Protein bicaudal D

Overview
NameProtein bicaudal D
Smed IDSMED30014979
Length (bp)3196
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein bicaudal D (SMED30014979) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein bicaudal D (SMED30014979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein bicaudal D (SMED30014979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein bicaudal D (SMED30014979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30014979h1SMcG0020197 Contig44384uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014979h1SMcG0020197 Contig44384newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014979h1SMcG0020197 Contig39518uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014979h1SMcG0020197 Contig39518newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30014979h1SMcG0020197 dd_Smed_v4_758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014979h1SMcG0020197 dd_Smed_v4_758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014979h1SMcG0020197 dd_Smed_v4_758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014979h1SMcG0020197 dd_Smed_v4_758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014979h1SMcG0020197 dd_Smed_v4_758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein bicaudal D vs. Ensembl Human
Match: BICD1 (BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:1049])

HSP 1 Score: 179.104 bits (453), Expect = 1.603e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 111.694 bits (278), Expect = 2.878e-24
Identity = 84/253 (33.20%), Postives = 148/253 (58.50%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN 761
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  K+   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + + +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   I+
Sbjct:    7 LQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDLKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYIS 257          
BLAST of Protein bicaudal D vs. Ensembl Human
Match: BICD1 (BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:1049])

HSP 1 Score: 179.104 bits (453), Expect = 1.603e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 111.694 bits (278), Expect = 2.878e-24
Identity = 84/253 (33.20%), Postives = 148/253 (58.50%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN 761
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  K+   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + + +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   I+
Sbjct:    7 LQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDLKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYIS 257          
BLAST of Protein bicaudal D vs. Ensembl Human
Match: BICD1 (BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:1049])

HSP 1 Score: 178.718 bits (452), Expect = 1.968e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 111.309 bits (277), Expect = 3.071e-24
Identity = 84/253 (33.20%), Postives = 148/253 (58.50%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN 761
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  K+   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + + +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   I+
Sbjct:    7 LQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDLKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYIS 257          
BLAST of Protein bicaudal D vs. Ensembl Human
Match: BICD1 (BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:1049])

HSP 1 Score: 179.104 bits (453), Expect = 3.271e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 113.235 bits (282), Expect = 9.326e-25
Identity = 84/253 (33.20%), Postives = 148/253 (58.50%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN 761
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  K+   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + + +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   I+
Sbjct:    7 LQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDLKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYIS 257          
BLAST of Protein bicaudal D vs. Ensembl Human
Match: BICD2 (BICD cargo adaptor 2 [Source:HGNC Symbol;Acc:HGNC:17208])

HSP 1 Score: 176.022 bits (445), Expect = 1.461e-44
Identity = 101/135 (74.81%), Postives = 121/135 (89.63%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEY+TQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE +E+D E++
Sbjct:  672 LMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQT 806          

HSP 2 Score: 117.857 bits (294), Expect = 3.503e-26
Identity = 83/258 (32.17%), Postives = 149/258 (57.75%), Query Frame = 3
Query:   21 EILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIH 794
            E L+ EV  L  EL     +K  AA++GL +LE+   L+ +    E     ++ E+E  K+   +     +K +  G   E+ L+ ++ + E     ++ +L+ E++ L++       E+++L     E +E     E  R  L++++K  K +E +++ D S+L EEN+ LQK +  L++ QVEFEG+KHE+KR +EE + L+SQLE+  +L +I+ + LE ALE+L+ EREQK + +KEL + ++ +  +  S++H
Sbjct:   20 EWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLH 277          
BLAST of Protein bicaudal D vs. Ensembl Celegans
Match: bicd-1 (Protein bicaudal D homolog [Source:UniProtKB/Swiss-Prot;Acc:V6CJ04])

HSP 1 Score: 136.732 bits (343), Expect = 1.152e-32
Identity = 88/184 (47.83%), Postives = 128/184 (69.57%), Query Frame = 3
Query: 1752 NIVSHLKSSLSTLIAIVHQL--QKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQ 2297
            N +S    SL  +I +V +   Q F ++  A+             E++ Q +KL+S+L+TKRDQI+TLR VL++NK TAE+AL ++++KYE+EK ++ +   K+R ELK LKEDAATFAS RAMF  R +E  ++++EL  +L+A E+EK+T+N LLR+AI QKL LTQRLE+VE+DR+R   Q
Sbjct:  514 NAISETTESLKKMIQVVKRTSEQAFNQAVMASG---------AENEIEMQNMKLRSLLSTKRDQISTLRTVLKSNKLTAESALTSMREKYESEKKMMMEINDKMRRELKQLKEDAATFASHRAMFTARGEELKSKVEELSNELRANEEEKKTLNQLLRLAIQQKLTLTQRLEEVEVDRDRQTYQ 688          

HSP 2 Score: 74.3294 bits (181), Expect = 2.810e-13
Identity = 79/261 (30.27%), Postives = 141/261 (54.02%), Query Frame = 3
Query:   12 STIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKD-AEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNI 791
            S +E L+ ++A L  + ++A E  + AA  GL LL   E+L K++   +  ++  + EI+   +  AE +S+  R        EE  L   +   E  L +RI  LE +++  +     + EE + + ++ +++ +     E+ RR+L+ E+K  K +E ++I + S+L EEN+ LQK +  L+ +QVE+E ++ +  R +E  +I+    EE   L  I  K LE AL + Q ER+Q+ A K+ELE   NA+    L+++
Sbjct:    4 SELEKLRQDIAILTEKYEQAKEDIHKAANAGLELLRQKEDLEKRLAEMQAELDLARTEIDKTNQTLAEYRSQHQRSTRSELENEESLLEESSAKEEEYL-QRIAKLEADLKKKEQELAEKKEELESIEKKHSKEIDSGAALEDERRKLRAELKETKEREQRLISEYSELEEENIGLQKTVANLRGSQVEYESLRIDNNRLEETIEIMKMAAEEDEILRVIADKQLEEALLTAQQERDQRLAMKRELEQTRNAEHISSLNDM 263          
BLAST of Protein bicaudal D vs. Ensembl Celegans
Match: bicd-1 (Protein bicaudal D homolog [Source:UniProtKB/Swiss-Prot;Acc:V6CJ04])

HSP 1 Score: 135.576 bits (340), Expect = 2.728e-32
Identity = 87/180 (48.33%), Postives = 127/180 (70.56%), Query Frame = 3
Query: 1752 NIVSHLKSSLSTLIAIVHQL--QKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRER 2285
            N +S    SL  +I +V +   Q F ++  A+             E++ Q +KL+S+L+TKRDQI+TLR VL++NK TAE+AL ++++KYE+EK ++ +   K+R ELK LKEDAATFAS RAMF  R +E  ++++EL  +L+A E+EK+T+N LLR+AI QKL LTQRLE+VE+DR+R
Sbjct:  514 NAISETTESLKKMIQVVKRTSEQAFNQAVMASG---------AENEIEMQNMKLRSLLSTKRDQISTLRTVLKSNKLTAESALTSMREKYESEKKMMMEINDKMRRELKQLKEDAATFASHRAMFTARGEELKSKVEELSNELRANEEEKKTLNQLLRLAIQQKLTLTQRLEEVEVDRDR 684          

HSP 2 Score: 74.7146 bits (182), Expect = 2.222e-13
Identity = 79/261 (30.27%), Postives = 141/261 (54.02%), Query Frame = 3
Query:   12 STIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKD-AEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNI 791
            S +E L+ ++A L  + ++A E  + AA  GL LL   E+L K++   +  ++  + EI+   +  AE +S+  R        EE  L   +   E  L +RI  LE +++  +     + EE + + ++ +++ +     E+ RR+L+ E+K  K +E ++I + S+L EEN+ LQK +  L+ +QVE+E ++ +  R +E  +I+    EE   L  I  K LE AL + Q ER+Q+ A K+ELE   NA+    L+++
Sbjct:    4 SELEKLRQDIAILTEKYEQAKEDIHKAANAGLELLRQKEDLEKRLAEMQAELDLARTEIDKTNQTLAEYRSQHQRSTRSELENEESLLEESSAKEEEYL-QRIAKLEADLKKKEQELAEKKEELESIEKKHSKEIDSGAALEDERRKLRAELKETKEREQRLISEYSELEEENIGLQKTVANLRGSQVEYESLRIDNNRLEETIEIMKMAAEEDEILRVIADKQLEEALLTAQQERDQRLAMKRELEQTRNAEHISSLNDM 263          
BLAST of Protein bicaudal D vs. Ensembl Fly
Match: BicD (gene:FBgn0000183 transcript:FBtr0081002)

HSP 1 Score: 298.13 bits (762), Expect = 7.560e-87
Identity = 264/781 (33.80%), Postives = 440/781 (56.34%), Query Frame = 3
Query:   15 TIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAE-NSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDA--MDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQ---HLLSEVGLSTRSMKXXXXXXXXXXXX----ICAVIKETPSKVMAD------IIGNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQ 2309
            +++ L+ EV  L  ELD+ +     +A++GL+LLE+   L++K    E   ++ ++E+++ ++   +     +  +  G ++ED LL ++   E  L  +I DLE E++ L+   +R   E D+++Q+ ++   +    E  R  LK+E+K LK +ET+M+ + S+L EEN+ LQK +  L+ +QVEFEG KHE++R  EE ++L+ Q++E+  L +I  K +E ALE+LQ ERE KYA KKEL+  +N +S Y +SN+   IR   E N++ NS G +   +NL     L  +  +L+ +   ++S D    DLFSE+   ++ ++   ++ M+ E+      ++E +  L+K Q E       +  L + ++ +    K  ID      E   + + L++           ++R  + Q  + + +  K++  ++ ++       N   +  +   L+ E+        N++ +L ++++  + L ++ Q   H+    G S  S +S+L  L+         +C V  ETP++V+ D         N  L +   I  +   D  ++       +       E+ K V+   + + +LK+++   I     + K K  S    D    +N+ E EELQ Q+VKLKS+L+ KR+QI TLRNVL++NK TAE AL NLK KYENEK++V+DTM KLR EL+ LKEDAATF+SLRAMFA RC+EYVTQ+D+L +QL+AAE+EK+T+N LLR+A+ QKLALTQRLE++EMDRE   M+H ++
Sbjct:   14 SVQDLQMEVERLTRELDQVSSASAQSAQYGLSLLEEKSALQQKCEELETLYDNTRHELDITQEALTKFQTSQKVTNKTGIEQEDALLNESAARETSLNLQIFDLENELKQLRHELERVRNERDRMLQENSDFGRDKSDSEADRLRLKSELKDLKFRETRMLSEYSELEEENISLQKQVSSLRSSQVEFEGAKHEIRRLTEEVELLNQQVDELANLKKIAEKQMEEALETLQGEREAKYALKKELDGHLNRESMYHISNLAYSIRSNMEDNASNNSDGEE---ENL----ALKRLEADLSTE---LKSPDGTKCDLFSEIHLNELKKLEKQLESMESEKTHLTANLREAQTSLDKSQNELQNFMSRLALLAAHVDALVQLKK-QIDVKEQGKEGGQKKDELEQ-----------QLRALISQYANWFTLSAKEIDGLKTDIAELQKGLNYTDATTT---LRNEVT-------NLKNKLLATEQKSLDLQSDVQTLTHISQNAGQSLGSARSTLVALSDDLAQLYHLVCTVNGETPTRVLLDHKTDDMSFENDSLTA---IQSQFKSDVFIAKPQIVEDLQGLADSVEIKKYVDTVSDQIKYLKTAVEHTI----DMNKHKIRSEG-GDALEKVNTEEMEELQEQIVKLKSLLSVKREQIGTLRNVLKSNKQTAEVALTNLKSKYENEKIIVSDTMSKLRNELRLLKEDAATFSSLRAMFAARCEEYVTQVDDLNRQLEAAEEEKKTLNQLLRLAVQQKLALTQRLEEMEMDRE---MRHVRR 751          
BLAST of Protein bicaudal D vs. Ensembl Fly
Match: BicD (gene:FBgn0000183 transcript:FBtr0330225)

HSP 1 Score: 298.13 bits (762), Expect = 7.560e-87
Identity = 264/781 (33.80%), Postives = 440/781 (56.34%), Query Frame = 3
Query:   15 TIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAE-NSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDA--MDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQ---HLLSEVGLSTRSMKXXXXXXXXXXXX----ICAVIKETPSKVMAD------IIGNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQ 2309
            +++ L+ EV  L  ELD+ +     +A++GL+LLE+   L++K    E   ++ ++E+++ ++   +     +  +  G ++ED LL ++   E  L  +I DLE E++ L+   +R   E D+++Q+ ++   +    E  R  LK+E+K LK +ET+M+ + S+L EEN+ LQK +  L+ +QVEFEG KHE++R  EE ++L+ Q++E+  L +I  K +E ALE+LQ ERE KYA KKEL+  +N +S Y +SN+   IR   E N++ NS G +   +NL     L  +  +L+ +   ++S D    DLFSE+   ++ ++   ++ M+ E+      ++E +  L+K Q E       +  L + ++ +    K  ID      E   + + L++           ++R  + Q  + + +  K++  ++ ++       N   +  +   L+ E+        N++ +L ++++  + L ++ Q   H+    G S  S +S+L  L+         +C V  ETP++V+ D         N  L +   I  +   D  ++       +       E+ K V+   + + +LK+++   I     + K K  S    D    +N+ E EELQ Q+VKLKS+L+ KR+QI TLRNVL++NK TAE AL NLK KYENEK++V+DTM KLR EL+ LKEDAATF+SLRAMFA RC+EYVTQ+D+L +QL+AAE+EK+T+N LLR+A+ QKLALTQRLE++EMDRE   M+H ++
Sbjct:   14 SVQDLQMEVERLTRELDQVSSASAQSAQYGLSLLEEKSALQQKCEELETLYDNTRHELDITQEALTKFQTSQKVTNKTGIEQEDALLNESAARETSLNLQIFDLENELKQLRHELERVRNERDRMLQENSDFGRDKSDSEADRLRLKSELKDLKFRETRMLSEYSELEEENISLQKQVSSLRSSQVEFEGAKHEIRRLTEEVELLNQQVDELANLKKIAEKQMEEALETLQGEREAKYALKKELDGHLNRESMYHISNLAYSIRSNMEDNASNNSDGEE---ENL----ALKRLEADLSTE---LKSPDGTKCDLFSEIHLNELKKLEKQLESMESEKTHLTANLREAQTSLDKSQNELQNFMSRLALLAAHVDALVQLKK-QIDVKEQGKEGGQKKDELEQ-----------QLRALISQYANWFTLSAKEIDGLKTDIAELQKGLNYTDATTT---LRNEVT-------NLKNKLLATEQKSLDLQSDVQTLTHISQNAGQSLGSARSTLVALSDDLAQLYHLVCTVNGETPTRVLLDHKTDDMSFENDSLTA---IQSQFKSDVFIAKPQIVEDLQGLADSVEIKKYVDTVSDQIKYLKTAVEHTI----DMNKHKIRSEG-GDALEKVNTEEMEELQEQIVKLKSLLSVKREQIGTLRNVLKSNKQTAEVALTNLKSKYENEKIIVSDTMSKLRNELRLLKEDAATFSSLRAMFAARCEEYVTQVDDLNRQLEAAEEEKKTLNQLLRLAVQQKLALTQRLEEMEMDRE---MRHVRR 751          
BLAST of Protein bicaudal D vs. Ensembl Fly
Match: BicD (gene:FBgn0000183 transcript:FBtr0330226)

