGYFYGGDCYLILYTYLVNNKKCYLLYMWQGRHATQDELAACAFQAVALDQKYNDEPVQVRVTMGKEPRHFMALFKGKMVIFEGGTSR--KGASEPEPPVRLFQVHGSDLSNTKTFEVPALAASLNSNDVFLLRSQTQIYLWCGKGSSGDERAMAKEVSSVICLDSQRSSE---EIVAEGQEP--MEFWELLGGKAPYASSKRLQQVLLDYQPRLFECSNKTGRFIVTEVT--HFNQDDLNEDDVMLLDTWDQVFLWVGKDANEIERKESVATSQEYLRTHPGDRDPDTPIIMIKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 205.297 bits (521), Expect = 8.776e-58
Identity = 124/340 (36.47%), Postives = 187/340 (55.00%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ-KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFY-----------NKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDN-GQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            +   L IW I   K+V  P + FG FFEGD YIVLNI + K      D+H+WIG  S+QDE G AA    +LD  L   P+Q+REVQ YES  F+SYF   IIY  GG  SGF HV+T  YN  RL+HV+G+K ++   EV  +  + N+ D+F+ D+G  I QW G  +N+ E+ KA   AQ + + +R G+ +I V++      + E             NKL +  P   D+ H  +  +  +L+ + +  G+L  ++VA+    +  +  +D FI+D+ G  + V+ G++AS  ER+ A+  A  Y+KA +YP  P T V+   +G  +  F  + 
Sbjct:   15 RKAGLQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKGKK-HVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIP---DEKHDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP--PSTGVEVMSEGGESAMFKHLF 348          

HSP 2 Score: 151.754 bits (382), Expect = 4.247e-39
Identity = 98/310 (31.61%), Postives = 159/310 (51.29%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNPRLLHVRGE-KNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            +WRIE  ++VE   +  G+F+ GD Y+VL  Y +  +  Y ++ W G+++TQDE    AY+ V +D+  +  P+Q R V   E   F + F    I  +GG  +G       E + RL  VRG  + N   +EV +   +LNS+DVF+  +    Y W GKG + DER  A+       SD   +   +V+ EGQ   N  F+  L      A DK   K    H  +LF  S++TG  +  +V   +F +S++ E+DV ++D  + +++++G+ A+ +E  +A   A  YL+   A   P  PI  +K+
Sbjct:  404 VWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMAKT-----TSDVLFRQDKQVVMEGQEPAN--FWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVY--DFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISIKQ 702          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 205.297 bits (521), Expect = 1.157e-57
Identity = 124/340 (36.47%), Postives = 187/340 (55.00%), Query Frame = 2
Query:  338 KTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQ-KEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYF-PNIIYLKGGCESGFRHVNTREYN-PRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQL-NSDRNGKLKIEVLDEGQMSPNHEFY-----------NKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDN-GQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            +   L IW I   K+V  P + FG FFEGD YIVLNI + K      D+H+WIG  S+QDE G AA    +LD  L   P+Q+REVQ YES  F+SYF   IIY  GG  SGF HV+T  YN  RL+HV+G+K ++   EV  +  + N+ D+F+ D+G  I QW G  +N+ E+ KA   AQ + + +R G+ +I V++      + E             NKL +  P   D+ H  +  +  +L+ + +  G+L  ++VA+    +  +  +D FI+D+ G  + V+ G++AS  ER+ A+  A  Y+KA +YP  P T V+   +G  +  F  + 
Sbjct:   33 RKAGLQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKGKK-HVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIP---DEKHDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP--PSTGVEVMSEGGESAMFKHLF 366          

HSP 2 Score: 151.369 bits (381), Expect = 6.362e-39
Identity = 98/310 (31.61%), Postives = 159/310 (51.29%), Query Frame = 2
Query:  356 IWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN-IIYLKGGCESGFRHVNTREYNPRLLHVRGE-KNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKN-HKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLK---ATDYPQAPITVVKK 1267
            +WRIE  ++VE   +  G+F+ GD Y+VL  Y +  +  Y ++ W G+++TQDE    AY+ V +D+  +  P+Q R V   E   F + F    I  +GG  +G       E + RL  VRG  + N   +EV +   +LNS+DVF+  +    Y W GKG + DER  A+       SD   +   +V+ EGQ   N  F+  L      A DK   K    H  +LF  S++TG  +  +V   +F +S++ E+DV ++D  + +++++G+ A+ +E  +A   A  YL+   A   P  PI  +K+
Sbjct:  422 VWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMAKT-----TSDVLFRQDKQVVMEGQEPAN--FWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVY--DFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISIKQ 720          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015924.1 (SMESG000015924.1)

