Lamin

Overview
NameLamin
Smed IDSMED30014980
Length (bp)2397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lamin (SMED30014980) t-SNE clustered cells

Violin plots show distribution of expression levels for Lamin (SMED30014980) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lamin (SMED30014980) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lamin (SMED30014980) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014980

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014980SMESG000009886.1 SmedASXL_005334SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014980SMESG000009886.1 SmedASXL_005334SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30014980SMESG000009886.1 SMESG000009885.1 Contig38929uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014980SMESG000009886.1 SMESG000009885.1 Contig38929newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014980SMESG000009886.1 dd_Smed_v6_850_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30014980SMESG000009886.1 dd_Smed_v6_850_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30014980SMESG000009886.1 dd_Smed_v6_850_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30014980SMESG000009886.1 dd_Smed_v6_850_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30014980SMESG000009886.1 dd_Smed_v6_850_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014980SMESG000009886.1 dd_Smed_v4_850_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 224.557 bits (571), Expect = 1.813e-63
Identity = 167/542 (30.81%), Postives = 283/542 (52.21%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAAS----PLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLER-----------DLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEA 1873
            TPS + +     +A+S    P  I+R +EK++L  LNDR A YID VRSLE     L  +I    +  + E+  IK  YE EL   RK +D +AKERA +++EL   +E+    + +  K++ DL   Q +L++LE             LS++R        L  Q   LE    +  K+L  E+L R D EN+  T+KE+L+F + +Y+EE  + ++ H     +I++ KQ E+ES+LAD L+ +R +  ++ E YK E E++++ +L + ++  ++ +  V    +E+   R + +    +L+    +  A + +++DLE  L  ER+     L +   E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +     S    ++ S + +    G   +   R    +  R S+     + G V    + D  GKFV+L N +++D  +G W +K    D+   +Y+F     +KA    T+W++ A  TH+PP+DLV K Q  +  G++++  L N+  +E A
Sbjct:    3 TPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQ----GGGSVTKKRKLESTESRSSFSQHARTSGRVAV-EEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 224.942 bits (572), Expect = 3.362e-63
Identity = 169/542 (31.18%), Postives = 284/542 (52.40%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAAS----PLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLER-----------DLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEA 1873
            TPS + +     +A+S    P  I+R +EK++L  LNDR A YID VRSLE     L  +I    +  + E+  IK  YE EL   RK +D +AKERA +++EL   +E+    + +  K++ DL   Q +L++LE             LS++R        L  Q   LE    +  K+L  E+L R D EN+  T+KE+L+F + +Y+EE  + ++ H     +I++ KQ E+ES+LAD L+ +R +  ++ E YK E E++++ +L + ++  ++ +  V    +E+   R + +    +L+    +  A + +++DLE  L  ER+     L +   E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +     S    ++ S + + G  G         +T S  R S+     + G V    + D  GKFV+L N +++D  +G W +K    D+   +Y+F     +KA    T+W++ A  TH+PP+DLV K Q  +  G++++  L N+  +E A
Sbjct:    3 TPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGG--GSVTKKRKLESTES--RSSFSQHARTSGRVAV-EEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 225.328 bits (573), Expect = 5.819e-63
Identity = 169/542 (31.18%), Postives = 284/542 (52.40%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAAS----PLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLER-----------DLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEA 1873
            TPS + +     +A+S    P  I+R +EK++L  LNDR A YID VRSLE     L  +I    +  + E+  IK  YE EL   RK +D +AKERA +++EL   +E+    + +  K++ DL   Q +L++LE             LS++R        L  Q   LE    +  K+L  E+L R D EN+  T+KE+L+F + +Y+EE  + ++ H     +I++ KQ E+ES+LAD L+ +R +  ++ E YK E E++++ +L + ++  ++ +  V    +E+   R + +    +L+    +  A + +++DLE  L  ER+     L +   E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +     S    ++ S + + G  G         +T S  R S+     + G V    + D  GKFV+L N +++D  +G W +K    D+   +Y+F     +KA    T+W++ A  TH+PP+DLV K Q  +  G++++  L N+  +E A
Sbjct:    3 TPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGG--GSVTKKRKLESTES--RSSFSQHARTSGRVAV-EEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Lamin vs. Ensembl Human
Match: LMNB2 (lamin B2 [Source:HGNC Symbol;Acc:HGNC:6638])

HSP 1 Score: 223.787 bits (569), Expect = 9.463e-63
Identity = 174/559 (31.13%), Postives = 283/559 (50.63%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLER-----------DLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALN-------------ASSKRRKVGERGEYVLPDNRGNTV--SCGRESYKVDLVSRGNVEFS---SKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEA 1873
            AT  P      +      SP  +SR +EK+EL  LNDR A YID VR+LE+  ++L  KI    +  T E+  IK LYE EL   R+++D+ A+ERA ++IE+   + +     K  +KR+ +L   Q ++++LE             LS +R      + L  Q    E   A   K+L+ E L+R D+EN+  +L+E+L+F + ++ EE  + R+ H     +++  +Q EY+ K+A  L  +R +  E+   YKLE EQ++  +L   K  + Q ++  +  R+E+   R + E    +L+    +  A + RI++LE  +  ER++F   L     E   +R+ ++++L E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S                  SKR+++    E   P   G +V  +    S    L  + +   S    + D  GKFV+L N +DKD  +G W +K  + + +E +YKF     ++A    TVW++ A   H+PPS LV KGQ  + +G + +  L NAD +E A
Sbjct:   22 ATPLPGRAGGPATPL---SPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRL----EVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVA 573          
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 224.172 bits (570), Expect = 9.508e-63
Identity = 169/544 (31.07%), Postives = 285/544 (52.39%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAAS----PLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLER-----------DLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEANC 1879
            TPS + +     +A+S    P  I+R +EK++L  LNDR A YID VRSLE     L  +I    +  + E+  IK  YE EL   RK +D +AKERA +++EL   +E+    + +  K++ DL   Q +L++LE             LS++R        L  Q   LE    +  K+L  E+L R D EN+  T+KE+L+F + +Y+EE  + ++ H     +I++ KQ E+ES+LAD L+ +R +  ++ E YK E E++++ +L + ++  ++ +  V    +E+   R + +    +L+    +  A + +++DLE  L  ER+     L +   E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +     S    ++ S + + G  G         +T S  R S+     + G V    + D  GKFV+L N +++D  +G W +K    D+   +Y+F     +KA    T+W++ A  TH+PP+DLV K Q  +  G++++  L N+   E ++C
Sbjct:    3 TPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGG--GSVTKKRKLESTES--RSSFSQHARTSGRVAV-EEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTG-EGSHC 540          
BLAST of Lamin vs. Ensembl Celegans
Match: lmn-1 (Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443])

HSP 1 Score: 159.844 bits (403), Expect = 2.978e-41
Identity = 159/555 (28.65%), Postives = 259/555 (46.67%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE----RDLSKQRMDSERYSTLLVQHDTLEKK-------CAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIV----IEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTR-DEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTS-----FSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSR---------GNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADN 1861
            +A S+ S+      SF  ++ L  SR +EKD L  LN R A+YID VR LE    +L  +I+ I   E  E   +   +E E   LR+ +D    E A   IE   AK +    + ++EK + +L   + +  + +    +  +KQ+    R   L+V++D L+K+          L K ++ E LLRT   NK   L+E L F  + +  E  ++R    V      +QI D    EY+SKL D++  +R +        K  FE ++  +L            N  + R +E ++       R ++L   +S N +L   I+ L S L+T +  F+ +L         L  ++E+ + EF  L+  KI LD E+  Y+ LLE EE R N++  A  +TS     FS+  AS++R   G +        R   V    E   +D ++R         G V    + D  GK+V++ N ++++  IGG+ L   A N+E S++F   + +   +  TVWS+DA   H+PP   VMK Q++  G N    L +++ 
Sbjct:   18 SANSSLSNNGGGDDSF-GSTLLETSRLQEKDHLTSLNSRLATYIDKVRQLEQENNRLQVQIRDIEVVEKKEKSNLADRFEAEKARLRRALDSAQDELAKYRIEYDAAKVEVKKLKPQVEKLERELAGAEEQALHAQSIADQSQAKQKTLQARNDKLVVENDDLKKQNITLRDTVEGLKKAVEDETLLRTAANNKIKALEEDLAFALQQHKGELEEVRHKRQVDMTTYAKQIND----EYQSKLQDQIEEMRAQFKNNLHQNKTAFEDAYKNKL------------NAARERQEEAVSEAIHLRARVRDLETSSSGNASL---IERLRSELDTLKRSFQEKLDDKDARIAELNQEIERMMSEFHDLLDVKIQLDAELKTYQALLEGEEERLNLTQEAPQNTSVHHVSFSSGGASAQR---GVK--------RRRVVDVNGEDQDIDYLNRRSKLNKETVGPVGID-EVDEEGKWVRVANNSEEEQSIGGYKLVVKAGNKEASFQFSSRMKLAPHASATVWSADAGAVHHPPEVYVMKKQQWPIGDNPSARLEDSEG 540          
BLAST of Lamin vs. Ensembl Celegans
Match: lmn-1 (Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443])

HSP 1 Score: 159.844 bits (403), Expect = 2.978e-41
Identity = 159/555 (28.65%), Postives = 259/555 (46.67%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE----RDLSKQRMDSERYSTLLVQHDTLEKK-------CAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIV----IEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTR-DEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTS-----FSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSR---------GNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADN 1861
            +A S+ S+      SF  ++ L  SR +EKD L  LN R A+YID VR LE    +L  +I+ I   E  E   +   +E E   LR+ +D    E A   IE   AK +    + ++EK + +L   + +  + +    +  +KQ+    R   L+V++D L+K+          L K ++ E LLRT   NK   L+E L F  + +  E  ++R    V      +QI D    EY+SKL D++  +R +        K  FE ++  +L            N  + R +E ++       R ++L   +S N +L   I+ L S L+T +  F+ +L         L  ++E+ + EF  L+  KI LD E+  Y+ LLE EE R N++  A  +TS     FS+  AS++R   G +        R   V    E   +D ++R         G V    + D  GK+V++ N ++++  IGG+ L   A N+E S++F   + +   +  TVWS+DA   H+PP   VMK Q++  G N    L +++ 
Sbjct:   18 SANSSLSNNGGGDDSF-GSTLLETSRLQEKDHLTSLNSRLATYIDKVRQLEQENNRLQVQIRDIEVVEKKEKSNLADRFEAEKARLRRALDSAQDELAKYRIEYDAAKVEVKKLKPQVEKLERELAGAEEQALHAQSIADQSQAKQKTLQARNDKLVVENDDLKKQNITLRDTVEGLKKAVEDETLLRTAANNKIKALEEDLAFALQQHKGELEEVRHKRQVDMTTYAKQIND----EYQSKLQDQIEEMRAQFKNNLHQNKTAFEDAYKNKL------------NAARERQEEAVSEAIHLRARVRDLETSSSGNASL---IERLRSELDTLKRSFQEKLDDKDARIAELNQEIERMMSEFHDLLDVKIQLDAELKTYQALLEGEEERLNLTQEAPQNTSVHHVSFSSGGASAQR---GVK--------RRRVVDVNGEDQDIDYLNRRSKLNKETVGPVGID-EVDEEGKWVRVANNSEEEQSIGGYKLVVKAGNKEASFQFSSRMKLAPHASATVWSADAGAVHHPPEVYVMKKQQWPIGDNPSARLEDSEG 540          
BLAST of Lamin vs. Ensembl Celegans
Match: ifb-1 (Intermediate filament protein ifb-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19289])

HSP 1 Score: 142.124 bits (357), Expect = 2.601e-35
Identity = 146/559 (26.12%), Postives = 268/559 (47.94%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLE----KRDLD----------LQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSAL----NASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINP-TDKDICIGGWMLKYIADN-QETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEANCVLAKEHTRSSV 1912
            +P+   + ++SF  A+      ++EK  L  LNDR  +YID V+ LE    KL   +  +      +  +IK  Y + L + RK +DD A+ +A +++++   ++D   YR + E    +R+ D          + + Q ++E L R   KQ  D E+  T    +  + ++  K   +LD E + R D +N+  TL E+LEF  R++ +E   +++   ++ +   D ++  ++++LA  +R I++E     +  K + E  + L++++++    + N   T  RDE+   R        +L    ++N  L++ +++L   L  ++ ++E  L         +R + +  + E  +L+ TK  LD EI +YRK+LE EETR  ++   +      +L    N  S R     RGE        +T +  + S K      GNV   S+ D +GKF+KL N   +KD  +G   ++   D  +E  Y    N+ IK   + T+++ D    +NPP  LV  G+  +  G+N+  +L N D +E A       HT+ ++
Sbjct:   32 SPALSANAAKSFLEAT------DKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEML-RARFKQLTDEEKRVT--ADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQE---VKELQALLAQAPADTREF-FKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRVGLTQMVEQAVKTHSLQQQENTDSTR---SVRGEV-------STKTTFQRSAK------GNVTI-SECDPNGKFIKLENSHRNKDENVGEHKIRRKLDGRREIVYSIPANVVIKPGKNLTIYARDQGGINNPPESLVFDGENTWGIGANVVTSLVNKDGEERAT------HTQKTI 554          
BLAST of Lamin vs. Ensembl Celegans
Match: ifb-1 (Intermediate filament protein ifb-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19289])

HSP 1 Score: 142.124 bits (357), Expect = 2.601e-35
Identity = 146/559 (26.12%), Postives = 268/559 (47.94%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLE----KRDLD----------LQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSAL----NASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINP-TDKDICIGGWMLKYIADN-QETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEANCVLAKEHTRSSV 1912
            +P+   + ++SF  A+      ++EK  L  LNDR  +YID V+ LE    KL   +  +      +  +IK  Y + L + RK +DD A+ +A +++++   ++D   YR + E    +R+ D          + + Q ++E L R   KQ  D E+  T    +  + ++  K   +LD E + R D +N+  TL E+LEF  R++ +E   +++   ++ +   D ++  ++++LA  +R I++E     +  K + E  + L++++++    + N   T  RDE+   R        +L    ++N  L++ +++L   L  ++ ++E  L         +R + +  + E  +L+ TK  LD EI +YRK+LE EETR  ++   +      +L    N  S R     RGE        +T +  + S K      GNV   S+ D +GKF+KL N   +KD  +G   ++   D  +E  Y    N+ IK   + T+++ D    +NPP  LV  G+  +  G+N+  +L N D +E A       HT+ ++
Sbjct:   32 SPALSANAAKSFLEAT------DKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEML-RARFKQLTDEEKRVT--ADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQE---VKELQALLAQAPADTREF-FKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRVGLTQMVEQAVKTHSLQQQENTDSTR---SVRGEV-------STKTTFQRSAK------GNVTI-SECDPNGKFIKLENSHRNKDENVGEHKIRRKLDGRREIVYSIPANVVIKPGKNLTIYARDQGGINNPPESLVFDGENTWGIGANVVTSLVNKDGEERAT------HTQKTI 554          
BLAST of Lamin vs. Ensembl Celegans
Match: ifb-1 (Intermediate filament protein ifb-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19289])

HSP 1 Score: 141.739 bits (356), Expect = 4.797e-35
Identity = 146/559 (26.12%), Postives = 268/559 (47.94%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLE----KRDLD----------LQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSAL----NASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINP-TDKDICIGGWMLKYIADN-QETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEANCVLAKEHTRSSV 1912
            +P+   + ++SF  A+      ++EK  L  LNDR  +YID V+ LE    KL   +  +      +  +IK  Y + L + RK +DD A+ +A +++++   ++D   YR + E    +R+ D          + + Q ++E L R   KQ  D E+  T    +  + ++  K   +LD E + R D +N+  TL E+LEF  R++ +E   +++   ++ +   D ++  ++++LA  +R I++E     +  K + E  + L++++++    + N   T  RDE+   R        +L    ++N  L++ +++L   L  ++ ++E  L         +R + +  + E  +L+ TK  LD EI +YRK+LE EETR  ++   +      +L    N  S R     RGE        +T +  + S K      GNV   S+ D +GKF+KL N   +KD  +G   ++   D  +E  Y    N+ IK   + T+++ D    +NPP  LV  G+  +  G+N+  +L N D +E A       HT+ ++
Sbjct:   63 SPALSANAAKSFLEAT------DKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEML-RARFKQLTDEEKRVT--ADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQE---VKELQALLAQAPADTREF-FKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRVGLTQMVEQAVKTHSLQQQENTDSTR---SVRGEV-------STKTTFQRSAK------GNVTI-SECDPNGKFIKLENSHRNKDENVGEHKIRRKLDGRREIVYSIPANVVIKPGKNLTIYARDQGGINNPPESLVFDGENTWGIGANVVTSLVNKDGEERAT------HTQKTI 585          
BLAST of Lamin vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0087512)