HSP 1 Score: 297.36 bits (760), Expect = 2.080e-86
Identity = 264/781 (33.80%), Postives = 440/781 (56.34%), Query Frame = 3
Query:   15 TIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAE-NSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDA--MDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQ---HLLSEVGLSTRSMKXXXXXXXXXXXX----ICAVIKETPSKVMAD------IIGNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQ 2309
            +++ L+ EV  L  ELD+ +     +A++GL+LLE+   L++K    E   ++ ++E+++ ++   +     +  +  G ++ED LL ++   E  L  +I DLE E++ L+   +R   E D+++Q+ ++   +    E  R  LK+E+K LK +ET+M+ + S+L EEN+ LQK +  L+ +QVEFEG KHE++R  EE ++L+ Q++E+  L +I  K +E ALE+LQ ERE KYA KKEL+  +N +S Y +SN+   IR   E N++ NS G +   +NL     L  +  +L+ +   ++S D    DLFSE+   ++ ++   ++ M+ E+      ++E +  L+K Q E       +  L + ++ +    K  ID      E   + + L++           ++R  + Q  + + +  K++  ++ ++       N   +  +   L+ E+        N++ +L ++++  + L ++ Q   H+    G S  S +S+L  L+         +C V  ETP++V+ D         N  L +   I  +   D  ++       +       E+ K V+   + + +LK+++   I     + K K  S    D    +N+ E EELQ Q+VKLKS+L+ KR+QI TLRNVL++NK TAE AL NLK KYENEK++V+DTM KLR EL+ LKEDAATF+SLRAMFA RC+EYVTQ+D+L +QL+AAE+EK+T+N LLR+A+ QKLALTQRLE++EMDRE   M+H ++
Sbjct:   14 SVQDLQMEVERLTRELDQVSSASAQSAQYGLSLLEEKSALQQKCEELETLYDNTRHELDITQEALTKFQTSQKVTNKTGIEQEDALLNESAARETSLNLQIFDLENELKQLRHELERVRNERDRMLQENSDFGRDKSDSEADRLRLKSELKDLKFRETRMLSEYSELEEENISLQKQVSSLRSSQVEFEGAKHEIRRLTEEVELLNQQVDELANLKKIAEKQMEEALETLQGEREAKYALKKELDGHLNRESMYHISNLAYSIRSNMEDNASNNSDGEE---ENL----ALKRLEADLSTE---LKSPDGTKCDLFSEIHLNELKKLEKQLESMESEKTHLTANLREAQTSLDKSQNELQNFMSRLALLAAHVDALVQLKK-QIDVKEQGKEGGQKKDELEQ-----------QLRALISQYANWFTLSAKEIDGLKTDIAELQKGLNYTDATTT---LRNEVT-------NLKNKLLATEQKSLDLQSDVQTLTHISQNAGQSLGSARSTLVALSDDLAQLYHLVCTVNGETPTRVLLDHKTDDMSFENDSLTA---IQSQFKSDVFIAKPQIVEDLQGLADSVEIKKYVDTVSDQIKYLKTAVEHTI----DMNKHKIRSEG-GDALEKVNTEEMEELQEQIVKLKSLLSVKREQIGTLRNVLKSNKQTAEVALTNLKSKYENEKIIVSDTMSKLRNELRLLKEDAATFSSLRAMFAARCEEYVTQVDDLNRQLEAAEEEKKTLNQLLRLAVQQKLALTQRLEEMEMDRE---MRHVRR 751          
BLAST of Protein bicaudal D vs. Ensembl Fly
Match: BicD (gene:FBgn0000183 transcript:FBtr0305688)

HSP 1 Score: 293.893 bits (751), Expect = 1.167e-85
Identity = 261/771 (33.85%), Postives = 434/771 (56.29%), Query Frame = 3
Query:   15 TIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAE-NSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDA--MDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQ---HLLSEVGLSTRSMKXXXXXXXXXXXX----ICAVIKETPSKVMAD------IIGNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDR 2279
            +++ L+ EV  L  ELD+ +     +A++GL+LLE+   L++K    E   ++ ++E+++ ++   +     +  +  G ++ED LL ++   E  L  +I DLE E++ L+   +R   E D+++Q+ ++   +    E  R  LK+E+K LK +ET+M+ + S+L EEN+ LQK +  L+ +QVEFEG KHE++R  EE ++L+ Q++E+  L +I  K +E ALE+LQ ERE KYA KKEL+  +N +S Y +SN+   IR   E N++ NS G +   +NL     L  +  +L+ +   ++S D    DLFSE+   ++ ++   ++ M+ E+      ++E +  L+K Q E       +  L + ++ +    K  ID      E   + + L++           ++R  + Q  + + +  K++  ++ ++       N   +  +   L+ E+        N++ +L ++++  + L ++ Q   H+    G S  S +S+L  L+         +C V  ETP++V+ D         N  L +   I  +   D  ++       +       E+ K V+   + + +LK+++   I     + K K  S    D    +N+ E EELQ Q+VKLKS+L+ KR+QI TLRNVL++NK TAE AL NLK KYENEK++V+DTM KLR EL+ LKEDAATF+SLRAMFA RC+EYVTQ+D+L +QL+AAE+EK+T+N LLR+A+ QKLALTQRLE++EMDR
Sbjct:   14 SVQDLQMEVERLTRELDQVSSASAQSAQYGLSLLEEKSALQQKCEELETLYDNTRHELDITQEALTKFQTSQKVTNKTGIEQEDALLNESAARETSLNLQIFDLENELKQLRHELERVRNERDRMLQENSDFGRDKSDSEADRLRLKSELKDLKFRETRMLSEYSELEEENISLQKQVSSLRSSQVEFEGAKHEIRRLTEEVELLNQQVDELANLKKIAEKQMEEALETLQGEREAKYALKKELDGHLNRESMYHISNLAYSIRSNMEDNASNNSDGEE---ENL----ALKRLEADLSTE---LKSPDGTKCDLFSEIHLNELKKLEKQLESMESEKTHLTANLREAQTSLDKSQNELQNFMSRLALLAAHVDALVQLKK-QIDVKEQGKEGGQKKDELEQ-----------QLRALISQYANWFTLSAKEIDGLKTDIAELQKGLNYTDATTT---LRNEVT-------NLKNKLLATEQKSLDLQSDVQTLTHISQNAGQSLGSARSTLVALSDDLAQLYHLVCTVNGETPTRVLLDHKTDDMSFENDSLTA---IQSQFKSDVFIAKPQIVEDLQGLADSVEIKKYVDTVSDQIKYLKTAVEHTI----DMNKHKIRSEG-GDALEKVNTEEMEELQEQIVKLKSLLSVKREQIGTLRNVLKSNKQTAEVALTNLKSKYENEKIIVSDTMSKLRNELRLLKEDAATFSSLRAMFAARCEEYVTQVDDLNRQLEAAEEEKKTLNQLLRLAVQQKLALTQRLEEMEMDR 744          
BLAST of Protein bicaudal D vs. Ensembl Zebrafish
Match: bicd1a (bicaudal D homolog 1a [Source:ZFIN;Acc:ZDB-GENE-081031-9])

HSP 1 Score: 270.011 bits (689), Expect = 2.581e-76
Identity = 266/810 (32.84%), Postives = 425/810 (52.47%), Query Frame = 3
Query:   15 TIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKI---NADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNV--GLELTNQKHIIESE--DAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEE----ELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRS----------MKXXXXXXXXXXXXICAVIKETPSKVMAD--------------------------IIGNLGLVSREDISRKDSPDDXXXXX---XXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNM 2294
            +++  + EV  L  EL  AN +K  AA+ GL +LE+N+ L+ +    E     LK E+E  ++   +     RK +  G   E+ LL ++ + E     R+ DL+ +++   S       E++ L   + E  E   T E  R  ++ E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+K  +EE  +L+SQLE+  +L  I+   LE AL+SL+ EREQK   +KEL + +   +  ++  +S +   ++ A E +   +  N       +DSN  +N   G     + H  ++E     DLFSEL  +++ ++   + +++ E+   +  ++E +  L+  Q   T+    +  L    E +    +L  D   D  ES      ++     E   +I      ++ LE +Y+V + ++  ++ ELK    + N     QSEE    E K + + +QV+        KS +E    +S+    L    G+++ S          + +    LA LY  +C    ETP++VM D                          +   L  V+  D+S++ SP+ +           S  +     +L +E  N +N+ + ++  +  L   V +  +      A  + +  ++  +   ++ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+S+ 
Sbjct:   10 SVDQYRSEVERLTRELAEANREKIRAAECGLVVLEENQKLKHQYAELEIEQEALKQELEQLQEAFGQAYTNQRKVAEDGETNEETLLQESASKEAYYMGRLDDLQSQLKVSSSAASNAQAETEHLNALMQELRENNETLELQRSRMREEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKVLEEETVLLNSQLEDALRLKDISQGQLEEALDSLKSEREQKNNLRKELAHHLSLTDTSTHLAISAVEG-LKFAEEAATNGTPNN-------EDSNRCNNECNGHGPKGEYHRRKTEMLPVSDLFSELNLSEIQKLKQQLIQVEREKAILLTNLQESQTQLQHTQGALTEQHRRVHRLT---ERVNAMKRLHNDKEFDTEESEKGDGPINGCC--EFETDI----NGIELLECKYRVAVTEVIDLKAELKVLKEKYNQSLESQSEESNHSEGKVQALEEQVKQLE-----KSCREARERVSSLEAELRCASGMASESNGMLNAAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSGSLKGPEDPRALLSPRLARRLAAVNSSDMSKRGSPNRTPFGSPINGSSLSSSTIPETGDLRREPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAAARELAPILDKDKEACME-EILKLKSLLSTKREQIATLRLVLKANKQTAEVALANLKSKYENEKCMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQSHC 796          
BLAST of Protein bicaudal D vs. Ensembl Zebrafish
Match: BICD2 (zgc:171572 [Source:NCBI gene;Acc:100330881])

HSP 1 Score: 254.603 bits (649), Expect = 9.862e-72
Identity = 231/691 (33.43%), Postives = 365/691 (52.82%), Query Frame = 3
Query:  315 IRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQ--LSNIHNDIRLAAENSARNSAGNQLSV-----QNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEE--ELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXX-------ICAVIKETPSKVMAD--------IIGNL--GLVSREDISRKDS--------PDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRE 2282
            +++L+ E+R  ++       E+++L     E  E     E  R  L++++K  K +E +++ D S+L EEN+ LQKH+  LK++QVEFEG+KHE++R +E+   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL   ++ +DS Y   LS   + ++ + + S   +    L V     + + D NN + V     ++     S    +L +EL  +++ ++   + +++ E++  +  ++E +  LE+     ++  E +G L   L  I          S   NE    S    ++   ++ G  +        L+ +YKV + + S ++ ELK      +  QS   EE  +L+ ++     +L ++    +S +E L  L    +      G S  S+  +   LA            +C    ETP+++M D        + G    G  S +   R+          P    S               +  KE  N +N+V+ ++  +  L   V +  +      A+ +     +  +   ++ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E
Sbjct:    1 MQELQAELRQTRTILTNVQSENERLATITQELRENSQMVELQRSRLRDDIKEFKFRECRLLQDYSELEEENITLQKHVSVLKQSQVEFEGLKHEIRRLEEDTQFLNSQLEDAIRLKEIAERQLGEALETIKTEREQKAALRKELSQYMSISDSMYHSPLSISLDGLKFSDDASIEPNNDEPLHVYENGFEKITD-NNDNRVSTPKKSELFQPSSSLVDNLLNELNISEIQKLKQQLLQVEREKVTLLSTLQESQKQLEQANGALSEEHEKVGRLTENLNAIRKLQANKERQSALDNEKERDSHEDSEYYEVDINGPEI--------LQCKYKVAVSEASQLKEELKTLKAEHSACQSQYQEERAQLESQVASLNAQLTSLERSSRSEREQLARLEKELRQASEVAGESQGSLNIAQDELATFSEELANLYHHVCMCNNETPNRIMLDYYREGKSGVNGTQTNGWCSPDGRGRRSPILLTRGLFPTAESSDGTSSPISSIPSPVADPRKEPMNIYNLVAIIRDQIRHLQLAVDRTTELSRQRMASLELGLGADREQEASVE-EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHE 681          
BLAST of Protein bicaudal D vs. Ensembl Zebrafish
Match: BICD2 (zgc:171572 [Source:NCBI gene;Acc:100330881])

HSP 1 Score: 253.447 bits (646), Expect = 1.732e-71
Identity = 222/649 (34.21%), Postives = 347/649 (53.47%), Query Frame = 3
Query:  441 RRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQ--LSNIHNDIRLAAENSARNSAGNQLSV-----QNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEE--ELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXX-------ICAVIKETPSKVMADII--GNLGLVSRED----------------ISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRE 2282
            R  L++++K  K +E +++ D S+L EEN+ LQKH+  LK++QVEFEG+KHE++R +E+   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL   ++ +DS Y   LS   + ++ + + S   +    L V     + + D NN + V     ++     S    +L +EL  +++ ++   + +++ E++  +  ++E +  LE+     ++  E +G L   L  I          S   NE    S    ++   ++ G  +        L+ +YKV + + S ++ ELK      +  QS   EE  +L+ ++     +L ++    +S +E L  L    +      G S  S+  +   LA            +C    ETP+++M D    G  G+   +                 ++R   P    S               +  KE  N +N+V+ ++  +  L   V +  +      A+ +     +  +   ++ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E
Sbjct:   43 RSRLRDDIKEFKFRECRLLQDYSELEEENITLQKHVSVLKQSQVEFEGLKHEIRRLEEDTQFLNSQLEDAIRLKEIAERQLGEALETIKTEREQKAALRKELSQYMSISDSMYHSPLSISLDGLKFSDDASIEPNNDEPLHVYENGFEKITD-NNDNRVSTPKKSELFQPSSSLVDNLLNELNISEIQKLKQQLLQVEREKVTLLSTLQESQKQLEQANGALSEEHEKVGRLTENLNAIRKLQANKERQSALDNEKERDSHEDSEYYEVDINGPEI--------LQCKYKVAVSEASQLKEELKTLKAEHSACQSQYQEERAQLESQVASLNAQLTSLERSSRSEREQLARLEKELRQASEVAGESQGSLNIAQDELATFSEELANLYHHVCMCNNETPNRIMLDYYREGKSGVNGTQTNGWCSPDGRGRRSPILLTRGLFPTAESSDGTSSPISSIPSPVADPRKEPMNIYNLVAIIRDQIRHLQLAVDRTTELSRQRMASLELGLGADREQEASVE-EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHE 681          
BLAST of Protein bicaudal D vs. Ensembl Zebrafish
Match: CR854830.1 (bicaudal D homolog 1a [Source:NCBI gene;Acc:556758])

HSP 1 Score: 253.832 bits (647), Expect = 6.883e-71
Identity = 247/736 (33.56%), Postives = 386/736 (52.45%), Query Frame = 3
Query:  231 RKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNV----GLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEE----ELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRS----------MKXXXXXXXXXXXXICAVIKETPSKVMAD--------------------------IIGNLGLVSREDISRKDSPDDXXXXXX---XXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNM 2294
            RK +  G   E+ LL ++ + E     R+ DL+ +++   S       E++ L   + E  E   T E  R  ++ E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+K  +EE  +L+SQLE+  +L  I+   LE AL+SL+ EREQK   +KEL + ++  D+   L+    +    AE +A N   N       +DSN  +N     G +    +   E     DLFSEL  +++ ++   + +++ E+   +  ++E +  L+  Q   T+    +  L    E +    +L  D   D  ES      ++     E   +I      ++ LE +Y+V + ++  ++ ELK    + N     QSEE    E K + + +QV+        KS +E    +S+    L    G+++ S          + +    LA LY  +C    ETP++VM D                          +   L  V+  D+S++ SP+ +           S  +     +L +E  N +N+ + ++  +  L   V +  +      A  + +  ++  +   ++ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+S+ 
Sbjct:   61 RKVAEDGETNEETLLQESASKEAYYMGRLDDLQSQLKVSSSAASNAQAETEHLNALMQELRENNETLELQRSRMREEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKVLEEETVLLNSQLEDALRLKDISQGQLEEALDSLKSEREQKNNLRKELAHHLSLTDTSTHLAISAVEGLKFAEEAATNGTPNN------EDSNRCNNECNGHGPKGEYHRRKTEMLPVSDLFSELNLSEIQKLKQQLIQVEREKAILLTNLQESQTQLQHTQGALTEQHRRVHRLT---ERVNAMKRLHNDKEFDTEESEKGDGPINGCC--EFETDI----NGIELLECKYRVAVTEVIDLKAELKVLKEKYNQSLESQSEESNHSEGKVQALEEQVKQLE-----KSCREARERVSSLEAELRCASGMASESNGMLNAAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSGSLKGPEDPRALLSPRLARRLAAVNSSDMSKRGSPNRTPFGSPINGSSLSSSTIPETGDLRREPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAAARELAPILDKDKEACME-EILKLKSLLSTKREQIATLRLVLKANKQTAEVALANLKSKYENEKCMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQSHC 775          
BLAST of Protein bicaudal D vs. Ensembl Zebrafish
Match: bicd2 (bicaudal D homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-120717-1])