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 368/368 (100.00%), Postives = 368/368 (100.00%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG 1315
            MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG 368          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015928.1 (SMESG000015928.1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 268/368 (72.83%), Postives = 316/368 (85.87%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG 1315
            M+K +KYDWKDSNVELIGSSEDR+VKKSSA+ E AW  AK C  + LFIWRIEKFKVVEWP+++ GEF+EGDSYIVLNIYQ+E ELLYD+HFWIGKYSTQDEYGTAAYKTVELD LLDDKP+QHREVQ YES++FKSYF N+IYLKGGCESGFRHV T EY PRLLHVRGEK NII+SEV++TK NLNS+DVFI+D+G+ I++WIGKGANKDE+FK Q+FAQ LNSDRNGK K+EV+DE  +S NHEFY  LS+ +P  DDK    L+  +KKLFRISD +G LKFE +A G F K +I+E+D+FI+DNG  +YVY+GE AS NER+NALIYAHNYLK T+YPQ P+TV+KKD+KGKNAE FNKV+ G
Sbjct:    1 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACSHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG 368          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015927.1 (SMESG000015927.1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 273/366 (74.59%), Postives = 321/366 (87.70%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            MK++ KYDWKDSNVELIGSSEDRSVKKSSA+TEKAW AAK C   ALF+WRIEKFKVVEWPK ++GEF+EGDSYIVL I++KEK+L YD+HFWIGKYSTQDEYGTAAYKTVELDTLLDDKP+QHREVQ YES++FKSYF NI+YLKGG ESGFRHVNTREY PRLLH +G+K NIII+E+S+TKKNL SDDVFI+D+GS I+QWIGKGANKDE++KAQQFAQQLN+DRNGKL IEVLDE +   NHE +  LS+++P  +D++ K L   E +LF+ISD TG LKFE+VA+G  NKS I+E DVFI+DNGQ++YVYVGE +S NERKNALIYAHNYLK TDYPQAP+TV+ KD+KG NAE FNK++
Sbjct:    1 MKRSAKYDWKDSNVELIGSSEDRSVKKSSAETEKAWAAAKACNHAALFVWRIEKFKVVEWPKVQYGEFYEGDSYIVLKIFEKEKQLNYDVHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPVQHREVQHYESNLFKSYFQNIVYLKGGHESGFRHVNTREYIPRLLHFKGDKRNIIITEISATKKNLKSDDVFIYDTGSSIFQWIGKGANKDEKYKAQQFAQQLNADRNGKLNIEVLDEEETPSNHELFKHLSDSDPEEEDQHLKVLNLQETQLFKISDATGSLKFEKVAAGKLNKSQINEEDVFIVDNGQIVYVYVGEGSSPNERKNALIYAHNYLKETDYPQAPVTVINKDVKGANAENFNKLV 366          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015925.1 (SMESG000015925.1)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 260/370 (70.27%), Postives = 313/370 (84.59%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSN--NEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG 1315
            M K +KY WKDSNVELIG+ EDRS+KK SA+TEKAW   K+C    LFIWRIEKFKVVEWPK +FGEF+ GDSYI+LNIY +  E+LYD+HFWIGKYSTQDEYGTAAYKTVELD  LDDKP+QHREVQ YES++FKSYF  +IYL GG ESGFRHV T+EY+PRLLHVRG+K  +I+SEV++TK+NLNSDDVF++D+G+ I+QWIGKGANKDER+  Q+FAQQL+SDRNGK+KIEV+DE   S N  FYNKLS+  +E   DDK+HK L  HEK LFRISDETG LKFE++  GN +++ I+E+DVFIIDNGQ I+VY+GEK+S  ER+NALIYAHNYLK T+YPQAPI+VVKKD+KG +AE+F KV+ G
Sbjct:    1 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPKNQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHHKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFKKVIGG 370          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015922.1 (SMESG000015922.1)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 244/366 (66.67%), Postives = 297/366 (81.15%), Query Frame = 2
Query:  212 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 1309
            M+K EKY WKDSNV L GSSEDR VKKSSA+TE AW  AK C  + L IWRIEKFKV+EWP ++ G F+EGDSYI+LNI +KE  LLYD+HFWIGK+STQDEYGTA YKTVELDTLLDD+P+QHREVQ YESD+FKSYF  +IYLKGGCESGFR VN + YNPRLLHV+G K +I +SEVS+T KNLNS+DVFI D+G  I+QWIGKGANKDE+FKA+QF QQLNSDRNGK  +EV+DE +   NHEFYN LS+ +P+ D+KN  +L++ EK++FRISD TG LKFE++    F+KSN+ ENDVFIID+G  + VY+GE +S +ERK +LIYAH YLK T +PQAP+TV+ K + GKN + FN + 
Sbjct:    1 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKKAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNGKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 363          
The following BLAST results are available for this feature:
BLAST of Gelsolin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIL11.637e-6437.01villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
VIL11.012e-6037.01villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
AVIL3.988e-5536.98advillin [Source:HGNC Symbol;Acc:HGNC:14188][more]
GSN8.254e-5436.14gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
GSN1.031e-5335.91gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gsnl-11.800e-5737.19Gelsolin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