HSP 1 Score: 225.713 bits (574), Expect = 8.711e-64
Identity = 166/566 (29.33%), Postives = 293/566 (51.77%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLT---ISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDL---QNLQRKLEN--------LERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNI----------SVAADGDTSFSALNASSKRRKVGERG-EYVLPDNRGNTVSCGRES------------YKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEAN 1876
            +TSTP    S S    A SP +    SR +EK+EL HLNDR A YID +R+LE    +LT+++     T   E   +K +YE EL + RK++D+ AKE+A +EI++K   E+    + +L+K+  +    +N  R  EN          + L+ ++   ++   L ++++ L ++   L K+L+ E L R D+EN+N +L+E+L F ++++ +E  + R    +   +I+ R   +YE+KL   L+ +R++   +    + E E  +   + +LK    +  +      +E+   R+K +    +L      N  L  RI++LE+LL+TER      +  L  E   +R+++  +L E+  LM  K++LD EI  Y KLL  EE R NI           ++++G  S    +ASS+  +V   G     P   G++    R +            Y V+  ++G++E   + D  G+F+KL N   ++I + GW L  IA ++E ++KF     +   +  T+WS DA   H+PP++LVMK +++   ++++  L NAD ++ A+
Sbjct:   16 STSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNG--SHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEI-IEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMK-KKWPVANSMRSVLANADKEDVAS 577          
BLAST of Lamin vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0333166)

HSP 1 Score: 224.557 bits (571), Expect = 3.032e-63
Identity = 165/560 (29.46%), Postives = 289/560 (51.61%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLT---ISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDL---QNLQRKLEN--------LERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNI----------SVAADGDTSFSALNASSKRRKVGERG-EYVLPDNRGNTVSCGRES------------YKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNAD 1858
            +TSTP    S S    A SP +    SR +EK+EL HLNDR A YID +R+LE    +LT+++     T   E   +K +YE EL + RK++D+ AKE+A +EI++K   E+    + +L+K+  +    +N  R  EN          + L+ ++   ++   L ++++ L ++   L K+L+ E L R D+EN+N +L+E+L F ++++ +E  + R    +   +I+ R   +YE+KL   L+ +R++   +    + E E  +   + +LK    +  +      +E+   R+K +    +L      N  L  RI++LE+LL+TER      +  L  E   +R+++  +L E+  LM  K++LD EI  Y KLL  EE R NI           ++++G  S    +ASS+  +V   G     P   G++    R +            Y V+  ++G++E   + D  G+F+KL N   ++I + GW L  IA ++E ++KF     +   +  T+WS DA   H+PP++LVMK +++   ++++  L NAD
Sbjct:   16 STSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNG--SHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEI-IEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMK-KKWPVANSMRSVLANAD 571          
BLAST of Lamin vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0346460)

HSP 1 Score: 223.787 bits (569), Expect = 3.857e-63
Identity = 173/568 (30.46%), Postives = 300/568 (52.82%), Query Frame = 2
Query:  281 KPTATSTP---------SHKESHSRSFRAASPLTISRNE---EKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKR-------DLDLQNLQRKLENLERDLSKQRMD----SERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDT--SFS-----ALNASSKRRKVG---ERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIAD--NQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANC 1879
            +P  TSTP             +HS++  A+SPL+ +R+    EK EL +LNDR A+YID VR+LE    +LT ++Q+   T T E   IK ++E EL   R+++DD A++RA  EI++K   E+    + KL+K+       + +++  + +   L    ++   D    +E  +  L + + L K+  +  K L+ E L R D+EN   +L+E+L F ++++++E  + R+       +I+ R  +EY++KL   L+ +R +  E+ +  + E +  +  ++  L++   +T+ +  K+ +E+ + R + +     +      N  L  RI+DLE  L+ +R     ++  L  E   LR ++ ++L E+  LM  K++LD EI  Y KLL  EE R NI+ A +  T  SFS     +  A+  RR      +R   V+ ++  ++V+     Y V   ++GNVE   + D  GKFV+L N   +++ IGGW L+ + +     T+YKFH ++ I+     TVWS+D   +H PPS LVMK Q++ S  N +  L N++ +  AN 
Sbjct:   14 QPGNTSTPRPPSAGPQPPPPSTHSQT--ASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVA----DYYVSASAKGNVEI-KEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVANL 574          
BLAST of Lamin vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307059)

HSP 1 Score: 223.787 bits (569), Expect = 3.857e-63
Identity = 173/568 (30.46%), Postives = 300/568 (52.82%), Query Frame = 2
Query:  281 KPTATSTP---------SHKESHSRSFRAASPLTISRNE---EKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKR-------DLDLQNLQRKLENLERDLSKQRMD----SERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDT--SFS-----ALNASSKRRKVG---ERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIAD--NQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANC 1879
            +P  TSTP             +HS++  A+SPL+ +R+    EK EL +LNDR A+YID VR+LE    +LT ++Q+   T T E   IK ++E EL   R+++DD A++RA  EI++K   E+    + KL+K+       + +++  + +   L    ++   D    +E  +  L + + L K+  +  K L+ E L R D+EN   +L+E+L F ++++++E  + R+       +I+ R  +EY++KL   L+ +R +  E+ +  + E +  +  ++  L++   +T+ +  K+ +E+ + R + +     +      N  L  RI+DLE  L+ +R     ++  L  E   LR ++ ++L E+  LM  K++LD EI  Y KLL  EE R NI+ A +  T  SFS     +  A+  RR      +R   V+ ++  ++V+     Y V   ++GNVE   + D  GKFV+L N   +++ IGGW L+ + +     T+YKFH ++ I+     TVWS+D   +H PPS LVMK Q++ S  N +  L N++ +  AN 
Sbjct:   14 QPGNTSTPRPPSAGPQPPPPSTHSQT--ASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVA----DYYVSASAKGNVEI-KEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVANL 574          
BLAST of Lamin vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307058)

HSP 1 Score: 223.787 bits (569), Expect = 3.857e-63
Identity = 173/568 (30.46%), Postives = 300/568 (52.82%), Query Frame = 2
Query:  281 KPTATSTP---------SHKESHSRSFRAASPLTISRNE---EKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKR-------DLDLQNLQRKLENLERDLSKQRMD----SERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDT--SFS-----ALNASSKRRKVG---ERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIAD--NQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANC 1879
            +P  TSTP             +HS++  A+SPL+ +R+    EK EL +LNDR A+YID VR+LE    +LT ++Q+   T T E   IK ++E EL   R+++DD A++RA  EI++K   E+    + KL+K+       + +++  + +   L    ++   D    +E  +  L + + L K+  +  K L+ E L R D+EN   +L+E+L F ++++++E  + R+       +I+ R  +EY++KL   L+ +R +  E+ +  + E +  +  ++  L++   +T+ +  K+ +E+ + R + +     +      N  L  RI+DLE  L+ +R     ++  L  E   LR ++ ++L E+  LM  K++LD EI  Y KLL  EE R NI+ A +  T  SFS     +  A+  RR      +R   V+ ++  ++V+     Y V   ++GNVE   + D  GKFV+L N   +++ IGGW L+ + +     T+YKFH ++ I+     TVWS+D   +H PPS LVMK Q++ S  N +  L N++ +  AN 
Sbjct:   14 QPGNTSTPRPPSAGPQPPPPSTHSQT--ASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVA----DYYVSASAKGNVEI-KEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGEAVANL 574          
BLAST of Lamin vs. Ensembl Zebrafish
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 232.646 bits (592), Expect = 1.850e-66
Identity = 176/560 (31.43%), Postives = 291/560 (51.96%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLS--------------KELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSF----------SALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEANCVLAK 1891
            AT+TPS   +        SP  ISR +EK+EL  LNDR A YID VR+LE+  ++L  K+    +  T E+  IK LYE EL   R+++D+ A+ERA ++IEL     +     +  +K+D DL     ++++LE   +K   +    +T L ++ +L  + A L               K+L+ E L+R D+EN+  +L E+LEF + +++EE  + R+ H     +++   Q +YE KL+  L+ +R++  E+ + YK E + +F  +L + K  +   ++ V   R+E+     + E    +L+    +  A + RI++LE LL+++R+++  QL     E   +R  ++++L+E+  L+  K+ALD EI  YRKLLE EE R  +S +     +           S+ ++ +KR++V    E       G  V   +++     VS   +      D  GK V L N +DKD  +G W LK  I D +E  YKF     +KA    TVWS+DA  +H+PPSDL+ K Q  + +G NI   L N+  ++ A   + K
Sbjct:    2 ATATPSRASAAQTPL---SPARISRLQEKEELRALNDRLAVYIDRVRALELENDRLQFKVSEKEEVTTREVSGIKSLYEAELADARRVLDETARERAKLQIELGKVNSELEEVTRNYKKKDGDLAAALVRIKDLEAQYNK---NEAALNTALSENASLSAELADLKAQLAKAEDAHGVAKKQLEVETLMRVDLENRCQSLTEELEFRKSMFDEEVRETRRRHEKRMVEVDSGMQQDYEFKLSQALQDLRKQHEEQVQIYKEELQHTFKAKLDNAKVSSDLNDKAVLTAREELQEAHVRIEGLSYQLSALQKQASAAEERIRELEGLLSSDRDKYRRQLDAKEREMAEMRECMQQQLNEYQELLDVKLALDMEINAYRKLLEGEEDRLKLSPSPSSRVTVSRTTASSTSASSRSSRAKRKRV----ELEESSTAGPKVQISQQAEASGSVSIEEI------DLEGKSVTLRNNSDKDQSLGSWRLKRQIGDGEEIVYKFSPKFVLKAGQTVTVWSADAGMSHSPPSDLLWKSQSSWGTGENILTLLVNSSGEDVAKRTVTK 545          
BLAST of Lamin vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 230.335 bits (586), Expect = 5.571e-65
Identity = 193/566 (34.10%), Postives = 291/566 (51.41%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAA-----SPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETS-EIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE-----RDLSKQRMDSERYSTLLVQHDTLEKKCAKL-------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEE--NVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVA---ADGDTSFSALNASSKRRKVGERGEYV---------LPDNR-------GNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEA 1873
            TP  K    RS R       SP  ISR +EK++L++LNDR A YID VRSLE+    L  +I   S+TE S E+  +K  YE EL   RK +D +AKERA +++EL   +ED    + +  K++ DL++   +L++LE     +D S      E+  TL V+   L+ + AKL        K+L  E+L R D EN+  TLKE+LEF + +Y+EE    K R    V+E  I+  +Q +YESKLAD L  +R +  E+   YK E E+++  +L + +   ++ +  V    +E+   R + E    +L+    +  A + +I++LE  L+ ER+    +L     E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +   A G T   +  + S  R V                L DN        G TV+  R S +     R  V+   + D  GKFV+L N +D+D  +G W +K  I       YKF    ++KA    T+W++ A  TH+PPSDLV K Q  + SG   +  L ++  +E A
Sbjct:    3 TPGQK----RSSRGGVTNVLSPTRISRLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITE-SETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEKR-TLEVEVRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRVVE--IDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEELQQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSPPPARGVTVTRSSGSGSHTRVVQSSTSRTSSGSAKKRRLNDNDSDASSVVGGTVTRTRISQQASASGRVTVD---EVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIVYKFPPKFNLKAGQTVTIWAAGAGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Lamin vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 230.335 bits (586), Expect = 5.571e-65
Identity = 193/566 (34.10%), Postives = 291/566 (51.41%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAA-----SPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETS-EIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE-----RDLSKQRMDSERYSTLLVQHDTLEKKCAKL-------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEE--NVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVA---ADGDTSFSALNASSKRRKVGERGEYV---------LPDNR-------GNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEA 1873
            TP  K    RS R       SP  ISR +EK++L++LNDR A YID VRSLE+    L  +I   S+TE S E+  +K  YE EL   RK +D +AKERA +++EL   +ED    + +  K++ DL++   +L++LE     +D S      E+  TL V+   L+ + AKL        K+L  E+L R D EN+  TLKE+LEF + +Y+EE    K R    V+E  I+  +Q +YESKLAD L  +R +  E+   YK E E+++  +L + +   ++ +  V    +E+   R + E    +L+    +  A + +I++LE  L+ ER+    +L     E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +   A G T   +  + S  R V                L DN        G TV+  R S +     R  V+   + D  GKFV+L N +D+D  +G W +K  I       YKF    ++KA    T+W++ A  TH+PPSDLV K Q  + SG   +  L ++  +E A
Sbjct:    3 TPGQK----RSSRGGVTNVLSPTRISRLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITE-SETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEKR-TLEVEVRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRVVE--IDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEELQQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSPPPARGVTVTRSSGSGSHTRVVQSSTSRTSSGSAKKRRLNDNDSDASSVVGGTVTRTRISQQASASGRVTVD---EVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIVYKFPPKFNLKAGQTVTIWAAGAGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Lamin vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 230.335 bits (586), Expect = 5.571e-65
Identity = 193/566 (34.10%), Postives = 291/566 (51.41%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAA-----SPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETS-EIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE-----RDLSKQRMDSERYSTLLVQHDTLEKKCAKL-------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEE--NVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVA---ADGDTSFSALNASSKRRKVGERGEYV---------LPDNR-------GNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEA 1873
            TP  K    RS R       SP  ISR +EK++L++LNDR A YID VRSLE+    L  +I   S+TE S E+  +K  YE EL   RK +D +AKERA +++EL   +ED    + +  K++ DL++   +L++LE     +D S      E+  TL V+   L+ + AKL        K+L  E+L R D EN+  TLKE+LEF + +Y+EE    K R    V+E  I+  +Q +YESKLAD L  +R +  E+   YK E E+++  +L + +   ++ +  V    +E+   R + E    +L+    +  A + +I++LE  L+ ER+    +L     E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +   A G T   +  + S  R V                L DN        G TV+  R S +     R  V+   + D  GKFV+L N +D+D  +G W +K  I       YKF    ++KA    T+W++ A  TH+PPSDLV K Q  + SG   +  L ++  +E A
Sbjct:    3 TPGQK----RSSRGGVTNVLSPTRISRLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITE-SETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEKR-TLEVEVRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRVVE--IDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEELQQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSPPPARGVTVTRSSGSGSHTRVVQSSTSRTSSGSAKKRRLNDNDSDASSVVGGTVTRTRISQQASASGRVTVD---EVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIVYKFPPKFNLKAGQTVTIWAAGAGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Lamin vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 229.95 bits (585), Expect = 1.098e-64
Identity = 191/562 (33.99%), Postives = 289/562 (51.42%), Query Frame = 2
Query:  299 TPSHKESHSRSF-RAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETS-EIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE-----RDLSKQRMDSERYSTLLVQHDTLEKKCAKL-------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEE--NVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVA---ADGDTSFSALNASSKRRKVGERGEYV---------LPDN-------RGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEA 1873
            TP  K S         SP  ISR +EK++L++LNDR A YID VRSLE+    L  +I   S+TE S E+  +K  YE EL   RK +D +AKERA +++EL   +ED    + +  K++ DL++   +L++LE     +D S      E+  TL V+   L+ + AKL        K+L  E+L R D EN+  TLKE+LEF + +Y+EE    K R    V+E  I+  +Q +YESKLAD L  +R +  E+   YK E E+++  +L + +   ++ +  V    +E+   R + E    +L+    +  A + +I++LE  L+ ER+    +L     E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +   A G T   +  + S  R V                L DN        G TV+  R S +     R  V+   + D  GKFV+L N +D+D  +G W +K  I       YKF    ++KA    T+W++ A  TH+PPSDLV K Q  + SG   +  L ++  +E A
Sbjct:    3 TPGQKRSSRGGVTNVLSPTRISRLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITE-SETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLSTALGEK-RTLEVEVRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRESKRRYESRVVE--IDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTYNSKLENARSSAERNSHLVGAAHEELQQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSPPPARGVTVTRSSGSGSHTRVVQSSTSRTSSGSAKKRRLNDNDSDASSVVGGTVTRTRISQQASASGRVTVD---EVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIVYKFPPKFNLKAGQTVTIWAAGAGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Lamin vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 245.743 bits (626), Expect = 3.575e-71
Identity = 181/545 (33.21%), Postives = 288/545 (52.84%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRA------ASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKL--------------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKY-IADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFF-SGSNIKINLTNAD 1858
            AT+TPS   + S    A       SP  ISR +EK+EL HLNDR A YID VRSLE+  ++L  KI    +  T E+  IK LYE EL   RK++D+ A+ERA ++IEL   + D     K  +K+D DL   Q ++ +LE      R ++E   T L +  +LE + A L               K+L+ E L+R D EN+  +L+E+++F + +Y EE+ + R+ H     +++   Q +Y+SKLA  L  +R++  E+ + YK E EQ++  +L ++K+ +   ++     R+E+   R + E    +L+    + +A + RI++LE LL+++R+++   L     E   +R+ ++++L E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S   +SS       R +      R  TV+    S  ++ +           D  GK+V L N +DKD  +G W LK  I + +E  YKF     +KA     ++S+DA   H+PPS LV K Q  + +GSNI+  L N +
Sbjct:    2 ATATPSRSGTSSMQSPARGTSTPLSPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADLSTAQGRIRDLEALF--HRSEAE-LGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVTVSRATSSSSSATRTSRSK------RNRTVTSATGSISIEEI-----------DLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTE 526          
BLAST of Lamin vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 246.128 bits (627), Expect = 4.040e-71
Identity = 186/563 (33.04%), Postives = 298/563 (52.93%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKL--------------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSF---------SALNASSKRRKVGERGEYVLPDNRGNTVSCGR-ESYKVDLVSRGNVEFS---SKPDCSGKFVKLINPTDKDICIGGWMLKY-IADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFF-SGSNIKINLTNADNQEEANCVLAK 1891
             TSTP             SP  ISR +EK+EL HLNDR A YID VRSLE+  ++L  KI    +  T E+  IK LYE EL   RK++D+ A+ERA ++IEL   + D     K  +K+D DL   Q ++ +LE      R ++E   T L +  +LE + A L               K+L+ E L+R D EN+  +L+E+++F + +Y EE+ + R+ H     +++   Q +Y+SKLA  L  +R++  E+ + YK E EQ++  +L ++K+ +   ++     R+E+   R + E    +L+    + +A + RI++LE LL+++R+++   L     E   +R+ ++++L E+  L+  K+ALD EI  YRKLLE EE R  +S +     +          +   + SKR++V E  E     +R  TV+ G+  S +  L  + +   S    + D  GK+V L N +DKD  +G W LK  I + +E  YKF     +KA     ++S+DA   H+PPS LV K Q  + +GSNI+  L N + +E A   + K
Sbjct:   18 GTSTP------------LSPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADLSTAQGRIRDLEALF--HRSEAE-LGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVTVSRATSSSSSATRTSRSKRKRVEEEYEEGGGSSR--TVTSGQGSSTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAVRTVTK 563          
BLAST of Lamin vs. Ensembl Xenopus
Match: lmx1a (LIM homeobox transcription factor 1 alpha [Source:Xenbase;Acc:XB-GENE-481569])

