PKD2L-1

Overview
NamePKD2L-1 (AKN21731.1)
Smed IDSMED30014978
Length (bp)2337
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PKD2L-1 (SMED30014978) t-SNE clustered cells

Violin plots show distribution of expression levels for PKD2L-1 (SMED30014978) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PKD2L-1 (SMED30014978) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PKD2L-1 (SMED30014978) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014978SMESG000018514.1 SMESG000018510.1 SmedASXL_014785SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014978SMESG000018514.1 dd_Smed_v6_19322_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014978SMESG000018514.1 SMESG000018510.1 dd_Smed_v6_15626_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014978SMESG000018514.1 SMESG000018510.1 dd_Smed_v6_15626_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
oocyteSMED30014978SMESG000018510.1 Contig29597newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30014978SMESG000018510.1 Contig29597uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014978SMESG000018510.1 Contig29597newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014978SMESG000018510.1 Contig29597uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014978SMESG000018510.1 Contig29597newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014978SMESG000018510.1 Contig29597uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD2L-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 184.882 bits (468), Expect = 3.004e-86
Identity = 101/256 (39.45%), Postives = 155/256 (60.55%), Query Frame = 3
Query:  180 EDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
              +   + + I TTL+EL +Y +FL  L I+ FGM    MY+L  ++++LF++  V      +F S+ S  DFW F +GPLL GLYW+SWYNN  + +    + IY+EN L+G+ R+RQ++V + +C + + FQ ++  CY  Y++  E    FGLQ +T W Y+  +N  S    G +  Y  GGY   L   +    +   +L  N WI RGTR + +DF++YNAN+NLFC+I+L+AEFPA GG++  + F +V
Sbjct:   15 HKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYS-TSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSV 269          

HSP 2 Score: 155.992 bits (393), Expect = 3.004e-86
Identity = 139/381 (36.48%), Postives = 223/381 (58.53%), Query Frame = 2
Query:  932 NC*ITEILFXXXXXXXXXXXXXXXXXSYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNEL-INQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENM 2071
            +C IT  +F+  +T +E+ +IK  K +YFKS+WN L+++++ + F+ + FN Y  V +  +L  LL +  ++ +F +L+ +   +N ++AIT+F AW+KIFK+ISFNKTM+QLSSTL RC KD+ GFA+MFFIIFFA+AQLG+L+FG+++  F     SIF  +RI+LGDF F     A+ I GP+YF+ ++FFV FVL NMFLAIINDTYSE+K +  I ++ +FE+G   K+  + +         +   L+ A  + D    G  D  E     + +GF              D N + +A +  + + +LE  K   + EI  +   +   E ++ F++ V             E+E  ++ + LK+N V++ +  +
Sbjct:  284 SCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNV--------LEKFRLKKAQKDEDKKTKGSGDLAE---QARREGF--------------DENEIQNAEQMKKWKERLE--KKYYSMEIQDDYQPVTQEEFRELFLYAV-------------ELEKELHYINLKLNQVVRKVSAL 624          
BLAST of PKD2L-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 185.267 bits (469), Expect = 1.116e-85
Identity = 101/256 (39.45%), Postives = 155/256 (60.55%), Query Frame = 3
Query:  180 EDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
              +   + + I TTL+EL +Y +FL  L I+ FGM    MY+L  ++++LF++  V      +F S+ S  DFW F +GPLL GLYW+SWYNN  + +    + IY+EN L+G+ R+RQ++V + +C + + FQ ++  CY  Y++  E    FGLQ +T W Y+  +N  S    G +  Y  GGY   L   +    +   +L  N WI RGTR + +DF++YNAN+NLFC+I+L+AEFPA GG++  + F +V
Sbjct:   15 HKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYS-TSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSV 269          

HSP 2 Score: 153.68 bits (387), Expect = 1.116e-85
Identity = 114/234 (48.72%), Postives = 169/234 (72.22%), Query Frame = 2
Query:  932 NC*ITEILFXXXXXXXXXXXXXXXXXSYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNEL-INQKNEFEIGDYFKE 1630
            +C IT  +F+  +T +E+ +IK  K +YFKS+WN L+++++ + F+ + FN Y  V +  +L  LL +  ++ +F +L+ +   +N ++AIT+F AW+KIFK+ISFNKTM+QLSSTL RC KD+ GFA+MFFIIFFA+AQLG+L+FG+++  F     SIF  +RI+LGDF F     A+ I GP+YF+ ++FFV FVL NMFLAIINDTYSE+K +  I ++ +FE+G   K+
Sbjct:  284 SCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQ 517          
BLAST of PKD2L-1 vs. Ensembl Human
Match: PKD2L1 (polycystin 2 like 1, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9011])

HSP 1 Score: 259.61 bits (662), Expect = 1.819e-74
Identity = 127/268 (47.39%), Postives = 177/268 (66.04%), Query Frame = 3
Query:  135 RFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
                G+R +W T  TE+   NR LYI+TTLREL +YIVFL  + ++ +GMT+ + Y+ T +++ LF++   +   SF +++S ADFW FAQGPLL+ LYW  WYNN ++     +FIY+EN L+G+ RLRQ++V + SC++  +F++ I  CY  YS   E   PFG  N TAWTY  Q  LG     G +++Y GGGYY+DLP  +  +   L  L   LW+DRGTR V +DF+VYNANINLFCV++L+ EFPA GG IP +  +TV
Sbjct:   72 HICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTV 339          