fli-11.053e-2225.56pep chromosome:WBcel235:III:8675297:8683732:-1 gen... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gel4.975e-6335.57gene:FBgn0010225 transcript:FBtr0336707[more]
Gel4.975e-6335.57gene:FBgn0010225 transcript:FBtr0078971[more]
Gel4.984e-6335.88gene:FBgn0010225 transcript:FBtr0078973[more]
Gel4.984e-6335.88gene:FBgn0010225 transcript:FBtr0309256[more]
Gel4.984e-6335.88gene:FBgn0010225 transcript:FBtr0078969[more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scin4.721e-6036.94scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
scin4.867e-6036.94scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
vill4.126e-5938.85villin-like [Source:ZFIN;Acc:ZDB-GENE-081222-1][more]
gsna4.609e-5838.22gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
gsna4.609e-5838.22gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jazf11.376e-6138.04JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf11.506e-6138.04JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf18.448e-6037.75JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
ndc801.091e-5639.55NDC80 kinetochore complex component [Source:Xenbas... [more]
ndc801.127e-5639.55NDC80 kinetochore complex component [Source:Xenbas... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vil11.925e-5836.90villin 1 [Source:MGI Symbol;Acc:MGI:98930][more]
Gsn7.715e-5636.22gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn7.930e-5536.22gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn8.713e-5536.22gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Avil2.541e-5437.42advillin [Source:MGI Symbol;Acc:MGI:1333798][more]
back to top
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MPM1|GELS2_LUMTE3.927e-11047.03Gelsolin-like protein 2 OS=Lumbricus terrestris OX... [more]
sp|Q7JQD3|GELS1_LUMTE1.137e-10546.74Gelsolin-like protein 1 OS=Lumbricus terrestris OX... [more]
sp|Q24800|SEVE_ECHGR2.518e-9543.32Severin OS=Echinococcus granulosus OX=6210 GN=AG8 ... [more]
sp|P10733|SEVE_DICDI1.397e-9043.92Severin OS=Dictyostelium discoideum OX=44689 GN=se... [more]
sp|Q07171|GELS_DROME4.996e-6235.88Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel... [more]
back to top
BLAST of Gelsolin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W6I1A36.565e-17899.59Gelsolin-like protein OS=Schmidtea mediterranea OX... [more]
A0A1I8FYV11.835e-14154.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GIF72.306e-14154.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GFK58.976e-13954.59Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IV516.939e-13754.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vill1.729e-6039.30villin like [Source:NCBI gene;Acc:103022178][more]
vill2.553e-6039.30villin like [Source:NCBI gene;Acc:103022178][more]
gsna2.408e-5938.22gelsolin-like [Source:NCBI gene;Acc:103033745][more]
gsna2.444e-5938.22gelsolin-like [Source:NCBI gene;Acc:103033745][more]
scin2.364e-5635.26scinderin [Source:NCBI gene;Acc:103042167][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
avil1.196e-5636.16advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
gsna3.492e-5042.03gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
ENSPMAT00000008894.16.708e-1132.28pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
ENSPMAT00000003626.11.056e-725.11pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 ... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492351.211e-11347.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403481.408e-11346.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431903.566e-10645.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492343.036e-10445.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431913.240e-9644.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsna3.979e-6038.75gelsolin [Source:NCBI gene;Acc:101167720][more]
gsna3.986e-6038.75gelsolin [Source:NCBI gene;Acc:101167720][more]
avil2.888e-5838.02advillin [Source:NCBI gene;Acc:101170835][more]
vill8.776e-5836.47villin like [Source:NCBI gene;Acc:101155645][more]
vill1.157e-5736.47villin like [Source:NCBI gene;Acc:101155645][more]
back to top
BLAST of Gelsolin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015924.10.000e+0100.00SMESG000015924.1[more]