HSP 1 Score: 245.358 bits (625), Expect = 5.481e-71
Identity = 172/550 (31.27%), Postives = 295/550 (53.64%), Query Frame = 2
Query:  290 ATSTPSHKESH-SRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDL---QNLQRKLE--------NLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNI-------SVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKV--DLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADN-QETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEA 1873
            ATSTPS    H S +    SP  ISR +EK++L HLNDR A+YI+ VRSLE  K  L  +++   +  + E+  ++ LYE EL   RK++D  A ERA +++EL   +ED    + +  K++ DL   QNL R LE        +L   LS +R   E+      Q   LE      +K+L  E+L R D+ENK  T+KEQL+F   ++ +E  ++R+ H     +I+  ++ E+ESKLA+ L+ +R +  ++   YK + E++F+ +L + +    + ++  + TR+E++  + + +    +L+    +N AL+ ++++L+ +L+   +    Q+ +   E   +R  L+ +L+E+  L+  K+ALD EI  YRK+LE EE R  +       S  +   TS S+  +  K+RK+ E G            S  + +YKV  +  S G V      D  G +V+L+N T++D  + GW+++    +  E +YK      +K++   T+W++ A   H+PP+DLV K  + +   +IKI L ++  +E A
Sbjct:    2 ATSTPSRAREHASAAPSPGSPTRISRMQEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEEKEEVTSREVTNLRLLYETELADARKLLDQTANERARLQVELGKVREDYRQLQARNSKKETDLSLAQNLLRDLESKLNTKEADLATALSGKRGLEEQLQEQRAQIAGLESSLRDTTKQLHDEMLWRVDLENKMQTIKEQLDFQRNIHEQEVKEMRKRHDTRIVEIDSGRRIEFESKLAEALQELRRDHEQQISDYKEQLERNFSAKLENAQLAAAKNSDYASATREEIMATKLRVDTLSSQLSQYQKQNSALEAKVRELQDMLDRAHDMHRRQMTEKDREVTEIRQTLQAQLEEYEQLLDVKLALDMEINAYRKMLEGEEQRLKLSPSPSQRSTVSRASTSQSSRLSRGKKRKLEETGR-----------SVTKRAYKVVQEASSTGPVSVED-IDPEGNYVRLLNNTEEDHSLHGWVVRRKHGSLPEIAYKLPCRFVLKSEQRVTIWAAGAGAVHSPPTDLVWKSHKNWGTGDIKIILLDSSGEECA 539          
BLAST of Lamin vs. Ensembl Xenopus
Match: lmx1a (LIM homeobox transcription factor 1 alpha [Source:Xenbase;Acc:XB-GENE-481569])

HSP 1 Score: 245.358 bits (625), Expect = 5.827e-71
Identity = 172/550 (31.27%), Postives = 295/550 (53.64%), Query Frame = 2
Query:  290 ATSTPSHKESH-SRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDL---QNLQRKLE--------NLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNI-------SVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKV--DLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADN-QETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEA 1873
            ATSTPS    H S +    SP  ISR +EK++L HLNDR A+YI+ VRSLE  K  L  +++   +  + E+  ++ LYE EL   RK++D  A ERA +++EL   +ED    + +  K++ DL   QNL R LE        +L   LS +R   E+      Q   LE      +K+L  E+L R D+ENK  T+KEQL+F   ++ +E  ++R+ H     +I+  ++ E+ESKLA+ L+ +R +  ++   YK + E++F+ +L + +    + ++  + TR+E++  + + +    +L+    +N AL+ ++++L+ +L+   +    Q+ +   E   +R  L+ +L+E+  L+  K+ALD EI  YRK+LE EE R  +       S  +   TS S+  +  K+RK+ E G            S  + +YKV  +  S G V      D  G +V+L+N T++D  + GW+++    +  E +YK      +K++   T+W++ A   H+PP+DLV K  + +   +IKI L ++  +E A
Sbjct:    2 ATSTPSRAREHASAAPSPGSPTRISRMQEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEEKEEVTSREVTNLRLLYETELADARKLLDQTANERARLQVELGKVREDYRQLQARNSKKETDLSLAQNLLRDLESKLNTKEADLATALSGKRGLEEQLQEQRAQIAGLESSLRDTTKQLHDEMLWRVDLENKMQTIKEQLDFQRNIHEQEVKEMRKRHDTRIVEIDSGRRIEFESKLAEALQELRRDHEQQISDYKEQLERNFSAKLENAQLAAAKNSDYASATREEIMATKLRVDTLSSQLSQYQKQNSALEAKVRELQDMLDRAHDMHRRQMTEKDREVTEIRQTLQAQLEEYEQLLDVKLALDMEINAYRKMLEGEEQRLKLSPSPSQRSTVSRASTSQSSRLSRGKKRKLEETGR-----------SVTKRAYKVVQEASSTGPVSVED-IDPEGNYVRLLNNTEEDHSLHGWVVRRKHGSLPEIAYKLPCRFVLKSEQRVTIWAAGAGAVHSPPTDLVWKSHKNWGTGDIKIILLDSSGEECA 539          
BLAST of Lamin vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 244.973 bits (624), Expect = 6.262e-71
Identity = 184/554 (33.21%), Postives = 292/554 (52.71%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKL--------------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGR-ESYKVDLVSRGNVEFS---SKPDCSGKFVKLINPTDKDICIGGWMLKY-IADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFF-SGSNIKINLTNADNQEEANCVLAK 1891
             TSTP             SP  ISR +EK+EL HLNDR A YID VRSLE+  ++L  KI    +  T E+  IK LYE EL   RK++D+ A+ERA ++IEL   + D     K  +K+D DL   Q ++ +LE      R ++E   T L +  +LE + A L               K+L+ E L+R D EN+  +L+E+++F + +Y EE+ + R+ H     +++   Q +Y+SKLA  L  +R++  E+ + YK E EQ++  +L ++K+ +   ++     R+E+   R + E    +L+    + +A + RI++LE LL+++R+++   L     E   +R+ ++++L E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S   +SS       R        R  TV+ G+  S +  L  + +   S    + D  GK+V L N +DKD  +G W LK  I + +E  YKF     +KA     ++S+DA   H+PPS LV K Q  + +GSNI+  L N + +E A   + K
Sbjct:    7 GTSTP------------LSPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADLSTAQGRIRDLEALF--HRSEAE-LGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVDFENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVTVSRATSSSSSATRTSR------SKRNRTVTSGQGSSTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEEEEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAVRTVTK 539          
BLAST of Lamin vs. Ensembl Mouse
Match: Lmnb2 (lamin B2 [Source:MGI Symbol;Acc:MGI:96796])

HSP 1 Score: 230.72 bits (587), Expect = 1.583e-65
Identity = 177/578 (30.62%), Postives = 296/578 (51.21%), Query Frame = 2
Query:  260 SKSMGEDKPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKL--------------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFS---------------ALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEANCVLAKEHT 1900
            S + G+    ATS  +    H+      SP  +SR +EK+EL  LNDR A YID VR+LE+  ++L  +I    +  T E+  IK LYE EL   R+++D+ A+ERA ++IE+   + +    RK  +KR+ +L   Q ++++LE      R ++E  +T L     LE + A+L               K+L+ E L+R D+EN+  +L+E+L F++ ++ EE  + R+ H     +++  +Q EY+ K+A  L  +R +  E+   Y++E EQ++  +L + K ++ Q ++     R+E+   R + E    +L     +  A +  I +LE  L  ER++F   L     E   +R+ ++++L E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S                     KRR++        P +R + VS G    +   V+ G V    + D  G+FV+L N +DKD  +G W +K  + + ++ +YKF     ++A    TVW++ A  TH+PPS LV K Q  +  G + +  L +AD +E A  V A +H+
Sbjct:    6 SGNRGDSPAAATSAMASLPPHAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVAQGRVKDLESLF--HRSEAE-LATALSDKQGLETEVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEDLRSQHDEQVRLYRVELEQTYQAKLDNAKLLSDQNDKAAHAAREELKEARMRVESLSYQLLGLQKQASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEERLKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSP-SRASRVSSGSRLAQ-QTVATGVVNI-DEVDPEGRFVRLKNSSDKDQSLGNWRIKRQVLEGEDIAYKFTPKYVLRAGQTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVA--VKAAKHS 575          
BLAST of Lamin vs. Ensembl Mouse
Match: Lmnb2 (lamin B2 [Source:MGI Symbol;Acc:MGI:96796])

HSP 1 Score: 225.328 bits (573), Expect = 1.051e-63
Identity = 172/558 (30.82%), Postives = 288/558 (51.61%), Query Frame = 2
Query:  320 HSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKL--------------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFS---------------ALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEANCVLAKEHT 1900
            H+      SP  +SR +EK+EL  LNDR A YID VR+LE+  ++L  +I    +  T E+  IK LYE EL   R+++D+ A+ERA ++IE+   + +    RK  +KR+ +L   Q ++++LE      R ++E  +T L     LE + A+L               K+L+ E L+R D+EN+  +L+E+L F++ ++ EE  + R+ H     +++  +Q EY+ K+A  L  +R +  E+   Y++E EQ++  +L + K ++ Q ++     R+E+   R + E    +L     +  A +  I +LE  L  ER++F   L     E   +R+ ++++L E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S                     KRR++        P +R + VS G    +   V+ G V    + D  G+FV+L N +DKD  +G W +K  + + ++ +YKF     ++A    TVW++ A  TH+PPS LV K Q  +  G + +  L +AD +E A  V A +H+
Sbjct:    7 HAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVAQGRVKDLESLF--HRSEAE-LATALSDKQGLETEVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEDLRSQHDEQVRLYRVELEQTYQAKLDNAKLLSDQNDKAAHAAREELKEARMRVESLSYQLLGLQKQASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEERLKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSP-SRASRVSSGSRLAQ-QTVATGVVNI-DEVDPEGRFVRLKNSSDKDQSLGNWRIKRQVLEGEDIAYKFTPKYVLRAGQTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVA--VKAAKHS 556          
BLAST of Lamin vs. Ensembl Mouse
Match: Lmnb1 (lamin B1 [Source:MGI Symbol;Acc:MGI:96795])

HSP 1 Score: 220.32 bits (560), Expect = 5.373e-62
Identity = 179/560 (31.96%), Postives = 285/560 (50.89%), Query Frame = 2
Query:  290 ATSTPSHKE-SHSRSFRAASPLT---ISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLS------------KQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGW-MLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEANCVLAKEHTRSSVY 1915
            AT+TP  ++ + SR+   A+PL+   +SR +EK+EL  LNDR A YID VRSLE     L  ++    +    E+  +K LYE EL   R+ +DD A+ERA ++IEL   K +         K++ DL   Q KL   E  L+            K+ ++ +    L  Q   LE   +   K+L  E LL+ D+EN+  +L E LEF + +Y EE  + R+ H     +++  +Q EYE KLA  L  +RE+   +   YK E EQ++  +L + +  ++     V   R+E++  R + E    +L+    E+ A   RI++LE +L  ER+     L     E   +R+ ++++L ++  L+  K+ALD EI  YRKLLE EE R  +S +    +  +   ASS R     RG+    D   +  S           + GNV    + D  GKF++L N +++D  +GGW M++ I D    SYK+     +KA    TVW+++A  T +PP+DL+ K Q  + +G ++K+ L N+  +E A         RS+V+
Sbjct:    2 ATATPVQQQRAGSRASAPATPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLLNYAKKESDLSGAQIKLREYEAALNSKDAALATALGDKKSLEGD-LEDLKDQIAQLEASLSAAKKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDMLAKERDNSRRMLSDREREMAEIRDQMQQQLSDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSP--SSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASAT-GNVCI-EEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTS-VSYKYTSRYVLKAGQTVTVWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQ--------RSTVF 547          
BLAST of Lamin vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 218.394 bits (555), Expect = 1.928e-61
Identity = 168/552 (30.43%), Postives = 280/552 (50.72%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAAS----PLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLER-----------DLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTS----------FSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEA 1873
            TPS + +     +A+S    P  I+R +EK++L  LNDR A YID VRSLE     L  +I    +  + E+  IK  YE EL   RK +D +AKERA +++EL   +E+    + +  K++ DL   Q +L++LE             LS++R        L  Q   LE    +  K+L  E+L R D EN+  TLKE+L+F + +Y+EE  + ++ H     +I++ KQ E+ES+LAD L+ +R +  ++ E YK E E++++ +L + ++  ++ +  V    +E+   R + +    +L+    +  A + +++DLE  L  ER+     L +   E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +     S               + +K+RK+              T   GR + +             + D  GKFV+L N +++D  +G W ++    D+   +Y+F     +KA    T+W+S A  TH+PP+DLV K Q  +  GS+++  L N+  +E A
Sbjct:    3 TPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHART--SGRVAVE-------------EVDEEGKFVRLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVA 539          
BLAST of Lamin vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 218.394 bits (555), Expect = 1.314e-60
Identity = 168/552 (30.43%), Postives = 280/552 (50.72%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAAS----PLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLER-----------DLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTS----------FSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFS-GSNIKINLTNADNQEEA 1873
            TPS + +     +A+S    P  I+R +EK++L  LNDR A YID VRSLE     L  +I    +  + E+  IK  YE EL   RK +D +AKERA +++EL   +E+    + +  K++ DL   Q +L++LE             LS++R        L  Q   LE    +  K+L  E+L R D EN+  TLKE+L+F + +Y+EE  + ++ H     +I++ KQ E+ES+LAD L+ +R +  ++ E YK E E++++ +L + ++  ++ +  V    +E+   R + +    +L+    +  A + +++DLE  L  ER+     L +   E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +     S               + +K+RK+              T   GR + +             + D  GKFV+L N +++D  +G W ++    D+   +Y+F     +KA    T+W+S A  TH+PP+DLV K Q  +  GS+++  L N+  +E A
Sbjct:    3 TPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHART--SGRVAVE-------------EVDEEGKFVRLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVA 539          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P10999|LAML3_XENLA (Lamin-L(III) OS=Xenopus laevis OX=8355 PE=2 SV=2)