HSP 1 Score: 181.8 bits (460), Expect = 1.514e-46
Identity = 112/188 (59.57%), Postives = 137/188 (72.87%), Query Frame = 3
Query: 1893 QLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQMQQVLRSNNNNFRXXXXXXXXXXXXXQNSVNGVMINPAPPGIIGNAPFF 2456
            +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLD++Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+S            ++ +   R     SS  ++      N     P P G+IG+   F
Sbjct:  649 EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDDMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDNEQSRRGSGAGPGGRGKAPSGRGRGPLSFSSPHVSPRLPCKN----RPQPHGLIGSPAVF 832          

HSP 2 Score: 114.775 bits (286), Expect = 1.803e-25
Identity = 77/240 (32.08%), Postives = 142/240 (59.17%), Query Frame = 3
Query:   27 LKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKEL 746
            L+ E+  L  EL   + +K  AA++GL +LE+N+ L+++    E     ++ E++  ++   +     RK +  G   E+ L++++ + E   ++R+++L+ ++R  K+       E+++L     E  E     E  R  L+++++  K +E++++ D ++L EEN+ LQK +  LK+ QVEFEG+KHE +R +EE   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL
Sbjct:   22 LRAEIERLSRELSETSREKIQAAEYGLVVLEENQQLKQRFEELESEYETVRQELDQLREAYGQVHSTHRKVAADGESREESLILESASKEAYYEQRVQELQSDLRQAKNTLTGTQAENERLATLALELRENNEIVELQRSRLRDDIREYKIRESRLLQDYTELEEENISLQKQVSTLKQGQVEFEGLKHENRRLEEEVQYLNSQLEDAIRLREIADRQLTEALETVKTEREQKAALRKEL 261          
BLAST of Protein bicaudal D vs. Ensembl Xenopus
Match: ENSXETT00000024155.1 (FYVE, RhoGEF and PH domain containing 3 [Source:NCBI gene;Acc:100490625])

HSP 1 Score: 273.863 bits (699), Expect = 2.456e-77
Identity = 266/817 (32.56%), Postives = 420/817 (51.41%), Query Frame = 3
Query:   12 STIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINA-DSYY--QLSNIHNDIRLAAENSARNS-----AGNQLSVQNLDDSNNLDNVG-LELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELK------------------RYH----------------TRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSS----KEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII--GNLGLVSREDISRKDSP---------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            S  E L+ EV  L  EL   + +K  AA++GL +LE+ + L+++    E      + E+E  K+   +     +K +  G   E+ L+ ++   E    +++ +L+ E++  K+     L E+++L     E  E     E  R  L++++K  K +E +++ D ++L EEN+ LQK +  LK+ QVEFEG+KHE+KR +EE + L+SQLE+  +L +I+ + +E ALE+L+ EREQK   +KEL N +N  DS Y   L+   + ++ + E S  N+           V  L+  N +     LE  N    + S    DL SEL  +++ ++   + +++ E++  +  ++E +  LE  +   ++  + +  L   L  +          S   NE    S     +   ++ G  +        LE +YKV + ++  ++ ELK                  RY                 TR + DQ  + E+ELK+        + ++ GE + S    +++LV+ S    +L   V                     C    ETP++VM D    G  G  S E   R+ SP          ++  ++ G  +        +L +E  N +N+V+ ++  +  L A V +  +      A+ +   +++      L   ++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE +E+D E++
Sbjct:   18 SGPEWLRAEVRRLVRELAETSREKIQAAEYGLAVLEEKQQLKQQYEELEGECETARQELEQLKEAFGQAHSNHKKVAADGESREETLIQESATKEEYYMKKVLELQTELKLSKNVVANTLSENERLNSVAQELRELNQNIEVQRGRLRDDIKECKFREARLLQDYTELEEENISLQKQVSVLKQNQVEFEGLKHEIKRLEEETEFLNSQLEDAIRLKEISERQMEEALETLKSEREQKNNLRKELSNYMNINDSMYSNHLNLSLDGLKFSDETSEPNNDDVMNGYEHNGVIRLNGDNKMSTPKKLETGNPAPSLVS----DLLSELNISEIQKLKQQLMQVEREKVGLLSTLQESQKQLENTRGALSEQHDKVCRLTENLNAMKKLQATKERQSALDNEKERDSNEDGDYYEVDINGPEI--------LECKYKVAVSEIRDLKEELKSVKAKYEECESKYSEDKNRYESDTQAMTEKISIMEKTTRLDRDQVMRLEKELKK--------VSDVAGETQGSLTVAQDELVTFSEELANLYHHV---------------------CMCNNETPNRVMLDYYKEGKGGRSSPEGRGRR-SPILLSKGLLNSENGHNDPGSPASPLPSPVSDLRREPMNIYNLVAIIRDQIKHLQAAVDRTTELSRQQVASQELGPAVDRDREA-LMEDILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEHLELDHEQT 791          
BLAST of Protein bicaudal D vs. Ensembl Xenopus
Match: ENSXETT00000043549.1 (BICD cargo adaptor 2 like [Source:NCBI gene;Acc:100327237])

HSP 1 Score: 271.552 bits (693), Expect = 2.689e-77
Identity = 268/779 (34.40%), Postives = 420/779 (53.92%), Query Frame = 3
Query:   18 IEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIES-----------EDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELY-----NIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADIIGNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKS------SLSTLIAIVHQLQKFKESS------NATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVE 2270
            I IL+ E+  L +EL      K  AA++GL +LE+N  L++K    +     LK E++  K+   E     ++ +  G   E++LL +  + E +L ++I +L  E++ LKS       E+++L   I   ++E    E  + +L+ E+K  K  E + + D SDL EEN+ L K +  LK+ QVEFEGIKHELKR  EE D+L+  +EE+ +L  I+ + LE ALESL+ EREQK   ++EL   +N DS   + N+H               GN     N ++ ++  N G+  TN + ++ +           + A++LF+EL   ++ ++   + ++D E+   +  ++ LK+ L+      ++ Q+  GEL  Q+  +    K  +D SG   E+      + K   ++   E  R++K +K+L  +Y+           +LK+ +  E  +     +E      V +++ LY     + +G L   +EDL +L  +Y  + S++ L+   + S    LA LY  +C     TP++VM D   + G  S+    ++ S D             +     E S       +I S          S++ LIAIV    K  + +      + + ++ +S    + E L  +++KLKS+L+TKR+QI TLR VL+ANK TAE A++NLK KYENEK +V+DTMVKLR ELKALKEDAATF+SLR++FA RCD+YVTQL+E+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE  E
Sbjct:    6 IVILRAELDRLSAELQETTADKLQAAQYGLAVLEENSELKRKNSDLDSECELLKLELKQMKEALAESQTNHKRTAEDGESREENLLKEAASREAKLSDKIDELHSELKQLKSFRTNTTSENERLHLVIQNIKKEYGETEKEKAKLREEIKQCKISEMRQLQDFSDLEEENISLLKQVSILKENQVEFEGIKHELKRRAEEIDVLNGNVEELMRLRDISERQLEEALESLKSEREQKKELQRELSAFLNYDS---VGNLH---------------GN-FEDHNEEEFDSGYNFGISKTNGEILMSTPRNSDIYHPGPKAALNLFTELNLPEIQKLQQQLLQVDREKASVMADLEGLKNNLDVATEALSKEQKQNGELLEQINAL----KEDLDNSGRKCET-----EVFKCQCKQENTEASRLKKELKELLQQYQ-----------DLKKQYKDEKAEWEASMQE------VTERLSLYMKCERSDQGLLGELQEDLKTLRRSYCDVQSKLNLAQDELMSFTEELAHLYHHVCMRNSLTPNRVMLDYYRD-GKGSKLHFRKRKSSDFFGKLLVSPDMEITEIHSGECSPLSSPASSIGSDCGDSSREPLSITHLIAIVKDQIKHLQGAIVVSWQHTSLESIASEMDKDKEVLVDEIMKLKSLLSTKREQIATLRTVLKANKQTAEVAMSNLKSKYENEKALVSDTMVKLRHELKALKEDAATFSSLRSLFASRCDQYVTQLEEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEGRE 738          
BLAST of Protein bicaudal D vs. Ensembl Xenopus
Match: ENSXETT00000023986.1 (FYVE, RhoGEF and PH domain containing 3 [Source:NCBI gene;Acc:100490625])

HSP 1 Score: 271.937 bits (694), Expect = 5.580e-77
Identity = 266/817 (32.56%), Postives = 420/817 (51.41%), Query Frame = 3
Query:   12 STIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINA-DSYY--QLSNIHNDIRLAAENSARNS-----AGNQLSVQNLDDSNNLDNVG-LELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELK------------------RYH----------------TRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSS----KEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII--GNLGLVSREDISRKDSP---------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            S  E L+ EV  L  EL   + +K  AA++GL +LE+ + L+++    E      + E+E  K+   +     +K +  G   E+ L+ ++   E    +++ +L+ E++  K+     L E+++L     E  E     E  R  L++++K  K +E +++ D ++L EEN+ LQK +  LK+ QVEFEG+KHE+KR +EE + L+SQLE+  +L +I+ + +E ALE+L+ EREQK   +KEL N +N  DS Y   L+   + ++ + E S  N+           V  L+  N +     LE  N    + S    DL SEL  +++ ++   + +++ E++  +  ++E +  LE  +   ++  + +  L   L  +          S   NE    S     +   ++ G  +        LE +YKV + ++  ++ ELK                  RY                 TR + DQ  + E+ELK+        + ++ GE + S    +++LV+ S    +L   V                     C    ETP++VM D    G  G  S E   R+ SP          ++  ++ G  +        +L +E  N +N+V+ ++  +  L A V +  +      A+ +   +++      L   ++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE +E+D E++
Sbjct:   18 SGPEWLRAEVRRLVRELAETSREKIQAAEYGLAVLEEKQQLKQQYEELEGECETARQELEQLKEAFGQAHSNHKKVAADGESREETLIQESATKEEYYMKKVLELQTELKLSKNVVANTLSENERLNSVAQELRELNQNIEVQRGRLRDDIKECKFREARLLQDYTELEEENISLQKQVSVLKQNQVEFEGLKHEIKRLEEETEFLNSQLEDAIRLKEISERQMEEALETLKSEREQKNNLRKELSNYMNINDSMYSNHLNLSLDGLKFSDETSEPNNDDVMNGYEHNGVIRLNGDNKMSTPKKLETGNPAPSLVS----DLLSELNISEIQKLKQQLMQVEREKVGLLSTLQESQKQLENTRGALSEQHDKVCRLTENLNAMKKLQATKERQSALDNEKERDSNEDGDYYEVDINGPEI--------LECKYKVAVSEIRDLKEELKSVKAKYEECESKYSEDKNRYESDTQAMTEKISIMEKTTRLDRDQVMRLEKELKK--------VSDVAGETQGSLTVAQDELVTFSEELANLYHHV---------------------CMCNNETPNRVMLDYYKEGKGGRSSPEGRGRR-SPILLSKGLLNSENGHNDPGSPASPLPSPVSDLRREPMNIYNLVAIIRDQIKHLQAAVDRTTELSRQQVASQELGPAVDRDREA-LMEDILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEHLELDHEQT 791          
BLAST of Protein bicaudal D vs. Ensembl Xenopus
Match: ENSXETT00000023973.1 (FYVE, RhoGEF and PH domain containing 3 [Source:NCBI gene;Acc:100490625])

HSP 1 Score: 270.781 bits (691), Expect = 1.307e-76
Identity = 266/817 (32.56%), Postives = 420/817 (51.41%), Query Frame = 3
Query:   12 STIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINA-DSYY--QLSNIHNDIRLAAENSARNS-----AGNQLSVQNLDDSNNLDNVG-LELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELK------------------RYH----------------TRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSS----KEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII--GNLGLVSREDISRKDSP---------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            S  E L+ EV  L  EL   + +K  AA++GL +LE+ + L+++    E      + E+E  K+   +     +K +  G   E+ L+ ++   E    +++ +L+ E++  K+     L E+++L     E  E     E  R  L++++K  K +E +++ D ++L EEN+ LQK +  LK+ QVEFEG+KHE+KR +EE + L+SQLE+  +L +I+ + +E ALE+L+ EREQK   +KEL N +N  DS Y   L+   + ++ + E S  N+           V  L+  N +     LE  N    + S    DL SEL  +++ ++   + +++ E++  +  ++E +  LE  +   ++  + +  L   L  +          S   NE    S     +   ++ G  +        LE +YKV + ++  ++ ELK                  RY                 TR + DQ  + E+ELK+        + ++ GE + S    +++LV+ S    +L   V                     C    ETP++VM D    G  G  S E   R+ SP          ++  ++ G  +        +L +E  N +N+V+ ++  +  L A V +  +      A+ +   +++      L   ++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE +E+D E++
Sbjct:   18 SGPEWLRAEVRRLVRELAETSREKIQAAEYGLAVLEEKQQLKQQYEELEGECETARQELEQLKEAFGQAHSNHKKVAADGESREETLIQESATKEEYYMKKVLELQTELKLSKNVVANTLSENERLNSVAQELRELNQNIEVQRGRLRDDIKECKFREARLLQDYTELEEENISLQKQVSVLKQNQVEFEGLKHEIKRLEEETEFLNSQLEDAIRLKEISERQMEEALETLKSEREQKNNLRKELSNYMNINDSMYSNHLNLSLDGLKFSDETSEPNNDDVMNGYEHNGVIRLNGDNKMSTPKKLETGNPAPSLVS----DLLSELNISEIQKLKQQLMQVEREKVGLLSTLQESQKQLENTRGALSEQHDKVCRLTENLNAMKKLQATKERQSALDNEKERDSNEDGDYYEVDINGPEI--------LECKYKVAVSEIRDLKEELKSVKAKYEECESKYSEDKNRYESDTQAMTEKISIMEKTTRLDRDQVMRLEKELKK--------VSDVAGETQGSLTVAQDELVTFSEELANLYHHV---------------------CMCNNETPNRVMLDYYKEGKGGRSSPEGRGRR-SPILLSKGLLNSENGHNDPGSPASPLPSPVSDLRREPMNIYNLVAIIRDQIKHLQAAVDRTTELSRQQVASQELGPAVDRDREA-LMEDILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEHLELDHEQT 791          
BLAST of Protein bicaudal D vs. Ensembl Xenopus
Match: BICD1 (BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:1049])