SMESG000015928.10.000e+072.83SMESG000015928.1[more]
SMESG000015927.10.000e+074.59SMESG000015927.1[more]
SMESG000015925.10.000e+070.27SMESG000015925.1[more]
SMESG000015922.10.000e+066.67SMESG000015922.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014981 ID=SMED30014981|Name=Gelsolin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1397bp
CTCTTCCGATCTTATCAACTTACTCACATAGATGATAAAATGTTTGGCTG
GTTGTTTAAATATTTGAAAAAAAATTGACCAATAAGAAAAATTTCTGTGC
GCCAATTCAATCGATAATTTGCTCACTGACATTTGCATAGTTTTACAGCC
GATTTGGACAGTATAAATACGAATGTCACTTTAGATTAATTTCACTTGTC
TTTACATTATCATGAAAAAAGCAGAAAAATACGACTGGAAGGATTCGAAT
GTCGAATTAATTGGTTCATCGGAGGATCGCAGTGTTAAAAAATCATCGGC
AGACACTGAAAAAGCTTGGAATGCTGCAAAAACTTGCAAAACAACCGCTT
TGTTTATTTGGAGAATCGAGAAATTTAAGGTTGTTGAATGGCCTAAGCAG
AGATTCGGAGAATTCTTCGAAGGTGATTCCTATATTGTTCTAAATATTTA
TCAAAAAGAAAAAGAACTACTTTATGATATCCATTTTTGGATTGGAAAAT
ATTCGACTCAAGACGAGTACGGCACTGCTGCTTACAAGACTGTGGAGTTG
GATACCTTACTAGATGACAAACCCATCCAACATCGCGAGGTTCAGGATTA
TGAGTCTGACATGTTTAAAAGCTATTTTCCAAATATTATATATCTAAAAG
GAGGTTGCGAAAGTGGATTCCGACACGTCAACACAAGAGAGTACAATCCA
AGACTACTCCACGTCAGAGGCGAAAAGAATAATATAATTATATCTGAAGT
TTCGTCGACCAAGAAAAATTTAAATTCTGATGATGTATTCATTTTTGATT
CTGGAAGCTGTATATATCAATGGATCGGAAAAGGTGCTAATAAAGATGAA
AGATTCAAAGCTCAACAGTTTGCTCAGCAGTTGAACTCCGATCGAAATGG
GAAACTAAAAATCGAGGTACTTGATGAAGGACAAATGTCCCCAAATCATG
AATTCTATAATAAATTATCTAACAACGAACCAATTGCTGATGACAAAAAC
CATAAATCCTTAACAGCTCACGAAAAAAAGCTTTTTCGGATTTCCGACGA
AACTGGACATTTAAAGTTTGAACAAGTAGCAAGTGGAAATTTCAATAAAT
CTAATATTCATGAAAATGACGTCTTTATTATTGACAATGGGCAAGTTATC
TACGTTTATGTCGGAGAAAAGGCAAGTGACAATGAACGGAAAAACGCACT
TATCTATGCACATAACTATCTGAAGGCTACGGATTATCCCCAAGCTCCTA
TTACCGTTGTCAAGAAGGATATCAAAGGTAAAAATGCCGAAGAATTCAAC
AAAGTGTTAAATGGCTGACGACTCAACTTCATATAGAATTTAAATAATTT
TACTCTTACAATAATTTAATTAAAATTTAGTAATTGTTATTAATAAA
back to top

protein sequence of SMED30014981-orf-1

>SMED30014981-orf-1 ID=SMED30014981-orf-1|Name=SMED30014981-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIW
RIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQ
DEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCE
SGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSC
IYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYN
KLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIH
ENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVV
KKDIKGKNAEEFNKVLNG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0005509calcium ion binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000023embryonic pharynx
PLANA:0000029primitive ectoderm
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR030007Villin
IPR007122Villin/Gelsolin
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR007123Gelsolin-like_dom
Vocabulary: biological process
TermDefinition
GO:0045010actin nucleation
GO:0051014actin filament severing
GO:0051693actin filament capping
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007122Villin/GelsolinPRINTSPR00597GELSOLINcoord: 175..195
score: 33.33
coord: 296..318
score: 26.28
coord: 89..107
score: 34.21
coord: 64..80
score: 43.58
coord: 325..344
score: 23.64
coord: 122..142
score: 26.19
IPR007122Villin/GelsolinSMARTSM00262VILL_6coord: 45..142
e-value: 1.8E-21
score: 87.3
coord: 161..255
e-value: 2.6E-18
score: 76.8
coord: 273..357
e-value: 3.6E-8
score: 43.2
IPR007122Villin/GelsolinPANTHERPTHR11977VILLINcoord: 43..357
IPR007123Gelsolin-like domainPFAMPF00626Gelsolincoord: 57..135
e-value: 2.3E-12
score: 46.6
coord: 177..244
e-value: 9.5E-14
score: 51.1
coord: 286..349
e-value: 1.1E-8
score: 34.8
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 30..155
e-value: 1.9E-42
score: 146.0
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 156..262
e-value: 4.0E-31
score: 109.4
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 263..368
e-value: 6.5E-22
score: 79.4
IPR030007VillinPANTHERPTHR11977:SF35VILLIN-1coord: 43..357
NoneNo IPR availableCDDcd11289gelsolin_S2_likecoord: 163..252
e-value: 9.14643E-29
score: 105.397
NoneNo IPR availableCDDcd11290gelsolin_S1_likecoord: 42..148
e-value: 8.47486E-53
score: 168.556
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 262..367
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 153..256
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 44..173