HSP 1 Score: 244.973 bits (624), Expect = 3.792e-70
Identity = 171/548 (31.20%), Postives = 300/548 (54.74%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRA-ASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDL-----------SKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKV--DLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADN-QETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFF-SGSNIKINLTNADNQEEANCVL 1885
            ATSTPS    H+ + ++  SP  ISR +EK++L HLNDR A+YI+ VRSLE  K  L  +++   +  + E+  +++LYE EL   RK++D  A ERA +++EL   +E+    + +  K++ DL   Q +L +LE  L           S +R   E+      Q   LE      +K+L  E+L R D+ENK  T++EQL+F + ++ +E  +I++ H     +I+  ++ E+ESKLA+ L+ +R +  ++   YK   E++F+ +L + +    + ++  + TR+E++  + + +    +L     +N AL+ +++DL+ +L+   +    Q+ +   E   +R  L+ +L+E+  L+  K+ALD EI  YRK+LE EE R  +S +    ++ S  + S   R +  RG+    D  G +V+  + SYKV     S G V      D  G +V+L+N T++D  + GW++K +  +  E ++K      +K+    T+W++ A   H+PP+DLV K Q+ + +G NIKI L ++  +E A   L
Sbjct:    2 ATSTPSRAREHASAAQSPGSPTRISRMQEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEEREEVSSREVTNLRQLYETELADARKLLDQTANERARLQVELGKVREEYRQLQARNSKKENDLSLAQNQLRDLESKLNTKEAELATALSGKRGLEEQLQEQRAQIAGLESSLRDTTKQLHDEMLWRVDLENKMQTIREQLDFQKNIHTQEVKEIKKRHDTRIVEIDSGRRVEFESKLAEALQELRRDHEQQILEYKEHLEKNFSAKLENAQLAAAKNSDYASATREEIMATKLRVDTLSSQLNHYQKQNSALEAKVRDLQDMLDRAHDMHRRQMTEKDREVTEIRQTLQGQLEEYEQLLDVKLALDMEINAYRKMLEGEEQRLKLSPSPSQRSTVSRASTSQTSRLL--RGKKRKLDETGRSVT--KRSYKVVQQASSTGPVSVED-IDPEGNYVRLLNNTEEDFSLHGWVVKRMHMSLPEIAFKLPCRFILKSSQRVTIWAAGAGAVHSPPTDLVWKSQKTWGTGDNIKITLLDSTGEECAERTL 544          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P11048|LMNA_XENLA (Lamin-A OS=Xenopus laevis OX=8355 GN=lmna PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 6.206e-64
Identity = 173/549 (31.51%), Postives = 287/549 (52.28%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLS------------KQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAAD---------GDTSFSALNASSKRRKVGERGEYVLPDNRGNTVS-CGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEA 1873
            TP  K +   +    SP  I+R +EK++L  LNDR A YID VRSLE+   +L  +I       + E+  IK  YE EL   RK +D +AKERA +++EL   +E+    + +  K++ DL   Q +L++LE  L+            K+ +++E    L      LE   A   K+L  E+L R D EN+N TLKE+LEF + +YNEE  + ++ H     ++++ +Q E+ESKLAD L  +R +   +   YK E  +++  +L + K+  ++ +  V + ++E+   R + +    +L+    +  A + +++DLE     ER+     L     E   +R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S + +            S + +++S+ +R+  E GE     +R ++ +   R + KV +          + D  GK+V+L N +++D  +G W +K  I D     YKF   L +KA    T+W+S A  T++PPSDLV K Q  + +G +I+  L  + N+E A
Sbjct:    3 TPGQKRATRSTHTPLSPTRITRLQEKEDLQGLNDRLAVYIDKVRSLELENARLRLRITESEDVISREVTGIKSAYETELADARKTLDSVAKERARLQLELSKIREEHKELKARNAKKESDLLTAQARLKDLEALLNSKDAALTTALGEKRNLENE-IRELKAHIAKLEASLADTKKQLQDEMLRRVDTENRNQTLKEELEFQKSIYNEEMRETKRRHETRLVEVDNGRQREFESKLADALHELRAQHEGQIGLYKEELGKTYNAKLENAKQSAERNSSLVGEAQEEIQQSRIRIDSLSAQLSQLQKQLAAREAKLRDLEDAYARERDSSRRLLADKDREMAEMRARMQQQLDEYQELLDIKLALDMEINAYRKLLEGEEERLRLSPSPNTQKRSARTIASHSGAHISSSASKRRRLEEGE-----SRSSSFTQHARTTGKVSV---------EEVDPEGKYVRLRNKSNEDQSLGNWQIKRQIGDETPIVYKFPPRLTLKAGQTVTIWASGAGATNSPPSDLVWKAQSSWGTGDSIRTALLTSSNEEVA 536          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P21619|LMNB2_MOUSE (Lamin-B2 OS=Mus musculus OX=10090 GN=Lmnb2 PE=1 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 7.350e-63
Identity = 172/558 (30.82%), Postives = 288/558 (51.61%), Query Frame = 2
Query:  320 HSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKL--------------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFS---------------ALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEANCVLAKEHT 1900
            H+      SP  +SR +EK+EL  LNDR A YID VR+LE+  ++L  +I    +  T E+  IK LYE EL   R+++D+ A+ERA ++IE+   + +    RK  +KR+ +L   Q ++++LE      R ++E  +T L     LE + A+L               K+L+ E L+R D+EN+  +L+E+L F++ ++ EE  + R+ H     +++  +Q EY+ K+A  L  +R +  E+   Y++E EQ++  +L + K ++ Q ++     R+E+   R + E    +L     +  A +  I +LE  L  ER++F   L     E   +R+ ++++L E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S                     KRR++        P +R + VS G    +   V+ G V    + D  G+FV+L N +DKD  +G W +K  + + ++ +YKF     ++A    TVW++ A  TH+PPS LV K Q  +  G + +  L +AD +E A  V A +H+
Sbjct:    7 HAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVAQGRVKDLESLF--HRSEAE-LATALSDKQGLETEVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEDLRSQHDEQVRLYRVELEQTYQAKLDNAKLLSDQNDKAAHAAREELKEARMRVESLSYQLLGLQKQASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEERLKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSP-SRASRVSSGSRLAQ-QTVATGVVNI-DEVDPEGRFVRLKNSSDKDQSLGNWRIKRQVLEGEDIAYKFTPKYVLRAGQTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVA--VKAAKHS 556          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|Q03427|LAMC_DROME (Lamin-C OS=Drosophila melanogaster OX=7227 GN=LamC PE=1 SV=2)

HSP 1 Score: 225.713 bits (574), Expect = 8.732e-63
Identity = 166/566 (29.33%), Postives = 293/566 (51.77%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLT---ISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDL---QNLQRKLEN--------LERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNI----------SVAADGDTSFSALNASSKRRKVGERG-EYVLPDNRGNTVSCGRES------------YKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEAN 1876
            +TSTP    S S    A SP +    SR +EK+EL HLNDR A YID +R+LE    +LT+++     T   E   +K +YE EL + RK++D+ AKE+A +EI++K   E+    + +L+K+  +    +N  R  EN          + L+ ++   ++   L ++++ L ++   L K+L+ E L R D+EN+N +L+E+L F ++++ +E  + R    +   +I+ R   +YE+KL   L+ +R++   +    + E E  +   + +LK    +  +      +E+   R+K +    +L      N  L  RI++LE+LL+TER      +  L  E   +R+++  +L E+  LM  K++LD EI  Y KLL  EE R NI           ++++G  S    +ASS+  +V   G     P   G++    R +            Y V+  ++G++E   + D  G+F+KL N   ++I + GW L  IA ++E ++KF     +   +  T+WS DA   H+PP++LVMK +++   ++++  L NAD ++ A+
Sbjct:   16 STSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNG--SHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEI-IEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMK-KKWPVANSMRSVLANADKEDVAS 577          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P14731|LMNB1_CHICK (Lamin-B1 OS=Gallus gallus OX=9031 GN=LMNB1 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 9.899e-63
Identity = 176/540 (32.59%), Postives = 276/540 (51.11%), Query Frame = 2
Query:  338 AASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQ-----------RMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTS-FSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGW-MLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEANCVLAKEHTRSSVY 1915
            A SP  ISR +EK+EL  LNDR A YID VRSLE     L +++    +    EI  +K+L+E EL   RK +DD A+ERA ++IEL   + +         K+D DL   Q KL   E  L+ +           R   E    L  Q   LE   A   KEL  E L + D+EN+  +L E LEF + +Y EE  + R+ H     +++  +Q EYE KLA  L+ IRE+   + + YK E EQ+++ +L ++++ ++  +      R+E+   R + E     +A    E+ A + R+ +LE  L+ ER  +   L +   E   +RN ++++  ++  L+  K+ALD EI  YRKLLESEE R  +S    G +S  +   ASS R     RG+    D   +  S           + GN+    + D  GKF++L N +++D  +GGW M++ I D    SY++     +KA    T+W+++A  T +PP+DL+ K Q  + +G ++K+ L N+  +E A         RS+V+
Sbjct:   20 ALSPTRISRLQEKEELRQLNDRLAVYIDKVRSLETENSALQRRVSEREQVCGREISGLKELFETELADARKTLDDTARERAKLQIELGKLRAEHEQVLSSYAKKDSDLNAAQVKLREFEAALNAKEAALATALGDKRSQEEELEDLRDQIAQLEVSLAAAKKELADETLQKVDLENRCQSLIEDLEFRKNVYEEEIKETRRKHETRLVEVDSGRQIEYEYKLAQALKEIREQHDAQVKLYKEELEQTYSSKLENIRQSSEMHSCTANTVREELHESRMRIETLSSHIADIQKESRAWQDRVHELEDTLSKERENYRKILAENEREVAEMRNQMQQQFSDYEQLLDVKLALDMEISAYRKLLESEEERLRLS---PGPSSRVTVSRASSSRSVRTTRGKRKRIDVEESEASSSVSISHSASAT-GNISI-EEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTS-ASYRYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVVLKNSQGEEVAQ--------RSTVF 545          
BLAST of Lamin vs. TrEMBL
Match: A0A0X3NM60 (Lamin-B2 OS=Schistocephalus solidus OX=70667 GN=LMNB2 PE=3 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 7.535e-160
Identity = 268/617 (43.44%), Postives = 392/617 (63.53%), Query Frame = 2
Query:  131 MSGRSRKTRTSQQAESNTREEISIGDSDEDIMXXXXXXKRVVLSKSMGEDKPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM 1981
            MS R+RK++ S+QA+S++ ++    D              V +S     D     S PS +    R  R+ SPL I+R++EK+ELA LNDR A YIDYVR LE  KE + +KIQSI++   S +D+ ++ YEDE+ SLR++VDDLAK++A  ++ELK  ++DA   + KL +RDL+ + LQRK++ LE DLS  + D ERY  L  + DTLEK+   + ++L+ E +LRTD+ENK   L+E+L+F  RL++EE  K+    + IEE+IEDRK AEYES+LADEL + R++T +E + Y+ + E +F  +L +L+  N   ++   + RDE++  R +A+    ELA KT E D L RR+ DLE  LN ER +FE QL   R E   L+++LE R  EF+ LM+TKIALDQEILMYRK+LE EE+R NI  +   D++F    A  KRR   +  +         T S  R S++V   + G VEFSS+ D  G++VKL+N +D+D+ +G W+LK+ AD +E S+KFH ++ +K  + CT+WSSDA  THNPP D+VMK Q F SG NI I L+++D +E+A+C++ +E  ++ V +   +    S  T  E KC +M
Sbjct:    1 MSARARKSKQSEQAKSDSPQKSVTTD-----------RSHVSISSEFSRD-----SFPSPR----RRERSVSPLNITRSDEKEELASLNDRLAHYIDYVRKLEKDKETMKRKIQSITEERISRVDEARRTYEDEIASLRQLVDDLAKQKAVTDMELKKHRDDAADAKNKLARRDLEARGLQRKVDALEHDLSAFKDDHERYQRLKPEFDTLEKRLEAMRRDLEAETILRTDLENKVAGLREELDFKNRLFDEERQKLVSRTLTIEEEIEDRKAAEYESRLADELLSFRQQTGDELQEYRCQMENTFQKKLDELRAANSNASDESLRLRDEIIVVRKRADDLTHELAKKTGEVDLLNRRLSDLEHQLNQEREDFENQLRAQRAEVKRLQDELELRFGEFTDLMNTKIALDQEILMYRKMLEGEESRLNIQ-SPQRDSAFYL--AGKKRRLDADYDDETSSSEMPETSSTARYSFRVSTSATGGVEFSSEQDGQGRWVKLVNSSDEDVSLGNWVLKHQADGRECSFKFHRSVTLKPSATCTIWSSDAGATHNPPKDIVMKNQAFNSGGNISITLSDSDAKEQASCLIVRERVKAVVPHLRSQRFRGSSTTHSEEKCCIM 594          
BLAST of Lamin vs. TrEMBL
Match: A0A5K3FQP5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 6.920e-157
Identity = 249/549 (45.36%), Postives = 378/549 (68.85%), Query Frame = 2
Query:  335 RAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM 1981
            R+ SPL ISR +EK+ELAHLNDR ASYIDYVR LE  KE LT++I +IS+   S++D+++  YE E+ SLR +VDDLAKE+A  ++ELK  ++D    + KL KRD ++++LQRK++ +ERDL+  + D +RY  L  +++ LEKK   L K+L+ E +LRTD+ENK V L+E+L+F  RL  EE  K+    + +EE+IEDRK AE+ES+LADEL+A R++TA+E + Y+++ E +F  +L  L++ N     +  K R++++  R + ++   ELA K+ E D L+RR+ DLE+LLN ER ++E QL   R E   L+N+LE R  EF+ LM+TK+ALDQEILMYRK+LE EE+R N++ +    ++F +     K+R++ + G+ ++ D  G   S  R +++V   + G++EF++  D SGK+VKL N + +D+ IG W+LK+ AD QE ++KFH  + IK  + CTVWSSD+   HNPP+D+VMK Q F++G+NI I L N ++QE+A+C++ +E TR+ +    R+V  RS  +  + KCS+M
Sbjct:   42 RSPSPLNISRTDEKEELAHLNDRLASYIDYVRKLERDKECLTRRISTISEERLSQVDEVRNTYEKEISSLRHLVDDLAKEKATRDVELKKHRDDTADAKSKLAKRDGEVRSLQRKVDVMERDLASYKQDHDRYQQLRPEYEALEKKLETLIKDLEAETILRTDLENKVVGLREELDFKNRLIEEERSKLVLQTLTVEEEIEDRKAAEFESRLADELQAYRQQTADELQEYRIQMESTFQTKLEQLRRANIDATRDGGKLREDLMIMRKQCDELCHELAKKSGEVDLLQRRVVDLENLLNKEREDYEAQLTSEREEIKRLQNELELRFAEFTDLMNTKVALDQEILMYRKMLEGEESRLNLA-SPPRPSAFGSGGIVGKKRRL-DSGDEMVADELGGPCS-SRFAFRVSTSAIGDIEFTADQDGSGKWVKLTNASKRDVNIGNWILKHQADGQEVAFKFHRTVTIKPGATCTVWSSDSAIAHNPPTDIVMKNQAFYAGANITITLFNEEDQEQASCMVIRECTRAVL--PARRV--RSCTSKSDEKCSLM 583          
BLAST of Lamin vs. TrEMBL
Match: A0A504YHC4 (Lamin OS=Fasciola gigantica OX=46835 GN=FGIG_09440 PE=3 SV=1)