HSP 1 Score: 193.356 bits (490), Expect = 7.509e-51
Identity = 204/680 (30.00%), Postives = 338/680 (49.71%), Query Frame = 3
Query:  231 RKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINA-DSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIES-------EDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYN--IRGELKSSKED------------LVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII--------GNL-------GLVSREDISRK-DSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNI-------VSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQR 2129
            RK +  G   E+ LL ++ + E     RI +++ EV+  ++       E+++L   + + +E  EI+  + +R  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +E+  +L+SQLE+  +L +I+   LE ALE+L+ EREQK   +KEL   IN  DS Y     +N + L     + +   N     N D  N   +  L   N  +  ++           DLFSEL  ++M ++   + +++ E+   +   +E +  LE  +   T+  + +  L   +  +     + +D                K +GEE     + +   ++ LE +YKV + ++  ++ ELK    + N      SEE  K   +  ++++Y+  + G  ++SKE             +++   N  H  + +  +   + +    LA LY  +C    ETP++VM D          G+L       GL+S   + R   SP D                  ++ KE  N +N+       + HL+ ++   + +  Q    +E +   +         + E L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA R
Sbjct:   15 RKVAEDGETREETLLQESASKEEYYLGRILEMQNEVKQSRAAITNVQGENERLSSVVQDLKETNEILELQRLR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEDTVLLNSQLEDAIRLKEISEHQLEEALETLKNEREQKNNLRKELAQYININDSMY-----NNHLNLDGLKFSEDGEPN-----NEDKVNGHIHTPLVKLNGDYRTQATRKGESLHPVSDLFSELNISEMQKLKQQLIQVEREKALLLTNFQESQTQLEHTKGALTEQHDRVHRLTEHVNAMRKLHSIELDSEK------------PKVSGEENHDYEVDI-NGLEILECKYKVAVTEVIDLKAELKALKEKYNKHVETYSEERSK---LDSRIQMYDEQVGGLERASKESCEKVLVMEKELQIMTAIANETH--NTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSKVTRSGSLKGPDDPRGLLSPRLVRRGMASPVD---LRSPSPPSSPVSDTSDIRKEPMNIYNLNAIIRDQIKHLQKAVDKSLQLSRQRAAARELAPMID--------KDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKTMVTETMTKLRNELKALKEDAATFSSLRAMFATR 653          
BLAST of Protein bicaudal D vs. Ensembl Mouse
Match: Bicd1 (BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:1101760])

HSP 1 Score: 178.718 bits (452), Expect = 1.258e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 115.161 bits (287), Expect = 1.544e-25
Identity = 88/262 (33.59%), Postives = 154/262 (58.78%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLS 785
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  ++   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + E +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   IN +DS+  +S
Sbjct:    7 LKTVDQYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDGLKQELEQLREAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLNKILEMQNELKQSRAVVTNVQAENERLSAVVQELKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYINLSDSHISIS 266          
BLAST of Protein bicaudal D vs. Ensembl Mouse
Match: Bicd1 (BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:1101760])

HSP 1 Score: 178.718 bits (452), Expect = 1.261e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 115.161 bits (287), Expect = 1.541e-25
Identity = 88/262 (33.59%), Postives = 154/262 (58.78%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLS 785
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  ++   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + E +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   IN +DS+  +S
Sbjct:    7 LKTVDQYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDGLKQELEQLREAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLNKILEMQNELKQSRAVVTNVQAENERLSAVVQELKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYINLSDSHISIS 266          
BLAST of Protein bicaudal D vs. Ensembl Mouse
Match: Bicd1 (BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:1101760])

HSP 1 Score: 178.333 bits (451), Expect = 1.572e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 114.775 bits (286), Expect = 1.845e-25
Identity = 88/262 (33.59%), Postives = 154/262 (58.78%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLS 785
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  ++   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + E +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   IN +DS+  +S
Sbjct:    7 LKTVDQYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDGLKQELEQLREAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLNKILEMQNELKQSRAVVTNVQAENERLSAVVQELKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYINLSDSHISIS 266          
BLAST of Protein bicaudal D vs. Ensembl Mouse
Match: Bicd1 (BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:1101760])

HSP 1 Score: 179.104 bits (453), Expect = 2.286e-45
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 116.701 bits (291), Expect = 5.572e-26
Identity = 91/278 (32.73%), Postives = 161/278 (57.91%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAENSARN 833
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  ++   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + E +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   IN +DS+  +S   + ++ A + S  N
Sbjct:    7 LKTVDQYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDGLKQELEQLREAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLNKILEMQNELKQSRAVVTNVQAENERLSAVVQELKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYINLSDSHISISV--DGLKFAEDGSEPN 280          
BLAST of Protein bicaudal D vs. Ensembl Mouse
Match: Bicd2 (BICD cargo adaptor 2 [Source:MGI Symbol;Acc:MGI:1924145])

HSP 1 Score: 176.407 bits (446), Expect = 3.330e-45
Identity = 124/262 (47.33%), Postives = 165/262 (62.98%), Query Frame = 3
Query: 1560 ICAVIKETPSKVMADII----GNLGLVSREDISRKDSP---------------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            +C    ETP++VM D      G  G  S E   R+ SP               D          S        +  +E  N +N+++ ++  +  L A V +  +      A+ +   +++  +   L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEY+TQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE +E+D E++
Sbjct:  469 VCMCNNETPNRVMLDYYREGQGKAGRTSPEGRGRR-SPVLLPKGLLATEVGRADGGTGDNSPSPSSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEA-LMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQT 728          

HSP 2 Score: 100.523 bits (249), Expect = 4.492e-21
Identity = 65/183 (35.52%), Postives = 114/183 (62.30%), Query Frame = 3
Query:  231 RKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINA-DSYY 776
            +K +  G   E+ L+ ++ + E     ++ +L+ E++ L++       E+++L     E +E     E  R  L++++K  K +E +++ D S+L EEN+ LQK +  L++ QVEFEG+KHE+KR +EE + L+SQLE+  +L +I+ + LE ALE+L+ EREQK   +KEL + ++  DS+Y
Sbjct:   16 KKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLTSVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNNLRKELSHYMSINDSFY 198          
BLAST of Protein bicaudal D vs. UniProt/SwissProt
Match: sp|P16568|BICD_DROME (Protein bicaudal D OS=Drosophila melanogaster OX=7227 GN=BicD PE=1 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 7.578e-86
Identity = 264/781 (33.80%), Postives = 440/781 (56.34%), Query Frame = 3
Query:   15 TIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAE-NSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDA--MDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQ---HLLSEVGLSTRSMKXXXXXXXXXXXX----ICAVIKETPSKVMAD------IIGNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQ 2309
            +++ L+ EV  L  ELD+ +     +A++GL+LLE+   L++K    E   ++ ++E+++ ++   +     +  +  G ++ED LL ++   E  L  +I DLE E++ L+   +R   E D+++Q+ ++   +    E  R  LK+E+K LK +ET+M+ + S+L EEN+ LQK +  L+ +QVEFEG KHE++R  EE ++L+ Q++E+  L +I  K +E ALE+LQ ERE KYA KKEL+  +N +S Y +SN+   IR   E N++ NS G +   +NL     L  +  +L+ +   ++S D    DLFSE+   ++ ++   ++ M+ E+      ++E +  L+K Q E       +  L + ++ +    K  ID      E   + + L++           ++R  + Q  + + +  K++  ++ ++       N   +  +   L+ E+        N++ +L ++++  + L ++ Q   H+    G S  S +S+L  L+         +C V  ETP++V+ D         N  L +   I  +   D  ++       +       E+ K V+   + + +LK+++   I     + K K  S    D    +N+ E EELQ Q+VKLKS+L+ KR+QI TLRNVL++NK TAE AL NLK KYENEK++V+DTM KLR EL+ LKEDAATF+SLRAMFA RC+EYVTQ+D+L +QL+AAE+EK+T+N LLR+A+ QKLALTQRLE++EMDRE   M+H ++
Sbjct:   14 SVQDLQMEVERLTRELDQVSSASAQSAQYGLSLLEEKSALQQKCEELETLYDNTRHELDITQEALTKFQTSQKVTNKTGIEQEDALLNESAARETSLNLQIFDLENELKQLRHELERVRNERDRMLQENSDFGRDKSDSEADRLRLKSELKDLKFRETRMLSEYSELEEENISLQKQVSSLRSSQVEFEGAKHEIRRLTEEVELLNQQVDELANLKKIAEKQMEEALETLQGEREAKYALKKELDGHLNRESMYHISNLAYSIRSNMEDNASNNSDGEE---ENL----ALKRLEADLSTE---LKSPDGTKCDLFSEIHLNELKKLEKQLESMESEKTHLTANLREAQTSLDKSQNELQNFMSRLALLAAHVDALVQLKK-QIDVKEQGKEGGQKKDELEQ-----------QLRALISQYANWFTLSAKEIDGLKTDIAELQKGLNYTDATTT---LRNEVT-------NLKNKLLATEQKSLDLQSDVQTLTHISQNAGQSLGSARSTLVALSDDLAQLYHLVCTVNGETPTRVLLDHKTDDMSFENDSLTA---IQSQFKSDVFIAKPQIVEDLQGLADSVEIKKYVDTVSDQIKYLKTAVEHTI----DMNKHKIRSEG-GDALEKVNTEEMEELQEQIVKLKSLLSVKREQIGTLRNVLKSNKQTAEVALTNLKSKYENEKIIVSDTMSKLRNELRLLKEDAATFSSLRAMFAARCEEYVTQVDDLNRQLEAAEEEKKTLNQLLRLAVQQKLALTQRLEEMEMDRE---MRHVRR 751          
BLAST of Protein bicaudal D vs. UniProt/SwissProt
Match: sp|Q8BR07|BICD1_MOUSE (Protein bicaudal D homolog 1 OS=Mus musculus OX=10090 GN=Bicd1 PE=1 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 1.100e-44
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 114.775 bits (286), Expect = 1.290e-24
Identity = 88/262 (33.59%), Postives = 154/262 (58.78%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLS 785
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  ++   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + E +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   IN +DS+  +S
Sbjct:    7 LKTVDQYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDGLKQELEQLREAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLNKILEMQNELKQSRAVVTNVQAENERLSAVVQELKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYINLSDSHISIS 266          
BLAST of Protein bicaudal D vs. UniProt/SwissProt
Match: sp|Q96G01|BICD1_HUMAN (Protein bicaudal D homolog 1 OS=Homo sapiens OX=9606 GN=BICD1 PE=1 SV=3)

HSP 1 Score: 179.104 bits (453), Expect = 1.571e-44
Identity = 103/135 (76.30%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+N+LLRMAI QKLALTQRLED+E D E+S
Sbjct:  670 LMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQS 804          

HSP 2 Score: 113.235 bits (282), Expect = 4.478e-24
Identity = 84/253 (33.20%), Postives = 148/253 (58.50%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN 761
            + T++  K E+  L  EL     +K  AA++GL +LE+   L+++    E   + LK E+E  K+   +   + RK +  G   E+ LL ++ + E     +I +++ E++  ++       E+++L   + + +E  E+V  + IR  +K+E++  K +E +++ D ++L EEN+ LQK +  LK+ QVE+EG+KHE+KR +EE  +L+SQLE+  +L +I    LE ALE+L+ EREQK   +KEL   I+
Sbjct:    7 LQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDLKENNEMVELQRIR--MKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYIS 257          
BLAST of Protein bicaudal D vs. UniProt/SwissProt
Match: sp|Q921C5|BICD2_MOUSE (Protein bicaudal D homolog 2 OS=Mus musculus OX=10090 GN=Bicd2 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.825e-44
Identity = 124/262 (47.33%), Postives = 165/262 (62.98%), Query Frame = 3
Query: 1560 ICAVIKETPSKVMADII----GNLGLVSREDISRKDSP---------------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            +C    ETP++VM D      G  G  S E   R+ SP               D          S        +  +E  N +N+++ ++  +  L A V +  +      A+ +   +++  +   L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEY+TQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE +E+D E++
Sbjct:  543 VCMCNNETPNRVMLDYYREGQGKAGRTSPEGRGRR-SPVLLPKGLLATEVGRADGGTGDNSPSPSSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEA-LMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQT 802          

HSP 2 Score: 114.775 bits (286), Expect = 1.300e-24
Identity = 84/253 (33.20%), Postives = 146/253 (57.71%), Query Frame = 3
Query:   21 EILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINA-DSYY 776
            E L+ EV  L  EL     +K  AA++GL +LE+   L+ +    E     ++ E+E  K+   +     +K +  G   E+ L+ ++ + E     ++ +L+ E++ L++       E+++L     E +E     E  R  L++++K  K +E +++ D S+L EEN+ LQK +  L++ QVEFEG+KHE+KR +EE + L+SQLE+  +L +I+ + LE ALE+L+ EREQK   +KEL + ++  DS+Y
Sbjct:   20 EWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLTSVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNNLRKELSHYMSINDSFY 272          
BLAST of Protein bicaudal D vs. UniProt/SwissProt
Match: sp|Q8TD16|BICD2_HUMAN (Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 7.014e-44
Identity = 101/135 (74.81%), Postives = 121/135 (89.63%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEY+TQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLE +E+D E++
Sbjct:  672 LMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQT 806          