HSP 1 Score: 479.174 bits (1232), Expect = 8.047e-157
Identity = 248/565 (43.89%), Postives = 375/565 (66.37%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM 1981
             ++ TP  ++S SR+ R+ SPL+ISRNEEKDELAHLNDR A YIDYVR LE+ KE+LT++I S+++   S++++ +K YEDE+++LR +VDDLAK++   E++ K A++DA   R KL KRD +++ L R++ENLE++L+  + D +RY+ LL  +  LEK+  ++ ++L+ E LLRTD+ENK + LKEQL+F  RL++EE  K+ Q  + IEE++E RKQAEYE++LADELRAIR++TA E E YK++ E++F  +L  L+    Q+ ++  + R E+L  R +A+    +L+ K +E D L+RR+ +L+  L  ER + + QL   R E   L+++LE+   EF+ LM+TKIALDQEILMYRK+LE EE+R NI      D+ F+      KR      GE  +      T +  R +Y+V   + G VEF  + D  GK+VKLIN +++D+ IGGW L +  D +ET +KFH +L +K  + CT+WS D + THNPP+D+VMK + F +GS   I+L + D  E+A C + +E  R+   ++NR+   R+     + KC +M
Sbjct:   35 VSSGTP--RQSLSRAERSHSPLSISRNEEKDELAHLNDRLAGYIDYVRKLELDKERLTRRIHSVTEERMSKVEEARKTYEDEIQALRNLVDDLAKQKTKAELDAKQARDDANEARSKLNKRDQEIRTLHRRIENLEKELANFKQDHDRYAPLLSDYHALEKRFDEVQRDLEAETLLRTDLENKVLGLKEQLDFRTRLFDEEREKMVQKTMYIEEEVEGRKQAEYENRLADELRAIRDQTATELEDYKVQIEETFESKLGHLRSSADQSADDAHRQRSELLIARKRADDLAHDLSKKIAELDLLQRRVDELQRQLEQERQDHDAQLSMQREEVRRLKDELEESFREFTQLMNTKIALDQEILMYRKMLEGEESRLNIQPQV-RDSPFNITGGKRKRMDEDFDGEEAVLTGSSYTPAKARYAYRVSSTTSGPVEFYKEQDTQGKWVKLINTSNEDVSIGGWELVHEVDGKETRFKFHRSLAVKPGTTCTIWSGDTDTTHNPPADIVMKNKSFNAGSEAVISLLDGDGLEQAKCTVKRERVRTGGVSFNRRPGYRA---QSDEKCMLM 593          
BLAST of Lamin vs. TrEMBL
Match: A0A4E0R9K1 (Lamin OS=Fasciola hepatica OX=6192 GN=D915_003657 PE=3 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 9.257e-157
Identity = 248/565 (43.89%), Postives = 375/565 (66.37%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM 1981
             ++ TP  ++S SR+ R+ SPL+ISRNEEKDELAHLNDR A YIDYVR LE+ KE+LT++I S+++   S++++ +K YEDE+++LR +VDDLAK++   E++ K A++DA   R KL KRD +++ L R++ENLE++L+  + D +RY+ LL  +  LEK+  ++ ++L+ E LLRTD+ENK + LKEQL+F  RL++EE  K+ Q  + IEE++E RKQAEYE++LADELRAIR++TA E E YK++ E++F  +L  L+    Q+ ++  + R E+L  R +A+    +L+ K +E D L+RR+ +L+  L  ER + + QL   R E   L+++LE+   EF+ LM+TKIALDQEILMYRK+LE EE+R NI      D+ F+      KR      GE  +      T +  R +Y+V   + G VEF  + D  GK+VKLIN +++D+ IGGW L +  D +ET +KFH +L +K  + CT+WS D + THNPP+D+VMK + F +GS   I+L + D  E+A C + +E  R+   ++NR+   R+     + KC +M
Sbjct:   35 VSSGTP--RQSLSRAERSHSPLSISRNEEKDELAHLNDRLAGYIDYVRKLELDKERLTRRIHSVTEERMSKVEEARKTYEDEIQALRNLVDDLAKQKTKAELDAKQARDDANEARSKLNKRDQEIRTLHRRIENLEKELANFKQDHDRYAPLLSDYHALEKRFDEVQRDLEAETLLRTDLENKVLGLKEQLDFRTRLFDEEREKMVQKTMYIEEEVEGRKQAEYENRLADELRAIRDQTATELEDYKVQIEETFESKLGHLRSSADQSADDAHRQRSELLIARKRADDLAHDLSKKIAELDLLQRRVDELQRQLEQERQDHDAQLSMQREEVRRLKDELEESFREFTQLMNTKIALDQEILMYRKMLEGEESRLNIQPQV-RDSPFNITGGKRKRMDEDFDGEEAVLTGSSYTPAKARYAYRVSSTTSGPVEFYKEQDTQGKWVKLINTSNEDVSIGGWELVHEVDGKETRFKFHRSLAVKPGTTCTIWSGDTDTTHNPPADIVMKNKSFNAGSEAIISLLDGDGLEQAKCTVKRERVRTGGVSFNRRPGYRA---QSDEKCMLM 593          
BLAST of Lamin vs. TrEMBL
Match: A0A5J4NAW9 (Lamin B OS=Paragonimus westermani OX=34504 GN=DEA37_0013359 PE=3 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 2.149e-155
Identity = 249/565 (44.07%), Postives = 373/565 (66.02%), Query Frame = 2
Query:  251 VVLSKSMGEDKPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARS 1945
            V  + S+   + +A+ TP  ++S SRS R+ SPL+I+RNEEKDELAHLNDR A YIDYVR LE+ KE+LT++I S+++   S++++ +K YEDE+ +LR +VDDLAK++   E++ K +K+D+   + KL KRDL+++NLQR++E LE+DL+  + D +RY TLL     LEK+  ++ ++L+ E LLRTD+ENK + LKEQL+F  RL+ EE  K+ Q  + IEE++E RKQAEYES+LADEL++IRE+TA E + YK + E++F  +L  L+    Q  +++ + R E++  R +A++   ELA K +E + L+ R+ +L++ L  ER + + QLM  R E   L+++LE+   EF+ LM+TKIALDQEILMYRK+LE EE+R NI      D+ F+  +   +R   G  GE +         S  R +Y+V   + G VEF  + D  GK+VKL+N +  D+ +G W L + AD QE  +KFH  L +K  + CTVWSSD++ THNPPSD+VMK + F + S+  + L +AD  E+A C + +E  R    ++ R+   RS
Sbjct:   26 VTKTFSVERSRTSASGTP--RQSFSRSERSHSPLSITRNEEKDELAHLNDRLAGYIDYVRKLELDKERLTRRIHSVTEERMSKVEEARKTYEDEISALRNLVDDLAKQKTKAELDAKQSKDDSNDAKSKLNKRDLEVRNLQRRIEGLEKDLANYKQDHDRYQTLLADFRALEKRFEEVQRDLEAETLLRTDLENKVLGLKEQLDFRSRLFEEEREKLVQRTMYIEEEVEGRKQAEYESRLADELQSIREQTASELDEYKYQIEETFETKLGKLRSTADQNTDDIYRQRSELIETRKRADELAHELAKKIAELNLLQNRVDELQNQLEKERKDHDEQLMFQRQEIRRLKDELEESFREFTDLMNTKIALDQEILMYRKMLEGEESRLNIEPKT-RDSPFNFQSGKRRRMDDGIEGEDINLTGVSFIHSKARYAYRVSSTATGPVEFFKEQDTQGKWVKLVNTSTDDVSLGNWELVHEADGQELRFKFHRTLTLKPGTTCTVWSSDSDTTHNPPSDVVMKNKSFHASSDASMQLLDADGVEQAKCTVKRERVRPGGVSFGRRAGYRS 587          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmnb2 (lamin B2 [Source:NCBI gene;Acc:103025469])

HSP 1 Score: 234.187 bits (596), Expect = 4.085e-67
Identity = 176/547 (32.18%), Postives = 282/547 (51.55%), Query Frame = 2
Query:  290 ATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERD-----------LSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEANCVLAK 1891
            AT+TPS +   + S    SP  ISR +EK+EL HLNDR A YID VR+LE+  ++L  K+    +  T E+  IK LYE EL   R++VD++AKERA ++I+L  +  +     K  +K+D DL   Q +++ LE             LS+    S   + +  Q    E   A   K+L+ E L+R D+EN+  +L E+L+F + ++ EE  + R+       +++   + +YE KL+  L+ +R++  E+   YK E EQ+F  +L + K  +   ++ V+  R+E+     + E    +L+    +  A + R+++LE +LN+ER+++   +     E   +R  ++ +L+E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S   ASS   +     +    +    T    R S + +      VE   + D  GK V L N  DKD  +G W LK  I +  E  YKF     +KA    TVW++DA   H+PPSDL+ K Q  + SG      L N++ +E A   ++K
Sbjct:    2 ATATPSRESGRAASSTPLSPTRISRLQEKEELRHLNDRLAVYIDRVRALELENDRLMVKVSEKEEVTTREVSGIKSLYEAELADARRVVDEIAKERARLQIDLGKSNSELEEITKSFKKKDGDLVLAQARIKELESQYNQSEAALNTALSENAALSAELADVKTQLAKAEDAHAVAKKQLEAETLMRVDLENRCQSLTEELQFRKSMFEEEVRETRRRREKRMVEVDSGAKQDYEFKLSQALQDLRKQHEEQVGFYKEELEQTFQAKLDNAKVSSDLNDKAVSTAREELQEAHVRIESLSYQLSALQKQAAAAEDRVRELEDILNSERDKYRRMMDGKEREMSEMRERMQMQLNEYQELLDVKLALDMEINAYRKLLEGEEDRLKLSPSPSSRVTVSRSTASSSSSRTTRSTKRKRVEEEPVTAPSVRISQQAEATGGVTVE---EIDLEGKSVTLKNNADKDQSLGSWRLKRQIGEADEIVYKFSPKFVLKAGQTVTVWAADAGVAHSPPSDLLWKSQSSWGSGDETVTVLVNSNGEEVAKRTVSK 545          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 232.646 bits (592), Expect = 7.242e-67
Identity = 182/546 (33.33%), Postives = 289/546 (52.93%), Query Frame = 2
Query:  299 TPSHK-ESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETS-EIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE-----RDLSKQRMDSERYSTLLVQHDTLEKKCAKL-------SKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCG-----RESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEA 1873
            TPS K  S   +    SP  I+R +EK++L +LNDR A YID VRSLE     L  +I   S+TE S E+  +K  YE EL   RK +D +AKERA +++EL   +ED    + +  K++ DL+    +L++LE     +D S      E+ S L V+   L+ + AKL        K+L  E+L R D EN+  TLKE+LEF + +YNEE  + ++ H     +I+  KQ E+ESKLAD L  +R +  E+   YK E E+++  +L + ++   + +  V    +E+   R + E    +L+    +  A + ++++LE  L+ ER+    +L +   E  ++R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +             +++R++ +       D+  ++V+ G     R + +     R  V+   + D  GKFV+L N  D+D  +G W +K  +  +    YKF     +KA    T+W+S A  THNPPSDLV K Q  + SG   +  L +A+ +E A
Sbjct:    3 TPSQKRSSRGGATTVLSPARITRLQEKEDLCNLNDRLAVYIDKVRSLEAENAGLRLRITE-SETEISREMGGMKAAYETELADARKTLDSVAKERARLQLELSKVREDYKELKARNSKKEADLEAALARLKDLEALLNSKDASLTTALGEKRS-LEVEVRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYNEELRESKRRHESRIVEIDSGKQQEFESKLADALTELRGQHEEQLRIYKEEIEKTYNAKLENARQSADRNSHLVGAAHEELQQTRVRLESMSAQLSQLQKQLAAREAKVRELEEALSRERDMMRRRLDEREREMSDMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSP----------PPTRKRRLND------TDSEASSVAGGMVTRTRITQQASASGRITVD---EVDLEGKFVRLSNKADQDQSLGHWQVKRQVGTSTPIIYKFPPKFTLKAGQSVTIWASGAGGTHNPPSDLVWKTQNSWGSGDLFQTTLISANGEEMA 527          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmnb1 (lamin B1 [Source:NCBI gene;Acc:103034386])

HSP 1 Score: 220.32 bits (560), Expect = 4.092e-62
Identity = 178/563 (31.62%), Postives = 285/563 (50.62%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMD-----SER------YSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTS-------FSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGW-MLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVY 1915
            TA STP+ +   S      SP  I+R +EK+EL++LNDR A YID VRSLE     L  +I    +  + E+  +K LYE EL   R+ +DD AKERA ++IEL   + +     +   K+D DL   Q +L+++E  L+ +        SER       + L  Q   LE   A   K+L  E LLR D+EN+  +L E+LEF + ++ EE    R+ H     +++  +Q EYE KLA  L  +R++  ++ + YK E EQ++  +L +++  ++  + + +  R+E+     + E    +L+    E    + RI +LES L  E++     L     E   +R  ++ +L+E+  L+  K+ALD EI  YRKLLE EE R  +S +     +        S      KR++V          +   + +    S      + GNV    + D  GKF++L N +D+D  + G+ M + I D+  T YKF     +KA    T+W+S+A  + +PP+DL+ K Q  + +G N+K+ LTN D +E A         RS+V+
Sbjct:    3 TAPSTPAGRRMSSTPL---SPTRITRLQEKEELSNLNDRLAIYIDKVRSLESENSVLHLQISEKEEVRSRELTGLKALYETELADARRSLDDTAKERARLQIELGKIRTEHEQLLQSYAKKDSDLAGCQARLKDVEALLNSKEASLATALSERKALEGSLADLQAQIHELEASLASARKQLGDETLLRVDLENRCQSLVEELEFRKNMFEEEIKDTRRRHETRLVEVDSGRQVEYEFKLAQALTDMRQQHDDQVKVYKEEMEQTYMAKLENVRLSSEMNSSSASMAREELKEASLRVESLTAQLSGLQKEARGWQDRINELESALAQEKDLSRRMLADKEREISEIRAKMQLQLEEYEQLLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRV----------DVEESEASSSVSIAHSASATGNVCI-DELDVDGKFIRLHNTSDQDQPMVGFEMTRTIGDSSAT-YKFTPKYVLKAGQKVTIWASNAGVSSSPPTDLIWKSQSSWGTGENVKVVLTNGDGEEVA--------VRSTVF 542          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 214.542 bits (545), Expect = 5.535e-60
Identity = 167/548 (30.47%), Postives = 291/548 (53.10%), Query Frame = 2
Query:  338 AASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELD--------------GEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCG-RESYKVDL--VSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWML-KYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSG-SNIKINLTNADNQEEAN----CVLAKEHTRSSV 1912
            + SP  +SR +EK++L  LNDR A+YI+ VR LE  K  +   ++   +T T E+  ++ LYE+EL   RK +D  A ERA ++IE     ED      +  K++ +L N   +  +LE  L+ +  D   Y+ LL  +  LE   A L   +D               E L R D+EN+  TL+EQ++F + +  +E  ++R  H     +++  +Q E+ESKLA+ ++ +R+E   + + YK + E++F+ +L + K++  + ++  T T++E+   + + E +  +++   ++N  L+ R+++LE +L+ ER     +L +   E  ++R  ++ +L+E+ SL+  K+ LD EI  YRK+LE EE R N+S +    +S S  +A    RK G +        R +  + G   SYKV     SRG V    + D  G F+KL N +D D  +GGW++ K  +   +  +K   +  ++A+   T+WS+ A    NPP+DLV+ G + +   S++ ++L N  N+E A     CV ++    S V
Sbjct:   23 SVSPTRLSRLQEKEDLRQLNDRLANYIERVRQLESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEYSQLCEDHRRLVSRNNKKEAELSNAVERWRSLEAALNSKEAD---YANLLAANRRLETDVADLRTHVDNLESALQNAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISNLQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGT-RKAGSK-------KRKHEGASGLSPSYKVSQHSSSRGVVSI-DEIDLMGNFIKLRNNSDTDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEPNPPTDLVLSGLKTWGAVSDVLVSLFNTHNEEAAERSVVCVQSRAEGNSDV 558          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 214.157 bits (544), Expect = 7.455e-60
Identity = 167/548 (30.47%), Postives = 291/548 (53.10%), Query Frame = 2
Query:  338 AASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELD--------------GEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCG-RESYKVDL--VSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWML-KYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSG-SNIKINLTNADNQEEAN----CVLAKEHTRSSV 1912
            + SP  +SR +EK++L  LNDR A+YI+ VR LE  K  +   ++   +T T E+  ++ LYE+EL   RK +D  A ERA ++IE     ED      +  K++ +L N   +  +LE  L+ +  D   Y+ LL  +  LE   A L   +D               E L R D+EN+  TL+EQ++F + +  +E  ++R  H     +++  +Q E+ESKLA+ ++ +R+E   + + YK + E++F+ +L + K++  + ++  T T++E+   + + E +  +++   ++N  L+ R+++LE +L+ ER     +L +   E  ++R  ++ +L+E+ SL+  K+ LD EI  YRK+LE EE R N+S +    +S S  +A    RK G +        R +  + G   SYKV     SRG V    + D  G F+KL N +D D  +GGW++ K  +   +  +K   +  ++A+   T+WS+ A    NPP+DLV+ G + +   S++ ++L N  N+E A     CV ++    S V
Sbjct:   23 SVSPTRLSRLQEKEDLRQLNDRLANYIERVRQLESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEYSQLCEDHRRLVSRNNKKEAELSNAVERWRSLEAALNSKEAD---YANLLAANRRLETDVADLRTHVDNLESALQNAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISNLQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGT-RKAGSK-------KRKHEGASGLSPSYKVSQHSSSRGVVSI-DEIDLMGNFIKLRNNSDTDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEPNPPTDLVLSGLKTWGAVSDVLVSLFNTHNEEAAERSVVCVQSRAEGNSDV 558          
BLAST of Lamin vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 199.519 bits (506), Expect = 2.451e-55
Identity = 160/551 (29.04%), Postives = 289/551 (52.45%), Query Frame = 2
Query:  344 SPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDK----------IKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLD-------LQNLQRKLENLERDLSKQRMDSERYST----LLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEE---NVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRL------ADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNIS---------VAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEA 1873
            SP  ++R +EK+ L  LNDR A+YI+ VRSLE+ K +L  ++    + E  +  K          ++  Y+ EL  +R+ +DD    +A +EI+L+ A+ +    R +  K + +       +++++ +L   E  LS    D E   T    L  Q + LE       ++L+ E L R D+EN+ +TL+E+LEF +R++ +E   +   R+ H++   +I+  +Q  +E KL++ L  +R++  E+ + Y+ E +Q+   +L       + + ++    E++ +    + T  S+    + +LA+       L+ R+++LE  L+ ER++ + +L +   E   LR  ++++L E+  L+  K+ALD EI  YRKLLE EE+R N+S         V      S S      KR++V   G +V      ++++  + S      + G++    + D  GK V ++N ++KD  +GGW+LK  I D  E +YKF     +KA    T+W+++A  +HNPPSDL+ K Q  + +G +I+ +L N+D +E A
Sbjct:   10 SPTRVTRLQEKESLVELNDRLAAYIERVRSLEVDKARLLARVSMWEEEEEEQRQKSERQREATGGLRAAYDAELAEVRRALDDALGAKAALEIQLRLAQVERDEGRSRCSKYEQEWNVALGRIRDMEVQLCAKEASLSTASGDKEYLETEVDDLRNQVNQLEGVLVSSKQQLEEETLARVDLENRMLTLQEELEFTKRIHEQEIHESRSKRETHVL---EIDGGQQQAFEYKLSEALTELRQQHEEQVQLYRQELDQTMRAKLEKSILTPEKQSLDISIREDLREATSRVGTLSSQLSAAQHDLAL-------LQGRVRELEETLSHERDQSKRRLDESDRELAELREVMDEQLIEYEQLLDIKLALDMEIAAYRKLLEGEESRLNLSPEKGVQSSVVQTSTSASHSIRTMPGKRKRVQLEG-FV------DSMAQSQRSVSQHASASGSIGI-KEVDMEGKSVTMVNNSEKDQPLGGWVLKRQIEDQAEIAYKFSSRYVLKAGQTVTIWAANAGVSHNPPSDLLWKTQSSWGTGDDIRTSLLNSDGEEVA 542          
BLAST of Lamin vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 134.42 bits (337), Expect = 2.117e-34
Identity = 95/324 (29.32%), Postives = 159/324 (49.07%), Query Frame = 2
Query:  929 QIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNIS--------VAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEE 1870
            +I+   Q EYESKLA  L+ +R E  ++ + YK E E ++  ++ + K   QQ +      ++E+   R + E    +L     +    + +I+DLE  L  ER+    QL     E   +R  +  +++E+  L+  K+ALD EI  YRK+LE EE R ++S        V    +T  ++  A  KR  V E           ++VS  + +    +++   +      D  G+FVKLIN + +D  +GGW +K  I  + +  YKF     +KA    T+W+  A   HNPP DL+MK    + SG  +++ + NA+ +E+
Sbjct:   17 EIDAGHQQEYESKLAQALQDLRAEHMDQVQLYKNELENNYKTKMENAKMSLQQNSTMSGVVQEELTESRMRIETLNNQLGALQRQVAGAEAKIRDLEETLRRERDSHWRQLADKDRELTEIRQAMTAQINEYEQLLEVKLALDMEISAYRKMLEGEEERLHLSPSPSSRVTVTRSSETVRTSGGAKRKRLDVQE-------SEATSSVSVTQRASASGVIAVDEI------DAGGRFVKLINDSQQDQAVGGWTVKRSIHGHADIVYKFTGRTIVKAGDSITIWAGGAGVQHNPPRDLLMKQHSTWGSGDEVRVVVLNANGEEQ 327          
BLAST of Lamin vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 121.709 bits (304), Expect = 5.031e-30
Identity = 95/337 (28.19%), Postives = 155/337 (45.99%), Query Frame = 2
Query:  929 QIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYK-------------------VDLVSRGNVEFSSKPDCSGKFVKLINPT--DKDICIGGWMLK-YIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEE 1870
            +I+   Q EYESKLA  L+ +R E  ++ + YK E E ++  ++ + K   QQ +      ++E+   R + E    +L     +    + +I+DLE  L  ER+    QL     E   +R  +  +++E+  L+  K+ALD EI  YRK+LE EE R ++S +    +  +   +S   R  G  G  V     G   + G                            S   V    + D  G+FVKLIN +  ++D  +GGW +K  I  + +  YKF     +KA    T+W+  A   HNPP DL+MK    + SG  +++ + NA+ +E+
Sbjct:   16 EIDAGHQQEYESKLAQALQDLRAEHMDQVQLYKNELENNYKTKMENAKMSLQQNSTMSGVVQEELTESRMRIETLNNQLGALQRQVAGAEAKIRDLEETLRRERDSHWRQLADKDRELTEIRQAMTAQINEYEQLLEVKLALDMEISAYRKMLEGEEERLHLSPSP--SSRVTVTRSSETVRTSGGGGGAVSRSASGAGSASGAGGAASSRSSVASSESEATSSVSVTQRASASGVIAVDEIDAGGRFVKLINDSQQEQDQAVGGWTVKRSIHGHADIVYKFTGRTIVKAGDSITIWAGGAGVQHNPPRDLLMKQHSTWGSGDEVRVVVLNANGEEQ 350          
BLAST of Lamin vs. Ensembl Sea Lamprey
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 104.375 bits (259), Expect = 3.568e-24
Identity = 93/354 (26.27%), Postives = 171/354 (48.31%), Query Frame = 2
Query:  359 SRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKL----EFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRC 1408
            +R  EK EL  LNDRFA+YID VR LE   + L  ++  +   E +   ++  LYE ELR LR  V+ L  E+A  ++E  N  ++              LQ LQ++L+       +                  EK      +++D   L R D+E K  +L+E++ F +++++EE  +++         +E      Y+     +L A   +   E+E        E E+ +  +  DL +   + NE +   + E++ +R + + ++ ++      N++L+R+I+++E   + E   ++  + +L  +  NL++++ + L ++  L+  K+ALD EI  YRKLLE EETR 
Sbjct:   84 TRTNEKVELQELNDRFANYIDKVRYLEQQNKALLAELALLKGREPT---RVGPLYEQELRELRAQVERLTGEKARGDVERANLLDE--------------LQRLQQRLQEETAAREEA-----------------EKNLQAFRQDVDDATLARVDLERKVESLQEEIAFLKKIHDEELREVQVQVQEQTVHVE------YDVGTKPDLTAALRDIRAEYEGIAAKNVAEAEEWYKSKFLDLSEAAVRNNEALRAAKQELMDYRRQVQAQQCDIDSLKGANESLERQIREMEERFSVESANYQDTITRLEDDIGNLKDEMARHLRDYQELLHVKMALDIEIATYRKLLEGEETRV 397          
BLAST of Lamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009640.1 (pep scaffold:Pmarinus_7.0:GL477881:338409:340387:-1 gene:ENSPMAG00000008713.1 transcript:ENSPMAT00000009640.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 8.323e-18
Identity = 62/217 (28.57%), Postives = 113/217 (52.07%), Query Frame = 2
Query:  761 LEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCN 1411
            +E   A   K+L  E L R ++EN+  +L+E+L+F +  + EE  + R+ H     + +  ++ +YES+L   L  +R+   ++  ++K E E +F  +  + +  +++ + +  + R+E+     + E    +L     +   L+ R++DLE  L  ER+     L +   E   LR  ++ +L E+  L+  K+ALD EI  YRKLLE EE RC 
Sbjct:    1 MEGVLASTKKQLAEETLQRVNLENRAQSLEEELDFRKSAFEEEVRETRKQHETRMVEGDSGRKWKYESELGQALLELRQAHDDQVNAFKQELETNFRAKTDNARLASEKNSSSANRAREELSEMTLRVETLTNQLNNAQKQTSVLESRVRDLEDSLAHERDSHRRALAE--REPSELREQMQAQLKEYEELLDVKLALDMEISAYRKLLEIEEERCG 215          
BLAST of Lamin vs. Ensembl Nematostella
Match: EDO37225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD1])

HSP 1 Score: 217.624 bits (553), Expect = 1.281e-61
Identity = 167/564 (29.61%), Postives = 287/564 (50.89%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLT--ISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIE----------LKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDG-------EILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQH-------HIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAA----DGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETS-YKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKG-QRFFSGSNIKINLTNADNQEEANCV 1882
            +++STP    S SR   ++ P +   +R +EK EL HLNDR A+YID V++LE    KL  ++    KT   E+D +K LYE EL   R+++D+ AKE+A  +IE           KN  +   A RKK EK   +L ++++ L + E  L+++  ++    ++L +   L+ +C +L   L         E L R D+EN+  +L+E+  F +++Y++E   IR          +V+E   +D+    YE  +A++L+ +RE+   +  S+K E E  ++ +  +L+   ++ +E + K R+E        ++   ++    ++N+AL  R+ DL+ L   ++ + + +++    E   LR  ++  L ++  LM  K+ALD EI  YRKLLESEETR  I+  A     G +S S     +KR +                      +      + G ++F ++ D  GK++K+ N  +KD  +GGW ++     ++ S YKF     +K++S  TVWS+    TH PPSDLV K    + SG+  +  L NA  +E A  +
Sbjct:   10 SSSSTPKTPVSSSRIMGSSPPGSAKFTRAQEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADARRLLDETAKEKAKQQIESSKNSNDAQEFKNKFDKEAAARKKAEK---ELNDVRKLLHDKENQLTRRNQEALNLESVLRE---LQGECEELKDALKAAKYALEQETLTRVDLENRCQSLQEEQNFKKQMYDKELSDIRSQLKTVETKRVVVETDYKDK----YEGLMAEKLQELREDYDSDARSFKEETELLYSSKFEELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGLRAQDKEKHDNEILLRENEIAELRTSIDDALRDYEDLMGVKVALDMEITAYRKLLESEETRLEITPPASPVLGGSSSVSQTRRGNKRAR----------------TEETESTMTTTTTAEGAIQF-TEADPDGKYIKIYNSGEKDEALGGWTIQRQVGTEDPSVYKFTPKYVLKSQSHVTVWSAQGGGTHKPPSDLVFKQLPSWGSGNEARTALVNAGGEEMATLL 546          
BLAST of Lamin vs. Ensembl Nematostella
Match: EDO39801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W1])

HSP 1 Score: 50.8322 bits (120), Expect = 5.829e-8
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 1571 GNVE-FSSKPDCSGKFVKLINPT-DKDICIGGWMLKY-IADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ 1810
            GNV      PD  G +V+L N +  +D  IGG+M++  +A    T ++F     +KA S  TVWS+ +   HNPPSD + K Q
Sbjct:    5 GNVRILEVNPD--GNYVRLFNTSAHRDEEIGGYMIQQNVAGRPVTVFRFPPRTRLKALSHTTVWSAGSLSRHNPPSDFLWKEQ 85          
BLAST of Lamin vs. Ensembl Medaka
Match: lmnb2 (lamin B2 [Source:NCBI gene;Acc:101158263])

HSP 1 Score: 227.639 bits (579), Expect = 9.016e-65
Identity = 176/546 (32.23%), Postives = 274/546 (50.18%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTL--------------EKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHH---IVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKV--DLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADN-QETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEA 1873
            TPS     S +    SP  ISR +EK +L  LNDR A YI+ VR+LE+  ++L  K+    +  T E+  +K LYE EL  LR+++D+ AKERA ++I+L  A+ D     +  +K++ DL     +  +LE  L K        ST L Q   L              E   A   ++L+ E L+R D+EN+  +L E L+F   +++EE  + R+H    IV   +++   + EYE KL   L+ +R++  E+   YK E E++F  +L +    ++ +N  +   R+E+   RS+ E    +L+    +    + RI++LE +L+ ER+     + +   E   LR  ++ +L E+  L+  K+ALD EI  YRKLLE EE R  +S +     + S +  SS  R    +   V             E   V  +  S G+V      D  G  VKL N TD+D  +G W L+   DN +E  YKF     +KA    TVWS+DA + HNPPS+L+ K Q  + +GS I  +L ++  +E A
Sbjct:    7 TPSRDTGRSAASTPLSPTRISRLQEKQDLQQLNDRLAVYIERVRALELENDRLMVKVSEKEEVTTREVTGLKALYEAELADLRRVLDETAKERARLQIDLGKAQADLEEATRSAKKKEADLAAAVSRANSLEGQLHKSEAA---LSTALSQSAALTSELGEVKSLLAKAEDGHAVAKRQLEAETLMRVDLENRCQSLSEDLDFRRNMFDEEMRESRRHQEQRIV---EVDSGARQEYEFKLTQALQDLRKQHDEQVSFYKEELEKTFQAKLENAHVSSEMSNAAMDAAREELQESRSRIESLSYQLSSLQKQVGTSEDRIRELEEILSAERDRHRRAMERKEQEMSELREGMDAQLSEYQELLDVKLALDVEINAYRKLLEGEEHRLKLSPSPSARVTVSRVTGSSSSRSTKRKWSEVEAQEEAGQ---AEEQLLVSEEATSTGSVSI-CPTDMDGTSVKLTNETDQDQPLGSWRLRRQVDNGEEVVYKFSPKFVLKAGQSVTVWSADAGKPHNPPSELLWKSQASWGTGSTIVTSLIDSSGEEVA 542          
BLAST of Lamin vs. Ensembl Medaka
Match: ENSORLT00000011270.2 (lamin-A [Source:NCBI gene;Acc:101160250])