HSP 2 Score: 117.857 bits (294), Expect = 1.682e-25
Identity = 83/258 (32.17%), Postives = 149/258 (57.75%), Query Frame = 3
Query:   21 EILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIH 794
            E L+ EV  L  EL     +K  AA++GL +LE+   L+ +    E     ++ E+E  K+   +     +K +  G   E+ L+ ++ + E     ++ +L+ E++ L++       E+++L     E +E     E  R  L++++K  K +E +++ D S+L EEN+ LQK +  L++ QVEFEG+KHE+KR +EE + L+SQLE+  +L +I+ + LE ALE+L+ EREQK + +KEL + ++ +  +  S++H
Sbjct:   20 EWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLH 277          
BLAST of Protein bicaudal D vs. TrEMBL
Match: A0A5K3FTP4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 3.569e-131
Identity = 301/757 (39.76%), Postives = 466/757 (61.56%), Query Frame = 3
Query:   33 DEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYH--TRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLS----TRSMKXXXXXXXXXXXXICAVIKETPSKVMADIIG----NLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEM 2273
            +EV  L+S L  A  +K +AA++GL LLE+ E+L+ K+   E+ +  L  E++L ++  +E+S L RK S  G+QEEDDLL ++ N E QL  RI+DLE ++++ K++++ Q+ E+DKL Q + + + +  + E IR++LK E+K +K KE Q++ +  +L  ENL LQK++L LK +Q+EFE +KHELKR QEEND++H QLEE+ +L +I  KSLE ALESLQ+EREQ++  KKEL++++  +S+Y L++I N +   +++   N   N  +   L+ S + D  G     QK     E   +L SELQ +++ Q  +++ ++        R+++E +   E    E T  QE I +L+++L+ I           G    +  + E+ ++  G +   + L  R+ ++Q E+RY V L+Q++SMQH+L RY    R N D +   ++ LK E++R + +L     ++K  ++ + + +   Q    E+GL     + S++   + L  LY  ICA IKETPSK ++D+      +L  V++       + D ++             + E L+K+ E+   +V HL+  +        +L K   S  A+ D          EELQ++++ LKS L+TKRDQ+  LR+VL+ANK TAETALANLKQKYENEK++VTDTM  LR+ELK LKEDA T+AS+RAMFAQ+ DE+VTQ+DELQQ+L +AEDEKRT+NSLLR+AI QKL LTQRLE+ E+
Sbjct:   11 EEVERLQSSLKEALREKYEAAQYGLKLLEEKESLQSKLEESEEKLVHLMRELQLTREKCDEQSELQRKISQAGFQEEDDLLSRSANREEQLSHRIKDLEHDLKSTKAKYENQMAENDKLHQIMKDLQAKYDSVEKIRQDLKQEMKGMKSKEAQLLSELDELESENLELQKNVLALKTSQIEFESLKHELKRGQEENDLIHVQLEEVTRLKRITEKSLEEALESLQIEREQRHNLKKELDSRLAYESFYHLNSIQNGLAQVSQSQLLNQT-NSRNASILETSKSADVGG-----QKSAAAGE---NLLSELQTSELTQFKAELAELQ-------RKLEEAQRSAEVASSEVTSKQERITQLQTELDIIM----------GVQRRADAEFEAKNEANGADTADDDLGSRRALRQAETRYSVALRQIASMQHDLWRYQELERMNADPALTDDKGLKAEVLRLREQLEKKASDIKKLEDRIDNGAVEAQ----EIGLKSASVSSSLRVGFSELLKLYMLICAEIKETPSKQVSDLASRAAMSLDTVTKATTDDSTASDPAVDGAVSIPISTDPVTPEMLAKQAEDQTTMVGHLRHVIQMFAEKNARLAKTAASGGASQD---------VEELQAEILSLKSKLSTKRDQVIALRDVLKANKTTAETALANLKQKYENEKMIVTDTMRGLRSELKVLKEDAVTYASIRAMFAQKHDEFVTQMDELQQKLNSAEDEKRTLNSLLRLAIQQKLHLTQRLEEYEV 728          
BLAST of Protein bicaudal D vs. TrEMBL
Match: A0A0X3PXF9 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR124431 PE=4 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 5.239e-131
Identity = 307/770 (39.87%), Postives = 468/770 (60.78%), Query Frame = 3
Query:   33 DEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKL---IQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARN-SAGNQLS-----VQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQS--FQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII--GNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHF 2303
            +E+  L+  L  A ++K DAA++GL LLE+ ENL+ K+   E+ +  L+ E++L ++   E+S L RK S  G+QEEDDLL  + + E QL  RI+DLE +V+  K +F++Q+ E+DKL   +Q I  K EE+   E  R ELK E+K LK KET ++ +  +L  ENL LQK++L LK +Q+EFE +KHE+KR QEEND+LH+QLEEI +L +I  KSLE ALESLQ+ER+Q++  KKEL+N++  +S YQ ++I N+   AA++   N S  N  S     V +   S  L+  G           +  A DLFSELQ T++N+  +D+K ++ E+ +  R++ E +  +E    E    QE I EL+S+L+ +    + A     ++ E           T EE  GE  ++R+ ++Q ++RY V L+Q++SM+H+L RY   E V  S    +EE L+ E+++ + +L     ++K+    L   +     +  +     R M    + L  LY  +CA +K+ P+K + ++       L + ++ + + +  D  +S+          S + L++++E    ++ HL+            LQ F E S      + + +S + +ELQS+++ LK  L  KR+Q+  LRNVL+ANKATAETALANLKQKYENEK +VTDTM  LR+ELK LKEDAAT+AS+RAMFAQ+ DE++TQ+DELQQ+L  +E+EKRT+NSLLR+AI QKLALTQRLE+ ++ +E  N  ++
Sbjct:   11 EEIQKLQKSLKDALKEKYDAAQYGLRLLEEKENLQAKLEESEERLIQLQRELQLTQEKCNEQSELHRKMSRFGFQEEDDLLSNSVSREEQLSNRIKDLEFDVKNTKLKFEQQMSENDKLHQLVQDIQAKYEEV---ERHRIELKQEIKALKLKETSLLSELDELESENLDLQKNVLALKTSQIEFESLKHEMKRGQEENDLLHAQLEEITRLKRITEKSLEEALESLQIERDQRHNLKKELDNRLAYESVYQFNSIQNEYATAAQSQLINQSVSNDFSSNSHLVPDGPPSMPLNKSG-----------NAAAGDLFSELQSTEVNKFKADIKILEVEKADLQRRLDEAQRGIEAATSEVASKQERISELQSELDVLMRVQQQA---DAELAEQQVTGTPTAPTTSEE-SGEEGQLRRALRQADTRYSVALRQIASMKHDLWRYQELEKVKASPELSTEEGLRAEVLKLRTDLETRTADIKTLNMQLCDGAEEANRVGLKAAAVHRQMCKGFSELLRLYMRVCADLKQAPAKQVVELASQAKFTLDAVKETTDESTASD-PASDGASEQPLEPVSLDVLTQQLETQDALLRHLRCL----------LQIFTEKSVHLAKTAQNGSSQDVQELQSEVLSLKGKLMLKREQVTALRNVLKANKATAETALANLKQKYENEKTLVTDTMRSLRSELKVLKEDAATYASIRAMFAQKHDEFITQMDELQQKLNTSEEEKRTLNSLLRLAIQQKLALTQRLEEYDITQEHLNQANY 751          
BLAST of Protein bicaudal D vs. TrEMBL
Match: A0A183SY14 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 3.550e-130
Identity = 307/770 (39.87%), Postives = 468/770 (60.78%), Query Frame = 3
Query:   33 DEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKL---IQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARN-SAGNQLS-----VQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQS--FQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII--GNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHF 2303
            +E+  L+  L  A ++K DAA++GL LLE+ ENL+ K+   E+ +  L+ E++L ++   E+S L RK S  G+QEEDDLL  + + E QL  RI+DLE +V+  K +F++Q+ E+DKL   +Q I  K EE+   E  R ELK E+K LK KET ++ +  +L  ENL LQK++L LK +Q+EFE +KHE+KR QEEND+LH+QLEEI +L +I  KSLE ALESLQ+ER+Q++  KKEL+N++  +S YQ ++I N+   AA++   N S  N  S     V +   S  L+  G           +  A DLFSELQ T++N+  +D+K ++ E+ +  R++ E +  +E    E    QE I EL+S+L+ +    + A     ++ E           T EE  GE  ++R+ ++Q ++RY V L+Q++SM+H+L RY   E V  S    +EE L+ E+++ + +L     ++K+    L   +     +  +     R M    + L  LY  +CA +K+ P+K + ++       L + ++ + + +  D  +S+          S + L++++E    ++ HL+            LQ F E S      + + +S + +ELQS+++ LK  L  KR+Q+  LRNVL+ANKATAETALANLKQKYENEK +VTDTM  LR+ELK LKEDAAT+AS+RAMFAQ+ DE++TQ+DELQQ+L  +E+EKRT+NSLLR+AI QKLALTQRLE+ ++ +E  N  ++
Sbjct:   38 EEIQKLQKSLKDALKEKYDAAQYGLRLLEEKENLQAKLEESEERLIQLQRELQLTQEKCNEQSELHRKMSRFGFQEEDDLLSNSVSREEQLSNRIKDLEFDVKNTKLKFEQQMSENDKLHQLVQDIQAKYEEV---ERHRIELKQEIKALKLKETSLLSELDELESENLDLQKNVLALKTSQIEFESLKHEMKRGQEENDLLHAQLEEITRLKRITEKSLEEALESLQIERDQRHNLKKELDNRLAYESVYQFNSIQNEYATAAQSQLINQSVSNDFSSNSHLVPDGPPSMPLNKSG-----------NAAAGDLFSELQSTEVNKFKADIKILEVEKADLQRRLDEAQRGIEAATSEVASKQERISELQSELDVLMRVQQQA---DAELAEQQVTGTPTAPTTSEE-SGEEGQLRRALRQADTRYSVALRQIASMKHDLWRYQELEKVKASPELSTEEGLRAEVLKLRTDLETRTADIKTLNMQLCDGAEEANRVGLKAAAVHRQMCKGFSELLRLYMRVCADLKQAPAKQVVELASQAKFTLDAVKETTDESTASD-PASDGASEQPLEPVSLDVLTQQLETQDALLRHLRCL----------LQIFTEKSVHLAKTAQNGSSQDVQELQSEVLSLKGKLMLKREQVTALRNVLKANKATAETALANLKQKYENEKTLVTDTMRSLRSELKVLKEDAATYASIRAMFAQKHDEFITQMDELQQKLNTSEEEKRTLNSLLRLAIQQKLALTQRLEEYDITQEHLNQANY 778          
BLAST of Protein bicaudal D vs. TrEMBL
Match: A0A3P7E694 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9112 PE=4 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 4.237e-130
Identity = 307/770 (39.87%), Postives = 468/770 (60.78%), Query Frame = 3
Query:   33 DEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKL---IQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARN-SAGNQLS-----VQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQS--FQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII--GNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHF 2303
            +E+  L+  L  A ++K DAA++GL LLE+ ENL+ K+   E+ +  L+ E++L ++   E+S L RK S  G+QEEDDLL  + + E QL  RI+DLE +V+  K +F++Q+ E+DKL   +Q I  K EE+   E  R ELK E+K LK KET ++ +  +L  ENL LQK++L LK +Q+EFE +KHE+KR QEEND+LH+QLEEI +L +I  KSLE ALESLQ+ER+Q++  KKEL+N++  +S YQ ++I N+   AA++   N S  N  S     V +   S  L+  G           +  A DLFSELQ T++N+  +D+K ++ E+ +  R++ E +  +E    E    QE I EL+S+L+ +    + A     ++ E           T EE  GE  ++R+ ++Q ++RY V L+Q++SM+H+L RY   E V  S    +EE L+ E+++ + +L     ++K+    L   +     +  +     R M    + L  LY  +CA +K+ P+K + ++       L + ++ + + +  D  +S+          S + L++++E    ++ HL+            LQ F E S      + + +S + +ELQS+++ LK  L  KR+Q+  LRNVL+ANKATAETALANLKQKYENEK +VTDTM  LR+ELK LKEDAAT+AS+RAMFAQ+ DE++TQ+DELQQ+L  +E+EKRT+NSLLR+AI QKLALTQRLE+ ++ +E  N  ++
Sbjct:   38 EEIQKLQKSLKDALKEKYDAAQYGLRLLEEKENLQAKLEESEERLIQLQRELQLTQEKCNEQSELHRKMSRFGFQEEDDLLSNSVSREEQLSNRIKDLEFDVKNTKLKFEQQMSENDKLHQLVQDIQAKYEEV---ERHRIELKQEIKALKLKETSLLSELDELESENLDLQKNVLALKTSQIEFESLKHEMKRGQEENDLLHAQLEEITRLKRITEKSLEEALESLQIERDQRHNLKKELDNRLAYESVYQFNSIQNEYATAAQSQLINQSVSNDFSSNSHLVPDGPPSMPLNKSG-----------NAAAGDLFSELQSTEVNKFKADIKILEVEKADLQRRLDEAQRGIEAATSEVASKQERISELQSELDVLMRVQQQA---DAELAEQQVTGTPTAPTTSEE-SGEEGQLRRALRQADTRYSVALRQIASMKHDLWRYQELEKVKASPELSTEEGLRAEVLKLRTDLETRTADIKTLNMQLCDGAEEANRVGLKAAAVHRQMCKGFSELLRLYMRVCADLKQAPAKQVVELASQAKFTLDAVKETTDESTASD-PASDGASEQPLEPVSLDVLTQQLETQDALLRHLRCL----------LQIFTEKSVHLAKTAQNGSSQDVQELQSEVLSLKGKLMLKREQVTALRNVLKANKATAETALANLKQKYENEKTLVTDTMRSLRSELKVLKEDAATYASIRAMFAQKHDEFITQMDELQQKLNTSEEEKRTLNSLLRLAIQQKLALTQRLEEYDITQEHLNQANY 778          
BLAST of Protein bicaudal D vs. TrEMBL
Match: A0A0R3SBG2 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1810 PE=4 SV=2)

HSP 1 Score: 417.157 bits (1071), Expect = 5.006e-127
Identity = 330/905 (36.46%), Postives = 489/905 (54.03%), Query Frame = 3
Query:   12 STIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDI------RLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQR-------EATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRE--NVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRS----MKXXXXXXXXXXXXICAVIKETPSKVMADIIGNLGL-------VSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKE------------SSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQMQQVLRSNNNNFRXXXXXXXXXXXXXQNSVNGV-----MINPAPPGIIGNAP----FFGGG----IP----SNTRPFNSIQQHPYMPMSSHQHPLSTYQPP 2561
            S +   K+E+  L+S L  A  +K +AA++GL LLE+ ++L+ K+   E+ +  LK E+ L ++  +E++ L RK S VG+QEEDDLL +T N E QL  RI+DLE +++  K +++RQ+ E+DK+ Q + E + +    E  R ELK E+K +K KETQ++ +  +L  ENL LQK++L LK +Q+EFE +KHELKR QEEND++H QLEE+ +L +I  KSLE ALESLQ+EREQ++  KKEL++++  +S+Y L+ I N +      +L  EN  R+  G              D +G +  N            LFSELQ ++  Q  ++M               +L+H LE+ QR       E    Q+ I +L+ +L+ I    K A D   D NE+           GEE       ++++++Q E+RY V L+Q++SMQH+L RY   E  NVD +   E  LK E+++ + EL N R E+K  KE +     N      EVG+ T      ++   + L  LY  +C  +KETPSK + D+     +        S  D S    P    S+  G S +    + + L K+VE+   ++ HL+          H +Q F E            +S  TND          EEL S++++L++ LT KR+QI +LR+VL+ NK+ AETALANLKQKYENEK +VTDT+  LR ELK LKEDA+T+ S+RAMF ++ +E+V Q+D+LQQ+L  AE+EKRT+NS+LR+AI QKL+LTQR+E +EM+              +  +N  + R  T  +      +     G      M  P  PG +   P    +F        P    S T PFN +      P  S Q P+  + PP
Sbjct:    4 SDVSNYKEEIEQLQSSLKEALREKYEAAQYGLRLLEEKDSLQAKLDENEEVLAQLKRELRLTQEKCDEQNELNRKMSRVGFQEEDDLLSRTANREEQLSNRIKDLEHDLKNTKIKYERQMTENDKIHQMMQEIQTKYDDGEKTRLELKQEIKAMKAKETQLLSELDELESENLELQKNVLVLKTSQIEFESLKHELKRGQEENDLMHVQLEEVTRLKRITEKSLEEALESLQIEREQRHNLKKELDSRLAYESFYHLNTIQNGLAQATQAQLLDENIGRSQGGG-------------DTIGKKGEN------------LFSELQLSETTQFKAEM--------------TDLQHKLEEAQRSAELASSEVNSKQDRINQLQDELDLIMGVQKRA-DTEFDANEA-----------GEEESA----LKRSLRQTETRYSVALRQIASMQHDLWRYQELEKMNVDPALADETGLKSEVLKLRKELENRRDEIKHLKERI----DNGAEAAQEVGIKTAGVSVFLRKGFSELLNLYMLVCVELKETPSKQVCDLASRSSIPLDSNNATSITDDSTASDPTVDASAAVGSSVITEPVTPDMLKKQVEDQITVLGHLR----------HAVQMFAEKNARMAQNVANGTSKFTND--------AVEELNSEILQLRAKLTVKREQIASLRSVLKKNKSVAETALANLKQKYENEKAIVTDTLRNLRAELKMLKEDASTYTSIRAMFTEKHEEFVQQMDQLQQKLNKAEEEKRTLNSILRLAIQQKLSLTQRIEALEME--------------LFAANPGSVRLPTDTAPPVRLYAPVDPTGAGASAQMQGPPTPGTLVPPPGPNAWFHAAPRLVCPPHPTSVTDPFNFVPTRAQTP--STQTPI--FPPP 813          
BLAST of Protein bicaudal D vs. Ensembl Cavefish
Match: bicd2 (protein bicaudal D homolog 2 [Source:NCBI gene;Acc:103037097])

HSP 1 Score: 286.574 bits (732), Expect = 8.055e-82
Identity = 273/883 (30.92%), Postives = 445/883 (50.40%), Query Frame = 3
Query:   27 LKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAENSARNSAGNQL--SVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSE---------SLDKWTGEELRGEILRMRKTVKQLES-RYKVGLKQMSSMQHELKRYHTRENVDQSFQSE--------EEL-------KEEIVRQQVELYNI-------RGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII----GNLGLVSREDISR-----KDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQMQQVLRSNNNNFRXXXXXXXXXXXXXQNSVNGVMINPAPPGIIGNAPFFGGGIPSNTRPFNSIQQHPYMPMSSHQH 2537
            L+ EV  L  EL     +K  AA++GL +LE+ + L ++    E     L+ E+E  ++         RK +  G   E+ L++++ + E   ++R++DL+ ++R  ++       E+++L     E  E  E+V  +  R  L+++++  K +E++++ D ++L EEN+ LQK +  L++ QVEFEG+KHE++R +EE   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL N +   DS   L++  + ++L  +    + A          + DS+  +        ++         DL SEL  +++ ++   + +++ E++  +  ++E +  LE+ +    + QE +  L   L  +  F       +G   +S   SE          +D +  +    EILR +  V   E+   +  LK + +   E++  HT   V +  +S+         EL       +E++ R Q EL          +G L  ++++LV+ S    +L   V                     C    ETPS+VM D      G  G  +R   ++     + +P  S S+    +S  +G + E+  KE  + +N+V+ ++  +  L   V +  +      A+ + ++  +  +   ++ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLD++Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+S                                          NPAP    G  PF  G  P+++   +S    P +P  S  H
Sbjct:   21 LRGEVERLSRELSETTREKIQAAEYGLAVLEEKQQLSQRYEELEGEYETLRQELEQLREAYGHAHSAQRKVAADGESREESLILESASKEAFYEQRVQDLQADLRQTRTTLTSTQAENERLAALALELRESNELVDLQRAR--LRDDIREFKVRESRLLQDYTELEEENITLQKQVSLLRQGQVEFEGLKHEIRRLEEEAQYLNSQLEDAVRLREIAERQLTEALETVKTEREQKAALRKELTNHMTLGDSL--LASSLDTLKLGLDEPNNDEAVRTFENGFAKMVDSDEDNRCSTPKKGERFRPAPSLVDDLLSELNISEIQKLKQQLVQVEREKVALLSTLQESQKQLEQARGSLAEQQEAMARLSDDLGAMRRFH------AGKERQSALDSERERDSREEGDVDYYELDIHGPEILRCKYEVAVAEAGELREELKALKAEHEEVRAEHT--EVQERLESQVRDLSSQVSELESGGRVDREKLARLQKELQETSVLAGESQGALSVAQDELVAFSEELANLYHHV---------------------CMCNNETPSRVMLDFYKEGKGADGKATRPSSTQTPAGSEPAPPPSESTHSTTNSAPAGPAREDSKKEPMDVYNLVAIIRDQIRHLQQAVDRTTELSRQRVASLELNAVADKDQTACME-EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKTIVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDDMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQSRRGS--------------------------------------NPAP---RGKGPFSRGKGPASS---SSPHVSPRLPCRSRLH 825          
BLAST of Protein bicaudal D vs. Ensembl Cavefish
Match: BICD2 (protein bicaudal D homolog 2-like [Source:NCBI gene;Acc:103023429])

HSP 1 Score: 283.108 bits (723), Expect = 4.674e-81
Identity = 256/795 (32.20%), Postives = 412/795 (51.82%), Query Frame = 3
Query:   21 EILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAE-----NSARNSAGNQLSVQ----NLDDSNNLDNVGLELTNQKHIIESEDAM--DLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGEL-------KSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXX-------ICAVIKETPSKVMADI-----IGNLGLVSREDISRKDSP--------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            E L  E+  L  EL     +K  AA++GL +LE+ + L+++    E     ++ E+E  ++   +     RK +  G   E+ L+ ++   E   ++R+++L+ E+R +++       E+++L     E  E     E  R  L++++K  K +E +++ D S+L EEN+ LQKH+  LK++QVEFEG+KHE +R +E+   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL + ++  D+ Y     HN + ++ +     + A     N   +       D   N D+  +    +  +     ++  DL SEL  +++ ++   + +++ E++  +  +++ +  LE+     ++  E +  L   L  I          S   NE    S     +   ++ G  +        LE +YKV + +   ++ ELK   T  +  QS     + +E+  R + E+ N+R +L       ++ +E L  +    +      G S  S+  +   LA            +C    ETP++VM D          G  S E   R+ SP            S      S        +  KE  N +N+V+ ++  +  L   V +  +      A+ +     +  +   L+ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E++
Sbjct:   14 EWLVSELERLSRELSETTREKIQAAEYGLAVLEEKQALKQQFDELEAEYEAVRQELEQLREAFGQAHSNHRKVAADGESREESLIQESACKEAYYEQRVQELQTELRQIRNVLTNTQSENERLATITQELRENSQMVELQRSRLRDDIKEYKFREARLLQDYSELEEENITLQKHVSMLKQSQVEFEGLKHENRRLEEDTQFLNSQLEDAIRLKEIAERQLGEALETIKTEREQKAALRKELSHYMSIGDTMY-----HNPLNISLDGLKFSDDAATEPNNDDPIHTYENGFDKITNEDDNRISTPKKSELFHPAPSLVDDLLSELNISEIQKLKQQLVQVEREKVTLLSTLQDSQKQLEQAHGALSEEHEKVSRLTENLNAIRKLQASKERQSALDNEKERDSHEDGDYYEVDINGPEI--------LECKYKVAVSEAGHLKEELKTLKTEYSACQS-----QYEEDRTRLESEVTNLRSQLGTLEHSSRAEREQLARMEKELRQASEVAGESQGSLSVAQDELATFSEELANLYHHVCMCNNETPNRVMLDFYREGKANPTGRSSPEGRGRR-SPILLTRGLFPTPDSESPSPVSSSLPSPVADPRKEPMNIYNLVAIIRDQIRHLQLAVDRTTELSRQRVASMELGPGADRDQEASLE-EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQT 788          
BLAST of Protein bicaudal D vs. Ensembl Cavefish
Match: BICD2 (protein bicaudal D homolog 2-like [Source:NCBI gene;Acc:103023429])

HSP 1 Score: 283.108 bits (723), Expect = 5.517e-81
Identity = 256/795 (32.20%), Postives = 412/795 (51.82%), Query Frame = 3
Query:   21 EILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAE-----NSARNSAGNQLSVQ----NLDDSNNLDNVGLELTNQKHIIESEDAM--DLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGEL-------KSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXX-------ICAVIKETPSKVMADI-----IGNLGLVSREDISRKDSP--------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            E L  E+  L  EL     +K  AA++GL +LE+ + L+++    E     ++ E+E  ++   +     RK +  G   E+ L+ ++   E   ++R+++L+ E+R +++       E+++L     E  E     E  R  L++++K  K +E +++ D S+L EEN+ LQKH+  LK++QVEFEG+KHE +R +E+   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL + ++  D+ Y     HN + ++ +     + A     N   +       D   N D+  +    +  +     ++  DL SEL  +++ ++   + +++ E++  +  +++ +  LE+     ++  E +  L   L  I          S   NE    S     +   ++ G  +        LE +YKV + +   ++ ELK   T  +  QS     + +E+  R + E+ N+R +L       ++ +E L  +    +      G S  S+  +   LA            +C    ETP++VM D          G  S E   R+ SP            S      S        +  KE  N +N+V+ ++  +  L   V +  +      A+ +     +  +   L+ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E++
Sbjct:   14 EWLVSELERLSRELSETTREKIQAAEYGLAVLEEKQALKQQFDELEAEYEAVRQELEQLREAFGQAHSNHRKVAADGESREESLIQESACKEAYYEQRVQELQTELRQIRNVLTNTQSENERLATITQELRENSQMVELQRSRLRDDIKEYKFREARLLQDYSELEEENITLQKHVSMLKQSQVEFEGLKHENRRLEEDTQFLNSQLEDAIRLKEIAERQLGEALETIKTEREQKAALRKELSHYMSIGDTMY-----HNPLNISLDGLKFSDDAATEPNNDDPIHTYENGFDKITNEDDNRISTPKKSELFHPAPSLVDDLLSELNISEIQKLKQQLVQVEREKVTLLSTLQDSQKQLEQAHGALSEEHEKVSRLTENLNAIRKLQASKERQSALDNEKERDSHEDGDYYEVDINGPEI--------LECKYKVAVSEAGHLKEELKTLKTEYSACQS-----QYEEDRTRLESEVTNLRSQLGTLEHSSRAEREQLARMEKELRQASEVAGESQGSLSVAQDELATFSEELANLYHHVCMCNNETPNRVMLDFYREGKANPTGRSSPEGRGRR-SPILLTRGLFPTPDSESPSPVSSSLPSPVADPRKEPMNIYNLVAIIRDQIRHLQLAVDRTTELSRQRVASMELGPGADRDQEASLE-EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQT 788          
BLAST of Protein bicaudal D vs. Ensembl Cavefish
Match: bicd2 (protein bicaudal D homolog 2 [Source:NCBI gene;Acc:103037097])

HSP 1 Score: 281.952 bits (720), Expect = 6.657e-81
Identity = 259/800 (32.38%), Postives = 426/800 (53.25%), Query Frame = 3
Query:   27 LKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEE--EIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAENSARNSAGNQL--SVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSE---------SLDKWTGEELRGEILRMRKTVKQLES-RYKVGLKQMSSMQHELKRYHTRENVDQSFQSE--------EEL-------KEEIVRQQVELYNI-------RGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADII----GNLGLVSREDISR-----KDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L+ EV  L  EL     +K  AA++GL +LE+ + L ++    E     L+ E+E  ++         RK +  G   E+ L++++ + E   ++R++DL+ ++R  ++       E+++L     E  E  E+V  +  R  L+++++  K +E++++ D ++L EEN+ LQK +  L++ QVEFEG+KHE++R +EE   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL N +   DS   L++  + ++L  +    + A          + DS+  +        ++         DL SEL  +++ ++   + +++ E++  +  ++E +  LE+ +    + QE +  L   L  +  F       +G   +S   SE          +D +  +    EILR +  V   E+   +  LK + +   E++  HT   V +  +S+         EL       +E++ R Q EL          +G L  ++++LV+ S    +L   V                     C    ETPS+VM D      G  G  +R   ++     + +P  S S+    +S  +G + E+  KE  + +N+V+ ++  +  L   V +  +      A+ + ++  +  +   ++ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLD++Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+S
Sbjct:   10 LRGEVERLSRELSETTREKIQAAEYGLAVLEEKQQLSQRYEELEGEYETLRQELEQLREAYGHAHSAQRKVAADGESREESLILESASKEAFYEQRVQDLQADLRQTRTTLTSTQAENERLAALALELRESNELVDLQRAR--LRDDIREFKVRESRLLQDYTELEEENITLQKQVSLLRQGQVEFEGLKHEIRRLEEEAQYLNSQLEDAVRLREIAERQLTEALETVKTEREQKAALRKELTNHMTLGDSL--LASSLDTLKLGLDEPNNDEAVRTFENGFAKMVDSDEDNRCSTPKKGERFRPAPSLVDDLLSELNISEIQKLKQQLVQVEREKVALLSTLQESQKQLEQARGSLAEQQEAMARLSDDLGAMRRFH------AGKERQSALDSERERDSREEGDVDYYELDIHGPEILRCKYEVAVAEAGELREELKALKAEHEEVRAEHT--EVQERLESQVRDLSSQVSELESGGRVDREKLARLQKELQETSVLAGESQGALSVAQDELVAFSEELANLYHHV---------------------CMCNNETPSRVMLDFYKEGKGADGKATRPSSTQTPAGSEPAPPPSESTHSTTNSAPAGPAREDSKKEPMDVYNLVAIIRDQIRHLQQAVDRTTELSRQRVASLELNAVADKDQTACME-EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKTIVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDDMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQS 775          
BLAST of Protein bicaudal D vs. Ensembl Cavefish
Match: BICD2 (protein bicaudal D homolog 2-like [Source:NCBI gene;Acc:103023429])

HSP 1 Score: 281.952 bits (720), Expect = 7.996e-81
Identity = 256/795 (32.20%), Postives = 412/795 (51.82%), Query Frame = 3
Query:   21 EILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAE-----NSARNSAGNQLSVQ----NLDDSNNLDNVGLELTNQKHIIESEDAM--DLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGEL-------KSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXX-------ICAVIKETPSKVMADI-----IGNLGLVSREDISRKDSP--------DDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            E L  E+  L  EL     +K  AA++GL +LE+ + L+++    E     ++ E+E  ++   +     RK +  G   E+ L+ ++   E   ++R+++L+ E+R +++       E+++L     E  E     E  R  L++++K  K +E +++ D S+L EEN+ LQKH+  LK++QVEFEG+KHE +R +E+   L+SQLE+  +L +I  + L  ALE+++ EREQK A +KEL + ++  D+ Y     HN + ++ +     + A     N   +       D   N D+  +    +  +     ++  DL SEL  +++ ++   + +++ E++  +  +++ +  LE+     ++  E +  L   L  I          S   NE    S     +   ++ G  +        LE +YKV + +   ++ ELK   T  +  QS     + +E+  R + E+ N+R +L       ++ +E L  +    +      G S  S+  +   LA            +C    ETP++VM D          G  S E   R+ SP            S      S        +  KE  N +N+V+ ++  +  L   V +  +      A+ +     +  +   L+ +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E++
Sbjct:   14 EWLVSELERLSRELSETTREKIQAAEYGLAVLEEKQALKQQFDELEAEYEAVRQELEQLREAFGQAHSNHRKVAADGESREESLIQESACKEAYYEQRVQELQTELRQIRNVLTNTQSENERLATITQELRENSQMVELQRSRLRDDIKEYKFREARLLQDYSELEEENITLQKHVSMLKQSQVEFEGLKHENRRLEEDTQFLNSQLEDAIRLKEIAERQLGEALETIKTEREQKAALRKELSHYMSIGDTMY-----HNPLNISLDGLKFSDDAATEPNNDDPIHTYENGFDKITNEDDNRISTPKKSELFHPAPSLVDDLLSELNISEIQKLKQQLVQVEREKVTLLSTLQDSQKQLEQAHGALSEEHEKVSRLTENLNAIRKLQASKERQSALDNEKERDSHEDGDYYEVDINGPEI--------LECKYKVAVSEAGHLKEELKTLKTEYSACQS-----QYEEDRTRLESEVTNLRSQLGTLEHSSRAEREQLARMEKELRQASEVAGESQGSLSVAQDELATFSEELANLYHHVCMCNNETPNRVMLDFYREGKANPTGRSSPEGRGRR-SPILLTRGLFPTPDSESPSPVSSSLPSPVADPRKEPMNIYNLVAIIRDQIRHLQLAVDRTTELSRQRVASMELGPGADRDQEASLE-EILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQT 788          
BLAST of Protein bicaudal D vs. Ensembl Sea Lamprey
Match: bicd1a (bicaudal D homolog 1a [Source:ZFIN;Acc:ZDB-GENE-081031-9])

HSP 1 Score: 168.703 bits (426), Expect = 2.288e-43
Identity = 100/135 (74.07%), Postives = 120/135 (88.89%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L  +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KY+NEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYV+QLDE+Q+QL AAEDEK+T+NSLLR AI QKLALTQRLED+E D E++
Sbjct:  602 LVEEMLKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYDNEKSMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVSQLDEMQRQLAAAEDEKKTLNSLLRAAI-QKLALTQRLEDLEFDHEQT 735          

HSP 2 Score: 108.612 bits (270), Expect = 2.320e-24
Identity = 109/392 (27.81%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  231 RKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN--ADSYY------------------QLSNIHND-IRLAAENSAR----NSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRG-EILRMRKTVKQLESRYKVGLKQMSSMQHELK 1328
            R+ +  G   E+ LL +  + E     +  ++  E++  ++     L E+++L     E+ E I   E  R  L++E+K  K +E +++ D ++L EEN+ LQK +  LK+ QVEFE +KHE+KR +EE + L SQLEE  +L +I  + LE AL++L+ EREQK A +KEL  K +   +S Y                   LSNI  D ++L  E++      +SAG++    N        + G  +  +   + S    DL SEL  +++ ++   + +++ E+   +  ++E +  L+  +   ++ +E I  L   L T+      A  G    +E     E  D +   ++ G EI         LE +Y+V + ++S ++ ELK
Sbjct:   16 RRVAEDGESREESLLRENASNEAAHHAQALEMSSELKANRAALSNTLSENERLAAVFVEQRENIEILELQRSRLRDEIKEYKFREARLLQDYTELEEENISLQKQVSTLKENQVEFESVKHEIKRLEEEVEFLQSQLEESLRLKEIGERQLEEALDALKTEREQKNALRKELAAKGHGTGESLYAAPGGPGAAAAAVAAAVAHLSNISLDGLKLGDESNGSSALDSSAGSEELASNGQSHKLNGDYGKAMYRKAPGLVS----DLLSELNISEVQKLKQQLMQVEREKAALLVTLQEAQRQLDHMKGALSEQRERIARLSEHLGTMKQLQARAQRGRATKDERDGAVEEGDGYYEVDINGPEI---------LECKYQVAVMEVSDLRSELK 394          
BLAST of Protein bicaudal D vs. Ensembl Nematostella
Match: EDO45405 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT63])