HSP 1 Score: 216.468 bits (550), Expect = 3.340e-60
Identity = 164/535 (30.65%), Postives = 277/535 (51.78%), Query Frame = 2
Query:  344 SPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLE-----RDLSKQRMDSERYSTLLVQHDTLEKKCAKLS-------KELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAAD-----------GDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWML-KYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQ-RFFSGSNIKINLTNADNQEEA 1873
            SP  I+R +EK++L++LNDR A YID VRSLE     L  +I       T E+  +K  YE EL   RK +D +AKERA +++EL   +ED    + +  K++ DL    ++L++LE     +D S      E+ + L V++  L+ + +KL        K+L  E+L R D EN+  TLKE+LEF + L++EE  + ++ H     ++ + +Q ++ESKLA+ L  +R +   + + YK E E+++  +L   ++   +++  V    +E+   R++ E    +L+    +  A + +I+DLE  L  ER+     L     E  ++R  ++++LDE+  L+  K+ALD EI  YRKLLE EE R  +S +             G +  S+  +S  +R+     +       G  ++  R + +     R  V+   + D  GK+V+L N  D+D  +G W + + +       +KF     +KA    T+W+S+A  +HNPPSDLV K Q  + +G   +  L +A  +E A
Sbjct:   17 SPNRITRLQEKEDLSNLNDRLAVYIDKVRSLEAENACLRVRITESETEVTRELTGLKNAYEAELADARKTLDSVAKERARLQLELGKLREDHKELKARNTKKESDLAAALQRLKDLEALMNSKDASLTTALGEKRN-LEVENRDLKAQVSKLDTGLGDARKQLQDEMLRRVDGENRIQTLKEELEFQKNLHSEELQETKRRHESRMVEMNNGQQQDFESKLAEALVEMRSQHELQIQLYKEEIEKTYNAKLESARQSADRSSHLVGAAHEELQQIRTRLESTSAQLSQLQKQLAAREAKIRDLEDALTRERDSTRRLLADKEREMADMRQRMQQQLDEYQELLDVKLALDMEICAYRKLLEGEEERLRLSPSPPPTRVTGSRSSVGRSVHSSAQSSPAKRRRPNEADSEASSYGGGALARTRITQQASASGRVTVD---EVDLDGKYVRLSNKADEDQNLGSWQVRRQVGSGTPILFKFPAKFTLKAGQRVTIWASNAGGSHNPPSDLVWKSQPSWGTGDQFQTTLISASGEEMA 547          
BLAST of Lamin vs. Ensembl Medaka
Match: lmna (lamin A/C [Source:NCBI gene;Acc:101162240])

HSP 1 Score: 214.927 bits (546), Expect = 9.373e-60
Identity = 174/566 (30.74%), Postives = 285/566 (50.35%), Query Frame = 2
Query:  299 TPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLS------------KQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEEN--VKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVA----------ADGDTSFSALNASS---------------KRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKY-IADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQR-FFSGSNIKINLTNADNQEEA 1873
            TPS K    R+ R  SP  I+R +EK++L +LNDR A YID VRSLE     L  +I       T ++  IK  YE+EL   R  +D +AKE+A ++++L   +E+    + +  K++LDL+    +L +LE  L+            K+ +++E    L  Q   L+   A   K+L  E+L R D EN+  T+KE+LEF + +YNEE    K R    ++E  I+  +Q E+E+KLA  L  +R +  E+   YK E E+++  RL + +   ++T   V    +E+   RS+ E    ++     +  A + ++++LE  L+ ER+    +L     E    R  ++++L+++  L+  K+ALD EI  YR LLE EE R  +S +          + G +  S L  SS               K+R++    + V     G TV     S +     R  V   ++ D  GKF++L N +D+D  +G W +K  + D    +YKF     +KA +  T+W++    THNPP+DLV K Q  + +G +++I L ++  +E A
Sbjct:    3 TPSQK----RTMRVQSPARITRLQEKEDLCNLNDRLAVYIDKVRSLEAENAGLRLRISESESLVTRDLSGIKAAYENELADARHALDQVAKEKARLQLDLGKIREEHKELKARNTKKELDLEAALARLRDLEALLNSKDAALATALGEKRNLEAE-VKDLKAQLAKLDMNLADARKQLQDEMLKRVDAENRLQTVKEELEFQKNIYNEETRESKRRSESRMVE--IDCSRQQEFENKLAAALVELRAQHEEQVSIYKEELEKTYNSRLENARHSAERTTHLVGAAHEELQQTRSRLEGLTLQMTQLQKQLSASEAKVRELEEALSRERDLMRRRLEDKDREMAENRARMQQQLEDYQELLDIKLALDMEISHYRTLLEGEEERLRLSPSPPSAKVIVTRSTGSSHASRLLHSSAVASSSRTSSGASSTKKRRL---NDSVAASMVGGTVVKSHISQQASASGRIVV---NEVDLEGKFIRLSNKSDEDQSLGSWQVKAQVGDGNPVTYKFPSKFSLKAGATVTIWAASGGGTHNPPTDLVWKNQNSWGTGDSLEIILVSSSGEEMA 555          
BLAST of Lamin vs. Ensembl Medaka
Match: lmnl3 (lamin-L(III) [Source:NCBI gene;Acc:101168604])

HSP 1 Score: 209.92 bits (533), Expect = 1.976e-58
Identity = 152/545 (27.89%), Postives = 285/545 (52.29%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQ------------RMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSG-SNIKINLTNADNQEEANC 1879
            +ATSTP+ +    R   + SP    R +E+ EL HLNDR A+YI  V+ LE  K  +  ++Q   +    E   +++LYE+EL  +R+ +D+LA ERA ++IE  N +ED +  + + +K++ DL     +   +E  LS +            R+  E  + L VQ +  E+  A+   +L  EIL R ++EN+  TLKEQLE  + +  +E +++R        ++E  ++ E+ESKLA+ ++ +RE+   + + YK   E++F+ +L + ++  ++   +V+  R+E+   R K E    +L     +   L+ R ++L+  L+ ER+ ++ +L     E  ++R  +  +L+   +L+  K+ALD EI  YRK+LE EE R  +S      TS + +    + R    + E     +    + C R + K      G V   ++ D  GK+V++ N +D++  +GGW+++ +   + + S++F  +  +      T+WSS A +    P D+V++    +    ++++ L N  ++EE++C
Sbjct:    3 SATSTPAAR-GGRRGACSPSPGQPPRVQERGELRHLNDRLANYIQRVQELEQEKGAMLLRLQEQEEATARETRGVRRLYEEELADVRRALDELAAERARLQIEQGNQREDILKLQSRNQKKENDLAAAVTQRRKVEAVLSSKEAENRKLLSENGRLGGE-VADLQVQLENAERLLAETKNQLSSEILRRVEMENQVQTLKEQLELQKNISRQEILEVRSRQETRLVEVESGRRREFESKLAETMQQLREDHTLQLQQYKEAMEKTFSTKLQNAQQAAEENGVSVSTAREELEASREKLESLRSQLQQNQKDKLVLEERFQELQRTLDQERDAWQQRLSLKERELLSMRTQMNSQLENHQNLLDVKLALDMEINAYRKMLEVEEQRLQLSPTPPRHTSVARVQEHHQLRGKKRKHEEATRSSPAYKI-CRRSTRK------GGVTV-AEVDVGGKYVQIQNNSDQEQPLGGWVVRRVYPHSGDVSFQFPPSCVLAGGQTLTIWSSGAADEAE-PGDMVLENNGSWGAVGDMRVVLLNPSHEEESDC 536          
BLAST of Lamin vs. Ensembl Medaka
Match: lmnl3 (lamin-L(III) [Source:NCBI gene;Acc:101168604])

HSP 1 Score: 209.149 bits (531), Expect = 3.254e-57
Identity = 152/545 (27.89%), Postives = 285/545 (52.29%), Query Frame = 2
Query:  287 TATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQ------------RMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYI-ADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSG-SNIKINLTNADNQEEANC 1879
            +ATSTP+ +    R   + SP    R +E+ EL HLNDR A+YI  V+ LE  K  +  ++Q   +    E   +++LYE+EL  +R+ +D+LA ERA ++IE  N +ED +  + + +K++ DL     +   +E  LS +            R+  E  + L VQ +  E+  A+   +L  EIL R ++EN+  TLKEQLE  + +  +E +++R        ++E  ++ E+ESKLA+ ++ +RE+   + + YK   E++F+ +L + ++  ++   +V+  R+E+   R K E    +L     +   L+ R ++L+  L+ ER+ ++ +L     E  ++R  +  +L+   +L+  K+ALD EI  YRK+LE EE R  +S      TS + +    + R    + E     +    + C R + K      G V   ++ D  GK+V++ N +D++  +GGW+++ +   + + S++F  +  +      T+WSS A +    P D+V++    +    ++++ L N  ++EE++C
Sbjct:    3 SATSTPAARGGR-RGACSPSPGQPPRVQERGELRHLNDRLANYIQRVQELEQEKGAMLLRLQEQEEATARETRGVRRLYEEELADVRRALDELAAERARLQIEQGNQREDILKLQSRNQKKENDLAAAVTQRRKVEAVLSSKEAENRKLLSENGRLGGE-VADLQVQLENAERLLAETKNQLSSEILRRVEMENQVQTLKEQLELQKNISRQEILEVRSRQETRLVEVESGRRREFESKLAETMQQLREDHTLQLQQYKEAMEKTFSTKLQNAQQAAEENGVSVSTAREELEASREKLESLRSQLQQNQKDKLVLEERFQELQRTLDQERDAWQQRLSLKERELLSMRTQMNSQLENHQNLLDVKLALDMEINAYRKMLEVEEQRLQLSPTPPRHTSVARVQEHHQLRGKKRKHEEATRSSPAYKI-CRRSTRK------GGVTV-AEVDVGGKYVQIQNNSDQEQPLGGWVVRRVYPHSGDVSFQFPPSCVLAGGQTLTIWSSGAADEAE-PGDMVLENNGSWGAVGDMRVVLLNPSHEEESDC 536          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000009886.1 (SMESG000009886.1)

HSP 1 Score: 1246.49 bits (3224), Expect = 0.000e+0
Identity = 617/617 (100.00%), Postives = 617/617 (100.00%), Query Frame = 2
Query:  131 MSGRSRKTRTSQQAESNTREEISIGDSDEDIMXXXXXXKRVVLSKSMGEDKPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM 1981
            MSGRSRKTRTSQQAESNTREEISIGDSDEDIMTTTTTTKRVVLSKSMGEDKPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM
Sbjct:    1 MSGRSRKTRTSQQAESNTREEISIGDSDEDIMTTTTTTKRVVLSKSMGEDKPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM 617          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000047473.1 (SMESG000047473.1)

HSP 1 Score: 119.398 bits (298), Expect = 6.172e-28
Identity = 129/535 (24.11%), Postives = 242/535 (45.23%), Query Frame = 2
Query:  398 DRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLAD---ELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKI----NLTNADNQEEANCVLAKEHTRSSVYNYNRKVAARSLRTGEESKCSMM 1981
            D  A+YIDYVR++E + E L  + Q++ ++   +I  IK  Y +E+ SLRK +DDLA     + +E K+ +E+      KL+     L  ++  +  L+ ++S  R   E Y  L  ++  +  +  K    L  EI    ++EN+ +TL E+++F ++L     +       +I        Q  + S   D   ++  ++ +  E+FE  + + E+ +  +  ++ K N+++         E    + + E    +   K ++  AL  RI      +     E +  L  +  E+  L++ L  ++ E S L+  KIAL++E  ++  LLE E+TRCNIS              + KRRK+          N  +T     + ++++  +   ++     + +G  +KL+N +DK I I  W L  I D+  + Y F    +I +K    +W+ D+     P  D V   +   S  ++ +     LTN  +  EA+  L +   R  +     K   R+++T E  +C++M
Sbjct:   37 DGLANYIDYVRNIEASNENLKNEKQNLIESYEKDIYTIKSTYGEEIDSLRKALDDLATSTIKLNLENKSLQEERDCLSNKLKNETYSLNAMKTDMIELQENISNYRKKLEGYEVLKQEYSDISIENNKNKVALKNEICKCVELENRRITLTEEVDFYKKLNANSKITTETSFSII--------QNTHNSDANDKNEQVEILKRQLTEDFEHCREKLEKFYDNKCNEIMKANEKSILRYNTLFGENSNLKREIENLRNDNFAKDNQISALNNRIVSFNEFIEQRDREHDNHLKDMLNENRILQDKLNLKIQELSDLVDEKIALEKEFYVFTTLLEGEKTRCNISGV-----------TTPKRRKI----------NNDDT----DDKFQINAYTNDAMKLFCDEEYNGGHIKLLNDSDKLININEWKLTIITDDSTSVYCFPDK-NIDSKQTLQIWTVDS-----PVMDDVDNIRLNISLPDLSVLRSCTLTNDMDGFEASFKLKRAEPRKIL-----KAHPRNVQTNE--RCAIM 525          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000047473.1 (SMESG000047473.1)

HSP 1 Score: 118.627 bits (296), Expect = 1.281e-27
Identity = 123/502 (24.50%), Postives = 228/502 (45.42%), Query Frame = 2
Query:  398 DRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLAD---ELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHNPPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKE 1894
            D  A+YIDYVR++E + E L  + Q++ ++   +I  IK  Y +E+ SLRK +DDLA     + +E K+ +E+      KL+     L  ++  +  L+ ++S  R   E Y  L  ++  +  +  K    L  EI    ++EN+ +TL E+++F ++L     +       +I        Q  + S   D   ++  ++ +  E+FE  + + E+ +  +  ++ K N+++         E    + + E    +   K ++  AL  RI      +     E +  L  +  E+  L++ L  ++ E S L+  KIAL++E  ++  LLE E+TRCNIS    G T       + KRRK+          N  +T     + ++++  +   ++     + +G  +KL+N +DK I I  W L  I D+  + Y F    +I +K    +W+ D+     P  D V          NI++N++  D     +C L  +
Sbjct:   37 DGLANYIDYVRNIEASNENLKNEKQNLIESYEKDIYTIKSTYGEEIDSLRKALDDLATSTIKLNLENKSLQEERDCLSNKLKNETYSLNAMKTDMIELQENISNYRKKLEGYEVLKQEYSDISIENNKNKVALKNEICKCVELENRRITLTEEVDFYKKLNANSKITTETSFSII--------QNTHNSDANDKNEQVEILKRQLTEDFEHCREKLEKFYDNKCNEIMKANEKSILRYNTLFGENSNLKREIENLRNDNFAKDNQISALNNRIVSFNEFIEQRDREHDNHLKDMLNENRILQDKLNLKIQELSDLVDEKIALEKEFYVFTTLLEGEKTRCNIS----GVT-------TPKRRKI----------NNDDT----DDKFQINAYTNDAMKLFCDEEYNGGHIKLLNDSDKLININEWKLTIITDDSTSVYCFPDK-NIDSKQTLQIWTVDS-----PVMDDV---------DNIRLNISLPDLSVLRSCTLTND 490          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000062826.1 (SMESG000062826.1)