HSP 1 Score: 145.206 bits (365), Expect = 3.537e-36
Identity = 84/134 (62.69%), Postives = 110/134 (82.09%), Query Frame = 3
Query: 1884 LQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRER 2285
            L+ Q+VKL+S+L TKR+QI+T R VL+ANK+T E ALANLK +YEN+K V  +++ +L+  LKA K +AATFASLR+MFA RC+EYV QLDELQ +L AAE+EK+T+N LL+ AI QK+ALTQRLE+ E+ RER
Sbjct:  434 LRGQVVKLQSLLATKREQISTFRTVLKANKSTYEVALANLKSRYENDKAVQAESVAQLKRNLKAFKAEAATFASLRSMFAARCEEYVVQLDELQGKLMAAEEEKKTLNQLLKQAIHQKIALTQRLEEFEIARER 567          
BLAST of Protein bicaudal D vs. Ensembl Nematostella
Match: EDO45406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT64])

HSP 1 Score: 80.8777 bits (198), Expect = 2.019e-17
Identity = 61/181 (33.70%), Postives = 103/181 (56.91%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHIL 551
            MS++E L+ EV  L SEL +A+++K  AA++GL +LE+ + L+ +    E + + L+ E E  K+  E+     +K S  G   E+DL+ ++ + E     +I DLE E+R  K      L ESD+   QI+   +EI       ++L+ E + LKH+E + + + S+L EEN+ LQK ++
Sbjct:    1 MSSLEFLRGEVERLNSELQQASQEKCQAAEYGLAVLEEKQKLQDQYEELEASCDSLRQEYECLKEAHEQLKLEQQKRSKFGDDREEDLVKESESREASFIHKIADLENELRHSKKSEKECLLESDRKTNQISNLFKEIEQLNQTNKQLRTEARQLKHREAKHLQEYSELEEENINLQKQVI 181          
BLAST of Protein bicaudal D vs. Ensembl Medaka
Match: bicd2 (protein bicaudal D homolog 2 [Source:NCBI gene;Acc:101162517])

HSP 1 Score: 270.781 bits (691), Expect = 4.915e-77
Identity = 251/794 (31.61%), Postives = 413/794 (52.02%), Query Frame = 3
Query:   27 LKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKI----NADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETI-----TTFDKLAIDG--------SGDMNE-SITQSESLD-KWT-----GEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELK-RYHTRENVDQSFQSEEELKEEIVRQQVELYNIR-GELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADIIGNLGLVSRED------ISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVS-------HLKSSLSTLIAIVHQ-LQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            L+ EV  L  EL   +++K  AA++GL +LE+ + L+++    E     +K E++  K+   +     RK +  G   E+ L++++ + E   ++++ +L+ E+R  K+       E+D+L     E  E     E  R +L+++++  K +E +++ D S+L EEN+ LQK +L L++ QVEFEG+KHE++R +E++  LHSQLEE  +L +I  + L  +LE+++ EREQK   +KEL + +    +  S +  S +H D  +   ++     G +  +  + D +  +   +      +        DL SEL  +++ ++   + +++ E+   +  ++E +  L++     ++ +E +  L   L  +     T   + A+D          GD  E  I   E L  K+T       ELR E+  +R   ++  +RY+    ++ S   +L+ R  + E + Q+ + E    E+ +R   E      G L  ++++L++ S    +L + V                     C    ETP++VM D       + R+       ++    P+                       E  N +N+V+       HL+ ++     +  Q L   + SS A  D          E    +++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KY++EK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLD++Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E++
Sbjct:   22 LRAEVERLTRELRETSQEKIQAAEYGLAVLEEKQQLKQRFEELESEYETVKQELDQLKEAFGQAHTTHRKVAADGESREESLILESASKEALYQQKVLELQNELRQAKASLSSAQAENDRLASIALEMRESSELAELQRCQLRDDIREFKVREGRLLQDYSELEEENISLQKQVLALRQNQVEFEGLKHEIRRLEEDSQYLHSQLEEAVRLREIAERQLSESLETIKTEREQKATLRKELSHYMTIGGSFGSSFDNSKLHEDSAVIEPDNDDLIRGFENGLVKMSDGDEDNRTAVNKRGDAYKPAPSLVDDLLSELNISEIQKLKQQLSQVEREKAALMNSLQESQKQLDQAYGTVSEQKEAVNRLTENLSAMRKLQATKERQSALDSEKDRDSHDDGDYYELDINGPEILQCKYTVAVSEAGELRQELKTLRAQYQECRTRYEEERARLDSDVQDLRSRLLSLEKISQADKLEVSRLEKELRIASEAAGESLGSLNVAQDELIAFSEELANLYNHV---------------------CMCNNETPNRVMLDYYKEGKAMVRKGEEANSTVTTSPGPEHR--------------------PEPMNVYNLVAIIRDQIRHLQQAVDRTTELSRQRLANLELSSVADKD---------KEACMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKSKYDSEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDDMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQA 765          
BLAST of Protein bicaudal D vs. Ensembl Medaka
Match: BICD2 (protein bicaudal D homolog 2 [Source:NCBI gene;Acc:101171665])

HSP 1 Score: 263.462 bits (672), Expect = 4.921e-74
Identity = 247/787 (31.39%), Postives = 410/787 (52.10%), Query Frame = 3
Query:   21 EILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQ--LSNIHNDIRLAAE-----NSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMD-LFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEE--IVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXX-------ICAVIKETPSKVMADII--GNLGLVSREDISRKDS--------PDDXXXXXXXXXXXXXXXXXXXLS---KEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERS 2288
            E L+ E+  L  EL     +K  AA++GL +LE+ + L+++    E   + ++ E++  K+   +     +K +  G   E+ L+ ++   E   ++R+ DL+ E+R  ++       E+++L     + ++     E  R +L++++K  K +E++++ D ++L EEN+ LQK +  LK++QVEFEG+KHE++R +E+   L+SQLE+  +L +I  + L  ALE+++ ERE K + +KEL + +   DS Y   LS   + ++ + +     N+     G + S   L +    DN       ++        +D L SEL  +++ ++   + +M+ E++  +  +++ +  LE+     ++ QE +  L   L  I          S   NE    S     +   ++ G  +        LE +YKV + +   ++ ELK         QS   EE ++ E  +     +L  +    +  +E+   L    + L    G S  S+  +   L             +C    ETP++VM D    G  G  S E   R+          P+   +     +          +S   +E  N +N+V+ ++  +  L   V +  +      A+ +  S  +  +   ++ +++KLKS+L+TKR+QI TLR VL+ANK TAE AL+NLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQL+E+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E++
Sbjct:   20 EWLRAEIERLSRELTETTNEKIQAAEYGLAVLEEKQQLKQQYDDLEIEYDAVRQELDQVKEAFGQAHSNHKKVAADGESREESLIQESACKEAYYEQRVLDLQTEIRQTRNILTNTQSENERLGVIFQDMKDNCEMVELQRNQLRDDIKEYKFRESRLLQDYTELEEENISLQKQVSVLKQSQVEFEGLKHEIRRLEEDTQFLNSQLEDAIRLKEIAERQLGEALETIKTERELKASLRKELSHYMTIGDSLYHSPLSISLDGLKFSDDTATEPNNDEGLHGYENSFTKLANEIAEDNRVFTPKKEELFCPVPSLVDDLLSELNISEIQKLKQQLMQMEREKVNLLSNLQDSQKQLEQANGALSEHQEKVNRLTENLNAIRKLQASKERQSALDNEKERDSHEDGDYYEVDINGPEI--------LECKYKVAVSEAGELKEELKTLKAEYQSCQSRYDEERIRLENDVTTLGEKLATLEKTSQIDREEKAKLEKELRKLSDVAGESQGSLSVAQDELVTFSEELATLYNHVCMCNNETPNRVMLDFYKEGKGGRSSPEGRGRRSPILLTRGLFPEPGKADLSDGAPSPVSSQPSPVSDHRREPMNIYNLVAIIRDQIKHLQLAVDRTTELSRQRVASLELGSVADKDKEACME-EILKLKSLLSTKREQIATLRTVLKANKQTAEIALSNLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLEEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQT 797          
BLAST of Protein bicaudal D vs. Ensembl Medaka
Match: bicd1a (protein bicaudal D homolog 1 [Source:NCBI gene;Acc:101161483])

HSP 1 Score: 176.792 bits (447), Expect = 3.609e-45
Identity = 102/132 (77.27%), Postives = 120/132 (90.91%), Query Frame = 3
Query: 1896 LVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSN 2291
            ++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+++
Sbjct:  643 ILKLKSLLSTKREQIATLRLVLKANKQTAENALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQTH 774          

HSP 2 Score: 107.071 bits (266), Expect = 4.015e-23
Identity = 101/318 (31.76%), Postives = 164/318 (51.57%), Query Frame = 3
Query:  231 RKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIH--------NDIRLAAENSARNSAGNQLSVQNLDDSNNLD-----NVGLELTNQKHIIESED---AMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETI 1133
            RK +  G   E+ LL ++ + E     R+ +L+ EV   +S       ES++L   + E +E     E  R  ++ E+K  K +ET+++ D ++L EEN+ LQK +  LK++QVE+EG+KHE+K  +EE  +L+SQLE+  +L +I+   LE AL++L+ EREQK   +KEL + I+  D+ Y  +  H          ++   E +A NS G+  +  N++DSN  +     N GL   N  +    +      DLFSEL  ++M ++   M +++ E+            LL   Q   TQ Q   G L  Q E +
Sbjct:   13 RKVAEDGETIEETLLQESASKEAYYMGRLLELQTEVTLSRSVVSNAQAESERLNALLQELQESNEILELQRSRMREEIKEYKFRETRLLQDYTELEEENITLQKLVSTLKQSQVEYEGLKHEIKVLEEETVLLNSQLEDALRLKEISESQLEEALDALKSEREQKNNLRKELAHHISLTDNVYG-AGAHLALTVTGVEGLKFPEEPNAANS-GHPAANGNMEDSNRCNGHLHGNAGLTKMNGDYRAGRKGEGLVPDLFSELNLSEMQKLKQQMLQVEREK----------AALLMNLQESQTQLQHTQGALSEQSERL 318          
BLAST of Protein bicaudal D vs. Ensembl Medaka
Match: bicd1a (protein bicaudal D homolog 1 [Source:NCBI gene;Acc:101161483])

HSP 1 Score: 177.178 bits (448), Expect = 4.783e-45
Identity = 102/132 (77.27%), Postives = 120/132 (90.91%), Query Frame = 3
Query: 1896 LVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSN 2291
            ++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+++
Sbjct:  712 ILKLKSLLSTKREQIATLRLVLKANKQTAENALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQTH 843          

HSP 2 Score: 125.946 bits (315), Expect = 5.956e-29
Identity = 112/347 (32.28%), Postives = 187/347 (53.89%), Query Frame = 3
Query:   30 KDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIH--------NDIRLAAENSARNSAGNQLSVQNLDDSNNLD-----NVGLELTNQKHIIESED---AMDLFSELQRTQMNQMTSDMKKMDEER 1019
            + EV  L  EL  AN +K  AA+ GL +LE+N+ L++K    E     L+ E+E  ++   +     RK +  G   E+ LL ++ + E     R+ +L+ EV   +S       ES++L   + E +E     E  R  ++ E+K  K +ET+++ D ++L EEN+ LQK +  LK++QVE+EG+KHE+K  +EE  +L+SQLE+  +L +I+   LE AL++L+ EREQK   +KEL + I+  D+ Y  +  H          ++   E +A NS G+  +  N++DSN  +     N GL   N  +    +      DLFSEL  ++M ++   M +++ E+
Sbjct:   15 RAEVERLMQELAEANREKIRAAECGLAVLEENQTLKQKHAELETEQESLRKELEQLQEAFGQAYSNQRKVAEDGETIEETLLQESASKEAYYMGRLLELQTEVTLSRSVVSNAQAESERLNALLQELQESNEILELQRSRMREEIKEYKFRETRLLQDYTELEEENITLQKLVSTLKQSQVEYEGLKHEIKVLEEETVLLNSQLEDALRLKEISESQLEEALDALKSEREQKNNLRKELAHHISLTDNVYG-AGAHLALTVTGVEGLKFPEEPNAANS-GHPAANGNMEDSNRCNGHLHGNAGLTKMNGDYRAGRKGEGLVPDLFSELNLSEMQKLKQQMLQVEREK 359          
BLAST of Protein bicaudal D vs. Ensembl Medaka
Match: bicd1a (protein bicaudal D homolog 1 [Source:NCBI gene;Acc:101161483])

HSP 1 Score: 176.407 bits (446), Expect = 4.814e-45
Identity = 102/132 (77.27%), Postives = 120/132 (90.91%), Query Frame = 3
Query: 1896 LVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSN 2291
            ++KLKS+L+TKR+QI TLR VL+ANK TAE ALANLK KYENEK +VT+TM+KLR ELKALKEDAATF+SLRAMFA RCDEYVTQLDE+Q+QL AAEDEK+T+NSLLRMAI QKLALTQRLED+E D E+++
Sbjct:  663 ILKLKSLLSTKREQIATLRLVLKANKQTAENALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEFDHEQTH 794          

HSP 2 Score: 113.235 bits (282), Expect = 4.456e-25
Identity = 130/453 (28.70%), Postives = 223/453 (49.23%), Query Frame = 3
Query:   30 KDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKIN-ADSYYQLSNIHNDIRLAAENSARNSA---GNQ-LSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKT--------VKQLESRYKVGLKQMSSMQHELKRYHTREN 1349
            + EV  L  EL  AN +K  AA+ GL +LE+N+ L++K    E     L+ E+E  ++   +     RK +  G   E+ LL ++ + E     R+ +L+ EV   +S       ES++L   + E +E     E  R  ++ E+K  K +ET+++ D ++L EEN+ LQK +  LK++QVE+EG+KHE+K  +EE  +L+SQLE+  +L +I+   LE AL++L+ EREQK   +KEL + I+  D+ Y            A +S R +    GN  L+  N D        GL               DLFSEL  ++M ++   M +++ E+   +  ++E +  L+  Q   ++  E +  L    E +    +L  +G  ++++   +SE  D        G +L    +         + LE +YKV + ++  ++ ELK    + N
Sbjct:   15 RAEVERLMQELAEANREKIRAAECGLAVLEENQTLKQKHAELETEQESLRKELEQLQEAFGQAYSNQRKVAEDGETIEETLLQESASKEAYYMGRLLELQTEVTLSRSVVSNAQAESERLNALLQELQESNEILELQRSRMREEIKEYKFRETRLLQDYTELEEENITLQKLVSTLKQSQVEYEGLKHEIKVLEEETVLLNSQLEDALRLKEISESQLEEALDALKSEREQKNNLRKELAHHISLTDNVY-----------GAGDSNRCNGHLHGNAGLTKMNGDYRAGRKGEGL-------------VPDLFSELNLSEMQKLKQQMLQVEREKAALLMNLQESQTQLQHTQGALSEQSERLHRLT---ERVNAMKRL--NGDKELDDP-QESEKPDG-------GSLLSSANSHADQDSQGFEILECKYKVAVTEVIDLKAELKALKEKHN 430          
BLAST of Protein bicaudal D vs. Planmine SMEST
Match: SMESG000035031.1 (SMESG000035031.1)

HSP 1 Score: 1596.64 bits (4133), Expect = 0.000e+0
Identity = 894/896 (99.78%), Postives = 895/896 (99.89%), Query Frame = 3
Query:    9 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKXXXXXXXXXXXXICAVIKETPSKVMADIIGNLGLVSREDISRKDSPDDXXXXXXXXXXXXXXXXXXXLSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDXXXXXXXXXXXXLQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTXXXXXXXXXXXXXXXKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQMQQVLRSNNNNFRXXXXXXXXXXXXXQNSVNGVMINPAPPGIIGNAPFFGGGIPSNTRPFNSIQQHPYMPMSSHQHPLSTYQPPRQTTXXXXXXXXXXXXXXXXXXXXXXXNVITPPQSNSLIHKANQN 2696
            MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKSSLATLALLYTSICAVIKETPSKVMADIIGNLGLVSREDISRKDSPDDSLSSEFGESSVFSGESYEELSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDNSSSMNSAEAEELQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTQLDELQQQLQAAEDEKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQMQQVLRSNNNNFRPSTPMSSMPLTSSQNSVNGVMINPAPPGIIGNAPFFGGGIPSNTRPFNSIQQHP+MPMSSHQHPLSTYQP RQTTTSHPLAIPSSSSSANTSTHSHALNVITPPQSNSLIHKANQN
Sbjct:    1 MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYEQTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLKERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKNEVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRSQEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKINADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELTNQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHLLEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLDKWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQSFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLSTRSMKSSLATLALLYTSICAVIKETPSKVMADIIGNLGLVSREDISRKDSPDDSLSSEFGESSVFSGESYEELSKEVENHHNIVSHLKSSLSTLIAIVHQLQKFKESSNATNDNSSSMNSAEAEELQSQLVKLKSMLTTKRDQINTLRNVLRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASLRAMFAQRCDEYVTQLDELQQQLQAAEDEKRTVNSLLRMAITQKLALTQRLEDVEMDRERSNMQHFQQMQQVLRSNNNNFRPSTPMSSMPLTSSQNSVNGVMINPAPPGIIGNAPFFGGGIPSNTRPFNSIQQHPFMPMSSHQHPLSTYQPLRQTTTSHPLAIPSSSSSANTSTHSHALNVITPPQSNSLIHKANQN 896          
The following BLAST results are available for this feature:
BLAST of Protein bicaudal D vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BICD11.603e-4576.30BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
BICD11.603e-4576.30BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
BICD11.968e-4576.30BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
BICD13.271e-4576.30BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
BICD21.461e-4474.81BICD cargo adaptor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bicd-11.152e-3247.83Protein bicaudal D homolog [Source:UniProtKB/Swis... [more]
bicd-12.728e-3248.33Protein bicaudal D homolog [Source:UniProtKB/Swis... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
BicD7.560e-8733.80gene:FBgn0000183 transcript:FBtr0081002[more]
BicD7.560e-8733.80gene:FBgn0000183 transcript:FBtr0330225[more]
BicD2.080e-8633.80gene:FBgn0000183 transcript:FBtr0330226[more]
BicD1.167e-8533.85gene:FBgn0000183 transcript:FBtr0305688[more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bicd1a2.581e-7632.84bicaudal D homolog 1a [Source:ZFIN;Acc:ZDB-GENE-08... [more]
BICD29.862e-7233.43zgc:171572 [Source:NCBI gene;Acc:100330881][more]
BICD21.732e-7134.21zgc:171572 [Source:NCBI gene;Acc:100330881][more]
CR854830.16.883e-7133.56bicaudal D homolog 1a [Source:NCBI gene;Acc:556758... [more]
bicd21.514e-4659.57bicaudal D homolog 2 (Drosophila) [Source:ZFIN;Acc... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000024155.12.456e-7732.56FYVE, RhoGEF and PH domain containing 3 [Source:NC... [more]
ENSXETT00000043549.12.689e-7734.40BICD cargo adaptor 2 like [Source:NCBI gene;Acc:10... [more]
ENSXETT00000023986.15.580e-7732.56FYVE, RhoGEF and PH domain containing 3 [Source:NC... [more]
ENSXETT00000023973.11.307e-7632.56FYVE, RhoGEF and PH domain containing 3 [Source:NC... [more]
BICD17.509e-5130.00BICD cargo adaptor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bicd11.258e-4576.30BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:11... [more]
Bicd11.261e-4576.30BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:11... [more]
Bicd11.572e-4576.30BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:11... [more]
Bicd12.286e-4576.30BICD cargo adaptor 1 [Source:MGI Symbol;Acc:MGI:11... [more]
Bicd23.330e-4547.33BICD cargo adaptor 2 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Protein bicaudal D vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16568|BICD_DROME7.578e-8633.80Protein bicaudal D OS=Drosophila melanogaster OX=7... [more]
sp|Q8BR07|BICD1_MOUSE1.100e-4476.30Protein bicaudal D homolog 1 OS=Mus musculus OX=10... [more]
sp|Q96G01|BICD1_HUMAN1.571e-4476.30Protein bicaudal D homolog 1 OS=Homo sapiens OX=96... [more]
sp|Q921C5|BICD2_MOUSE3.825e-4447.33Protein bicaudal D homolog 2 OS=Mus musculus OX=10... [more]
sp|Q8TD16|BICD2_HUMAN7.014e-4474.81Protein bicaudal D homolog 2 OS=Homo sapiens OX=96... [more]
back to top
BLAST of Protein bicaudal D vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FTP43.569e-13139.76Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PXF95.239e-13139.87Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183SY143.550e-13039.87Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7E6944.237e-13039.87Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0R3SBG25.006e-12736.46Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bicd28.055e-8230.92protein bicaudal D homolog 2 [Source:NCBI gene;Acc... [more]
BICD24.674e-8132.20protein bicaudal D homolog 2-like [Source:NCBI gen... [more]
BICD25.517e-8132.20protein bicaudal D homolog 2-like [Source:NCBI gen... [more]
bicd26.657e-8132.38protein bicaudal D homolog 2 [Source:NCBI gene;Acc... [more]
BICD27.996e-8132.20protein bicaudal D homolog 2-like [Source:NCBI gen... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bicd1a2.288e-4374.07bicaudal D homolog 1a [Source:ZFIN;Acc:ZDB-GENE-08... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein bicaudal D vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO454053.537e-3662.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454062.019e-1733.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein bicaudal D vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bicd24.915e-7731.61protein bicaudal D homolog 2 [Source:NCBI gene;Acc... [more]
BICD24.921e-7431.39protein bicaudal D homolog 2 [Source:NCBI gene;Acc... [more]
bicd1a3.609e-4577.27protein bicaudal D homolog 1 [Source:NCBI gene;Acc... [more]
bicd1a4.783e-4577.27protein bicaudal D homolog 1 [Source:NCBI gene;Acc... [more]
bicd1a4.814e-4577.27protein bicaudal D homolog 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein bicaudal D vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000035031.10.000e+099.78SMESG000035031.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014979 ID=SMED30014979|Name=Protein bicaudal D|organism=Schmidtea mediterranea sexual|type=transcript|length=3196bp
TTTAATAAATGTCTACTATTGAAATTTTGAAAGATGAAGTTGCATACTTA
AAAAGTGAATTAGATCGGGCTAATGAACAGAAAAATGATGCAGCTAAACA
CGGATTAAATCTTTTGGAAGATAATGAAAATTTACGTAAAAAAGTTTTTC
ATTATGAACAAACTATCAATGACTTAAAATACGAAATCGAGTTATATAAA
AAAGACGCCGAAGAAAAAAGCCGCTTGTTACGAAAGGCAAGTGTAGTCGG
TTATCAGGAAGAGGACGACTTATTAATGCAAACTACAAATACTGAGATGC
AGTTGAAAGAAAGAATTCGAGATTTAGAAATGGAAGTTCGCACATTAAAA
AGTCGTTTTGATAGACAGTTGGAAGAAAGTGATAAATTAATTCAACAAAT
TACGGAGAAAGAAGAGGAAATAGTTACATGTGAGAATATTCGACGTGAAT
TAAAAAACGAAGTGAAAATTCTGAAACATAAAGAAACTCAAATGATTGGC
GACAATAGTGATCTTGCGGAAGAAAATCTGTGTTTACAAAAACACATTTT
GCAATTGAAAAAGGCTCAGGTGGAATTCGAGGGAATTAAGCACGAATTAA
AGCGCAGTCAAGAAGAAAACGATATTCTCCACAGCCAATTAGAGGAGATC
AATAAATTGTTGCAAATAAATGGCAAATCGCTGGAAAATGCACTGGAATC
GTTGCAGTTGGAACGGGAACAGAAATATGCGTTCAAGAAAGAGTTGGAAA
ACAAAATCAACGCCGATTCATATTACCAATTGAGTAATATTCACAACGAC
ATCCGATTGGCTGCCGAGAATTCCGCACGAAACTCGGCTGGCAACCAGCT
GAGCGTGCAGAATTTGGACGATTCTAATAACCTCGACAATGTGGGTTTAG
AATTAACCAATCAAAAGCACATAATTGAAAGTGAAGATGCAATGGATTTA
TTTTCTGAATTGCAACGAACGCAAATGAATCAAATGACTTCGGATATGAA
AAAAATGGACGAAGAAAGATTAGAGTCGATTAGACAAATAAAAGAACTGA
AACATTTACTAGAAAAACACCAAAGAGAAGCAACTCAAAGTCAGGAAATA
ATCGGCGAACTGAAATCACAGCTGGAAACCATTACAACATTTGATAAATT
GGCCATTGATGGATCTGGTGATATGAATGAATCGATTACTCAAAGTGAAT
CTCTCGACAAATGGACAGGCGAGGAATTACGAGGGGAAATTTTGAGAATG
AGGAAAACCGTTAAACAATTAGAAAGTCGATACAAAGTCGGATTAAAACA
AATGTCGAGTATGCAGCATGAGTTGAAACGATATCACACTCGGGAAAATG
TTGACCAGAGTTTCCAATCGGAAGAAGAACTCAAAGAGGAAATAGTTCGA
CAACAAGTTGAGTTGTATAATATTAGAGGTGAACTAAAATCATCGAAAGA
AGATCTAGTTTCATTGTCAACTAATTATCAACATTTGCTTTCGGAAGTAG
GATTGTCAACAAGAAGCATGAAATCATCGTTAGCCACTTTAGCGTTACTC
TACACATCGATCTGTGCAGTTATTAAAGAAACACCATCAAAAGTAATGGC
AGATATAATCGGCAATCTTGGACTCGTTTCTCGTGAGGATATTTCCCGGA
AAGATTCTCCAGACGATTCTCTTTCATCGGAGTTCGGAGAATCTTCAGTA
TTCAGTGGAGAATCCTATGAAGAGTTGTCGAAAGAAGTTGAAAATCACCA
CAATATCGTGAGCCATCTGAAAAGCTCACTGTCAACATTGATAGCAATCG
TTCATCAGTTACAAAAATTCAAAGAAAGCAGCAATGCAACCAATGACAAT
AGTAGTTCAATGAATTCGGCTGAGGCTGAGGAATTGCAGTCTCAACTCGT
TAAACTCAAGTCAATGCTTACCACAAAGCGAGATCAAATCAATACATTGC
GCAACGTTTTACGGGCTAATAAGGCCACGGCTGAGACTGCTTTGGCGAAT
TTGAAACAGAAATATGAAAATGAAAAAGTTGTGGTGACTGATACGATGGT
TAAATTGAGAACCGAATTGAAAGCCTTAAAAGAAGATGCGGCAACGTTTG
CGTCATTGCGAGCTATGTTTGCGCAGAGATGCGATGAATATGTCACCCAG
CTCGATGAATTGCAACAGCAACTACAGGCAGCTGAAGATGAAAAACGTAC
GGTTAATTCACTGCTTCGAATGGCAATTACTCAAAAATTGGCTTTGACTC
AGCGATTAGAAGATGTCGAAATGGACCGTGAAAGGAGTAACATGCAACAC
TTCCAGCAAATGCAACAAGTCCTACGAAGTAATAATAATAATTTCCGTCC
ATCAACTCCAATGAGCAGCATGCCTTTGACTTCAAGCCAAAACTCAGTGA
ACGGTGTAATGATCAATCCAGCACCTCCTGGAATAATTGGCAATGCACCG
TTTTTCGGTGGTGGTATTCCATCTAATACGCGACCATTTAATAGCATTCA
GCAGCATCCGTATATGCCAATGTCATCTCATCAGCATCCGTTGTCGACTT
ATCAACCACCTCGTCAAACCACTACTAGTCACCCGCTCGCTATTCCTTCT
TCATCGTCATCAGCAAATACATCCACACATTCACACGCTCTCAATGTTAT
CACACCACCTCAGTCGAATTCACTCATTCATAAAGCAAATCAGAATAAAG
TAAGTCTTTTTTATTTATGGTATTATTTATGGGTTTCTCTCTCTCTTCTC
TCTCTCAAGATCTCCCGTAGGATGACTGCAATTTTTAAAAAAGTTGGTAT
AAAAAAATCTCGGAGAAAATCTATATTTAAATAAATAATCTCGAACCGCC
AGATTAGATATAAATATATTCCTATAATGAGCGGGATAGTCTTGTTTGAA
TAAATGATCTTATAAAATCTGGTTGACGTGTTTCTTTCATTGTCTTTGGG
CTGATACTTTTGTAAATCTTTAAGGTGATTTTGTAGGTATGCACGGGTAA
ATGGTAATTCCACAAGTGGGCATTCTGATTTCATCAAAACAAGCTGAAAT
CCCAATTACTAAAAGTAGTAGCCTCATAAAGTACAATTTTAGTAAATGAA
ATTCATATTTCACAAGTAAAAGATTTTATAATTAAAAATACATACATTAT
TATTGAAAATACATTTCACCATTAAAAGTACAGATTTCATCAATAA
back to top

protein sequence of SMED30014979-orf-1

>SMED30014979-orf-1 ID=SMED30014979-orf-1|Name=SMED30014979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=942bp
MSTIEILKDEVAYLKSELDRANEQKNDAAKHGLNLLEDNENLRKKVFHYE
QTINDLKYEIELYKKDAEEKSRLLRKASVVGYQEEDDLLMQTTNTEMQLK
ERIRDLEMEVRTLKSRFDRQLEESDKLIQQITEKEEEIVTCENIRRELKN
EVKILKHKETQMIGDNSDLAEENLCLQKHILQLKKAQVEFEGIKHELKRS
QEENDILHSQLEEINKLLQINGKSLENALESLQLEREQKYAFKKELENKI
NADSYYQLSNIHNDIRLAAENSARNSAGNQLSVQNLDDSNNLDNVGLELT
NQKHIIESEDAMDLFSELQRTQMNQMTSDMKKMDEERLESIRQIKELKHL
LEKHQREATQSQEIIGELKSQLETITTFDKLAIDGSGDMNESITQSESLD
KWTGEELRGEILRMRKTVKQLESRYKVGLKQMSSMQHELKRYHTRENVDQ
SFQSEEELKEEIVRQQVELYNIRGELKSSKEDLVSLSTNYQHLLSEVGLS
TRSMKSSLATLALLYTSICAVIKETPSKVMADIIGNLGLVSREDISRKDS
PDDSLSSEFGESSVFSGESYEELSKEVENHHNIVSHLKSSLSTLIAIVHQ
LQKFKESSNATNDNSSSMNSAEAEELQSQLVKLKSMLTTKRDQINTLRNV
LRANKATAETALANLKQKYENEKVVVTDTMVKLRTELKALKEDAATFASL
RAMFAQRCDEYVTQLDELQQQLQAAEDEKRTVNSLLRMAITQKLALTQRL
EDVEMDRERSNMQHFQQMQQVLRSNNNNFRPSTPMSSMPLTSSQNSVNGV
MINPAPPGIIGNAPFFGGGIPSNTRPFNSIQQHPYMPMSSHQHPLSTYQP
PRQTTTSHPLAIPSSSSSANTSTHSHALNVITPPQSNSLIHKANQNKVSL
FYLWYYLWVSLSLLSLKISRRMTAIFKKVGIKKSRRKSIFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008093cytoskeletal adaptor activity
GO:0070840dynein complex binding
GO:0003688DNA replication origin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003133T_Ag_DNA-bd
IPR018477BICD
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 89..158
NoneNo IPR availableCOILSCoilCoilcoord: 648..675
NoneNo IPR availableCOILSCoilCoilcoord: 183..249
NoneNo IPR availableCOILSCoilCoilcoord: 4..31
NoneNo IPR availableCOILSCoilCoilcoord: 404..424
NoneNo IPR availableCOILSCoilCoilcoord: 39..73
NoneNo IPR availableCOILSCoilCoilcoord: 623..643
NoneNo IPR availableCOILSCoilCoilcoord: 337..371
NoneNo IPR availableCOILSCoilCoilcoord: 701..735
NoneNo IPR availableTMHMMTMhelixcoord: 900..919
IPR018477Bicaudal-D proteinPFAMPF09730BicDcoord: 75..755
e-value: 9.9E-128
score: 427.6
IPR018477Bicaudal-D proteinPANTHERPTHR31233FAMILY NOT NAMEDcoord: 3..775