HSP 1 Score: 106.686 bits (265), Expect = 1.286e-23
Identity = 123/503 (24.45%), Postives = 241/503 (47.91%), Query Frame = 2
Query:  245 KRVVLSKSMG-EDKPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEI--------------ELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQ-HHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSC--GRESYKVDL--VSRGNVEFSSKPDCS--GKFVKLINPTDKDICIGGWMLKYIADN 1687
            + + +SKS G    P ATS   H           + L   R +EK+EL  LNDRFA+YID VR+LE   ++L+ ++  +      E  +IK  Y++++  LR+ +D     +A +E+              EL +A +  +A ++ ++K    L + + ++ NL + L     +  R +  +++   L+++   L ++L+ E L      N+  +L +Q+EF ++++  E   +R+   +V ++  E++    + +++A  LR I+ E   + ++   + E  +TL++ +++    Q N    + R+E    + +  +    L    + N+ L+R ++ L   +  +  EF+ +   LR E  N + +LE  L E   L+  K++L+ EI+ YRK+LE EE R N     + + +  +++      +     ++  P  +    S   G  S K      ++GNV      +CS  GKF+ L N   ++  I G++L+   DN
Sbjct:   52 RTIEMSKSYGLSSTPGATSNIVHN--------GVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMR---LKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESE---VRELASLVYKDSTENKDF--WRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQ---ECSPDGKFIILENTGSQEEDISGYILQRNTDN 535          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000030599.1 (SMESG000030599.1)

HSP 1 Score: 98.5969 bits (244), Expect = 7.312e-21
Identity = 102/394 (25.89%), Postives = 185/394 (46.95%), Query Frame = 2
Query:  359 SRNEEKDELAHLNDRFASYIDYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIA---------------YRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESD------------------NLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTS 1441
             R +EK +L  LN+RFASYI+  R LE   ++L  +I+ +      +  K+K++YE E+  LR ++++  K RA +EI++ N+ E  I                YR  ++K+  +L+  + ++  L+R    + +D+ +      +   L  +  KL +  + E L    +E+   +L+E +EF ++++  E   +++   V  +         ++S++   LR I+ E   +    K E E S++L++ +++          +KTRD + T + K E      +   S+  +++ RI DLE     +  E+E  L  +R   +                    + DL   L E  SL+  K+ L+ EI  Y KLLE EE R N S  +DG+TS
Sbjct:  165 GRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQV-NSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKD---ETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATE---VKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLSGIKQELEASYSLQMQEIR---------TSKTRDNVETTQYKEEN-----SRIKSQIQSMRSRITDLE----MQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS--SDGNTS 531          
The following BLAST results are available for this feature:
BLAST of Lamin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMNA1.813e-6330.81lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA3.362e-6331.18lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA5.819e-6331.18lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNB29.463e-6331.13lamin B2 [Source:HGNC Symbol;Acc:HGNC:6638][more]
LMNA9.508e-6331.07lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
back to top
BLAST of Lamin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmn-12.978e-4128.65Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443][more]
lmn-12.978e-4128.65Lamin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21443][more]
ifb-12.601e-3526.12Intermediate filament protein ifb-1 [Source:UniPr... [more]
ifb-12.601e-3526.12Intermediate filament protein ifb-1 [Source:UniPr... [more]
ifb-14.797e-3526.12Intermediate filament protein ifb-1 [Source:UniPr... [more]
back to top
BLAST of Lamin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LamC8.711e-6429.33gene:FBgn0010397 transcript:FBtr0087512[more]
LamC3.032e-6329.46gene:FBgn0010397 transcript:FBtr0333166[more]
Lam3.857e-6330.46gene:FBgn0002525 transcript:FBtr0346460[more]
Lam3.857e-6330.46gene:FBgn0002525 transcript:FBtr0307059[more]
Lam3.857e-6330.46gene:FBgn0002525 transcript:FBtr0307058[more]
back to top
BLAST of Lamin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb21.850e-6631.43lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmna5.571e-6534.10lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmna5.571e-6534.10lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmna5.571e-6534.10lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmna1.098e-6433.99lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
back to top
BLAST of Lamin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
timm133.575e-7133.21translocase of inner mitochondrial membrane 13 hom... [more]
timm134.040e-7133.04translocase of inner mitochondrial membrane 13 hom... [more]
lmx1a5.481e-7131.27LIM homeobox transcription factor 1 alpha [Source:... [more]
lmx1a5.827e-7131.27LIM homeobox transcription factor 1 alpha [Source:... [more]
timm136.262e-7133.21translocase of inner mitochondrial membrane 13 hom... [more]
back to top
BLAST of Lamin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmnb21.583e-6530.62lamin B2 [Source:MGI Symbol;Acc:MGI:96796][more]
Lmnb21.051e-6330.82lamin B2 [Source:MGI Symbol;Acc:MGI:96796][more]
Lmnb15.373e-6231.96lamin B1 [Source:MGI Symbol;Acc:MGI:96795][more]
Lmna1.928e-6130.43lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
Lmna1.314e-6030.43lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
back to top
BLAST of Lamin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10999|LAML3_XENLA3.792e-7031.20Lamin-L(III) OS=Xenopus laevis OX=8355 PE=2 SV=2[more]
sp|P11048|LMNA_XENLA6.206e-6431.51Lamin-A OS=Xenopus laevis OX=8355 GN=lmna PE=2 SV=... [more]
sp|P21619|LMNB2_MOUSE7.350e-6330.82Lamin-B2 OS=Mus musculus OX=10090 GN=Lmnb2 PE=1 SV... [more]
sp|Q03427|LAMC_DROME8.732e-6329.33Lamin-C OS=Drosophila melanogaster OX=7227 GN=LamC... [more]
sp|P14731|LMNB1_CHICK9.899e-6332.59Lamin-B1 OS=Gallus gallus OX=9031 GN=LMNB1 PE=2 SV... [more]
back to top
BLAST of Lamin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NM607.535e-16043.44Lamin-B2 OS=Schistocephalus solidus OX=70667 GN=LM... [more]
A0A5K3FQP56.920e-15745.36Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A504YHC48.047e-15743.89Lamin OS=Fasciola gigantica OX=46835 GN=FGIG_09440... [more]
A0A4E0R9K19.257e-15743.89Lamin OS=Fasciola hepatica OX=6192 GN=D915_003657 ... [more]
A0A5J4NAW92.149e-15544.07Lamin B OS=Paragonimus westermani OX=34504 GN=DEA3... [more]
back to top
BLAST of Lamin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb24.085e-6732.18lamin B2 [Source:NCBI gene;Acc:103025469][more]
lmna7.242e-6733.33lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmnb14.092e-6231.62lamin B1 [Source:NCBI gene;Acc:103034386][more]
lmnl35.535e-6030.47lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnl37.455e-6030.47lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
back to top
BLAST of Lamin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb22.451e-5529.04lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmnb22.117e-3429.32lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmnb25.031e-3028.19lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
desmb3.568e-2426.27desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
ENSPMAT00000009640.18.323e-1828.57pep scaffold:Pmarinus_7.0:GL477881:338409:340387:-... [more]
back to top
BLAST of Lamin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO372251.281e-6129.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398015.829e-838.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lamin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb29.016e-6532.23lamin B2 [Source:NCBI gene;Acc:101158263][more]
ENSORLT00000011270.23.340e-6030.65lamin-A [Source:NCBI gene;Acc:101160250][more]
lmna9.373e-6030.74lamin A/C [Source:NCBI gene;Acc:101162240][more]
lmnl31.976e-5827.89lamin-L(III) [Source:NCBI gene;Acc:101168604][more]
lmnl33.254e-5727.89lamin-L(III) [Source:NCBI gene;Acc:101168604][more]
back to top
BLAST of Lamin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009886.10.000e+0100.00SMESG000009886.1[more]
SMESG000047473.16.172e-2824.11SMESG000047473.1[more]
SMESG000047473.11.281e-2724.50SMESG000047473.1[more]
SMESG000062826.11.286e-2324.45SMESG000062826.1[more]
SMESG000030599.17.312e-2125.89SMESG000030599.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014980 ID=SMED30014980|Name=Lamin|organism=Schmidtea mediterranea sexual|type=transcript|length=2397bp
CTATTTTAAATTACTTTTCAATGACTTTAGCTATAATACTTGTTAATTAT
TTGTTTATTCAAATCAATTGTTATAATTCCAATTTCATCCATAAGTAATT
TTATTAAGCTTTCTAGATAATTTTTATTCAATGTCTGGTAGAAGCAGAAA
AACTAGAACTTCTCAACAAGCTGAGTCTAACACCCGAGAAGAAATAAGCA
TTGGTGACAGCGATGAAGATATCATGACTACAACAACCACAACAAAACGT
GTCGTCTTGTCAAAAAGTATGGGCGAAGATAAGCCAACTGCTACTTCTAC
CCCATCACACAAAGAAAGCCATTCCCGTTCCTTTAGAGCTGCTAGTCCTT
TAACAATTTCCAGAAATGAGGAAAAGGATGAATTAGCTCACTTGAATGAT
CGATTTGCTTCATATATTGACTATGTTCGAAGTCTTGAAATTGCTAAGGA
AAAATTAACGAAAAAAATTCAATCCATATCCAAAACTGAAACTTCCGAAA
TTGATAAAATTAAGAAACTATACGAAGATGAACTAAGATCTTTACGAAAA
ATGGTAGATGATTTGGCAAAAGAAAGAGCGAACATTGAAATCGAATTGAA
AAATGCTAAAGAAGATGCAATAGCTTATCGTAAGAAACTTGAAAAACGAG
ACTTAGATTTACAGAATTTACAAAGGAAACTCGAAAATCTTGAAAGAGAT
TTGTCTAAACAGCGAATGGACAGTGAACGATATTCAACTCTGTTAGTACA
ACATGATACTTTGGAGAAGAAATGTGCTAAACTAAGTAAAGAATTAGATG
GGGAAATTTTATTAAGAACTGATATTGAAAACAAAAATGTTACGTTAAAA
GAACAATTAGAATTCAATGAACGTTTATACAACGAAGAAAATGTTAAAAT
TCGACAACATCATATTGTTATCGAAGAACAAATCGAAGATCGCAAGCAAG
CAGAATATGAATCAAAATTAGCCGACGAATTGCGAGCTATTCGTGAAGAA
ACTGCTGAAGAATTTGAAAGCTATAAACTGGAATTTGAACAGTCATTCAC
GCTAAGATTGGCAGATTTAAAAAAAATTAACCAGCAAACCAATGAAAATG
TTACAAAAACCCGTGATGAGATGTTAACTTGGAGATCAAAGGCTGAACAG
AGGGAACAGGAGTTGGCTATGAAGACCTCTGAAAATGATGCGTTAAAAAG
ACGGATTAAAGACCTCGAATCTCTATTGAATACTGAAAGAAATGAATTTG
AAGGACAACTAATGAAACTGCGTGGAGAATCAGACAATTTACGAAATGAT
TTAGAGAAACGACTTGATGAATTTTCCAGTTTAATGAGCACAAAAATTGC
ATTAGATCAAGAAATTCTCATGTACAGAAAACTTTTGGAAAGCGAAGAAA
CTCGGTGTAATATTAGCGTTGCTGCAGATGGCGACACGAGTTTCTCGGCA
CTGAATGCTAGCTCTAAGCGCAGGAAGGTCGGGGAGCGAGGGGAATACGT
GCTACCAGATAATAGGGGAAATACGGTCTCGTGTGGCCGTGAAAGTTACA
AAGTTGATCTCGTTAGTCGTGGAAATGTGGAGTTTTCATCGAAACCCGAC
TGCTCTGGGAAATTTGTGAAATTGATAAATCCTACGGATAAAGATATTTG
CATTGGTGGATGGATGCTGAAATATATCGCTGATAACCAGGAAACCAGCT
ATAAATTCCATCACAACCTTCATATCAAGGCCAAATCGGATTGCACAGTT
TGGAGCAGTGATGCGAATGAAACTCACAATCCACCAAGCGATTTGGTGAT
GAAAGGCCAGCGCTTTTTCTCTGGTTCTAACATTAAAATCAACCTAACAA
ACGCTGACAATCAGGAGGAGGCGAATTGTGTGCTGGCGAAGGAGCATACG
AGGTCATCTGTATACAATTACAATAGAAAGGTAGCTGCTAGGAGCCTCAG
AACTGGCGAGGAGAGTAAATGCTCGATGATGTGATCGGTGATCATTGTGC
GGAAGATGTCAATCATCAATGCTGATTGGTTATCTGTTTGTGTATCTGAG
TTGCGTTTTCCAATTAGTTTTATTTTTATTTTTTTAGAAATTCTGTGTTT
ATAATTAATATTAATATAATAATAATAATAATTCGATGTAATGATAATAA
TAATAATGCAATTTTATGTACCTATATATCTCTCTAACACATTTGTTACT
TGTGCTGTTGTGCTGTTGTTGTCGCTATTGGTTATGATGACGAGGAGGAA
CGGGAGGAACAAATGTTATTTTATCGCCTTGTCTCGATATCTGACGTCCC
ATTGGCACACTGTGAAGCTTTTTTATATTTTAATATATTTCTACGGTTTG
CCTGATTGTTAATTCATTTATTGATTATTTATCGATTTAAAGGGGGC
back to top

protein sequence of SMED30014980-orf-1

>SMED30014980-orf-1 ID=SMED30014980-orf-1|Name=SMED30014980-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=618bp
MSGRSRKTRTSQQAESNTREEISIGDSDEDIMTTTTTTKRVVLSKSMGED
KPTATSTPSHKESHSRSFRAASPLTISRNEEKDELAHLNDRFASYIDYVR
SLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERA
NIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSER
YSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLY
NEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKL
EFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTS
ENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSS
LMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKV
GERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLIN
PTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDANETHN
PPSDLVMKGQRFFSGSNIKINLTNADNQEEANCVLAKEHTRSSVYNYNRK
VAARSLRTGEESKCSMM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000016pharynx
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039008IF_rod_dom
IPR042180IF_rod_dom_coil1B
IPR036415Lamin_tail_dom_sf
IPR001664IF
IPR001322Lamin_tail_dom
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 338..397
NoneNo IPR availableCOILSCoilCoilcoord: 310..330
NoneNo IPR availableCOILSCoilCoilcoord: 99..119
NoneNo IPR availableCOILSCoilCoilcoord: 281..301
NoneNo IPR availableCOILSCoilCoilcoord: 128..204
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 342..426
e-value: 1.9E-15
score: 59.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..76
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 28..61
NoneNo IPR availablePANTHERPTHR45721FAMILY NOT NAMEDcoord: 50..593
NoneNo IPR availablePANTHERPTHR45721:SF11LAMIN DM0-RELATEDcoord: 50..593
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 353..425
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 79..114
IPR039008Intermediate filament, rod domainSMARTSM01391Filament_2coord: 80..425
e-value: 2.2E-22
score: 90.4
IPR039008Intermediate filament, rod domainPFAMPF00038Filamentcoord: 80..425
e-value: 1.2E-50
score: 172.9
IPR039008Intermediate filament, rod domainPROSITEPS51842IF_ROD_2coord: 81..426
score: 22.221
IPR001322Lamin tail domainPFAMPF00932LTDcoord: 488..579
e-value: 1.1E-11
score: 45.1
IPR001322Lamin tail domainPROSITEPS51841LTDcoord: 479..608
score: 16.756
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 76..170
e-value: 8.8E-21
score: 76.3
IPR036415Lamin tail domain superfamilyGENE3DG3DSA:2.60.40.1260coord: 435..593
e-value: 5.4E-34
score: 118.9
IPR036415Lamin tail domain superfamilySUPERFAMILYSSF74853Lamin A/C globular tail domaincoord: 471..590