HSP 2 Score: 227.639 bits (579), Expect = 5.104e-63
Identity = 160/363 (44.08%), Postives = 235/363 (64.74%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEI---ESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMD 2074
            Y  S+WNILD+VVI +S + + F+I+RT+ V  ++  LL   N + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFAVMFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ I GP YF+ YVFFV FVL NMFLAIINDTYSE+K EL  QK+E ++ D  K+     L +L L+K+++  +Q  L   +      + F+++   ++E G   +EI    + F+++D DGNR+LD  EQ +M+  LE ++ A+N EI      I +S   K+          VS +E+  L  R+ ++E V+  +V +I+ V   L+ ++
Sbjct:  381 YLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQE----IQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLE 739          
BLAST of PKD2L-1 vs. Ensembl Human
Match: PKD2 (polycystin 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9009])

HSP 1 Score: 227.639 bits (579), Expect = 2.706e-62
Identity = 170/432 (39.35%), Postives = 264/432 (61.11%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG-------------------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSE--EERKVKIGNMVQEELIKLNQDAVLTQ 2227
            YF+S WN LDVV++ +S + I  NIYRT  V+ +L+  L + N  PNF++L+Y+Q  FN + A+TVF  W+K+FK+I+FN+TM+QLS+T+ RC+KDL GFA+MFFIIF A+AQL YL+FGT++  F      IFT +RIILGD  F +   A+ + GP+YF  +VFF+ F+L NMFLAIINDTYSE+K++L  QK E E+ D  ++     L KL LKK+ +D +  +L        G ++FDE +  ++ KG    EIE++F++YD DG++ L  +E  +M++ LE ++  ++     + S +P   S ++F                            VS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR+ + ++L  ++  E L    E  + ++  +V+EEL +   D   +Q
Sbjct:  502 YFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQ-FLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLD----LDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQ 924          

HSP 2 Score: 225.713 bits (574), Expect = 1.285e-61
Identity = 114/271 (42.07%), Postives = 171/271 (63.10%), Query Frame = 3
Query:  132 NRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGS--FNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             R   G+R +W T+  E+   NR  Y+++ LREL  Y++FL +L I+ +GM +  +Y+ T +++ LF++  V+ T    F +++S  DFW F +G LL+GLYW    +N   +    +FI++EN L+G+ R+RQ+RV + SC I  + +  IK CY  YS   E   PFG +N TAW YT + +L      G I+TY G GYY+DL   +    + + +L  N+W+DRGTRA  +DF+VYNANINLFCV++L+ EFPA GGVIP + F+ +
Sbjct:  191 ERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSN-QTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPL 460          
BLAST of PKD2L-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 186.037 bits (471), Expect = 9.320e-53
Identity = 101/256 (39.45%), Postives = 155/256 (60.55%), Query Frame = 3
Query:  180 EDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
              +   + + I TTL+EL +Y +FL  L I+ FGM    MY+L  ++++LF++  V      +F S+ S  DFW F +GPLL GLYW+SWYNN  + +    + IY+EN L+G+ R+RQ++V + +C + + FQ ++  CY  Y++  E    FGLQ +T W Y+  +N  S    G +  Y  GGY   L   +    +   +L  N WI RGTR + +DF++YNAN+NLFC+I+L+AEFPA GG++  + F +V
Sbjct:   15 HKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYS-TSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSV 269          

HSP 2 Score: 43.1282 bits (100), Expect = 9.320e-53
Identity = 38/121 (31.40%), Postives = 75/121 (61.98%), Query Frame = 2
Query:  932 NC*ITEILFXXXXXXXXXXXXXXXXXSYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSS--TLGR 1288
            +C IT  +F+  +T +E+ +IK  K +YFKS+WN L+++++ + F+ + FN Y  V +  +L  LL +  ++ +F +L+ +   +N ++AIT+F AW+K       N T +++ +  ++GR
Sbjct:  284 SCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKNMFLAIINDTYSEVKADYSIGR 404          
BLAST of PKD2L-1 vs. Ensembl Celegans
Match: pkd-2 (Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U1S7])

HSP 1 Score: 147.132 bits (370), Expect = 1.874e-36
Identity = 87/227 (38.33%), Postives = 133/227 (58.59%), Query Frame = 3
Query:  240 YIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQ-VNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLP-SDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVI 914
            Y VFL +L+ +AF   +   Y+ + ++++LFV     +   +F S  S  + W +    L+ G+YW    N+ + +    N IY+EN+L+G  R+R ++V++ SC +   FQ+ IK C+  Y  ++E     G  +  A+ Y     L +L   G+I++YGGGG+   LP +    A S +  L  N WIDRG+RA+IVDF +YNANINLFCV+KL+ E PA GGVI
Sbjct:   80 YAVFLIVLVYVAFAQNSIQSYYYSKVMSDLFVASTGASGAPAFGSCTSMDNIWDWLSQVLIPGIYWTETSNSTDNE----NMIYYENRLLGEPRIRMLKVTNDSCTVMKSFQREIKECFANYEEKLEDKTMVGDGSVDAFIYATAKELENLKTVGTIASYGGGGFVQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVI 302          

HSP 2 Score: 133.65 bits (335), Expect = 4.189e-32
Identity = 121/357 (33.89%), Postives = 196/357 (54.90%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMD---FDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMD 2074
            Y    WN++DVV++G S   II ++ RT      + S++ N   +  FD ++  + ++  + A  VF+AWVK+FK+IS NKTM+QLSSTL R +KD+ GFAVMF + FFAFAQ GYL FGT++  +  L+ S F L R+ILGDF F    + +  FGP +F+ YVFFV F+L NMFLAIIND+Y E+K EL  +K+   I D+F  + +                   LT      D   +   ++++K  +   G+   +I   F+R++              + +  E+    V  +I  E + +  +E K+ ++   +  +Y +LN R+++M+  + ++V +I  V   L+ ++
Sbjct:  352 YLTQFWNLVDVVLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDVTSSENSYLNIKACVVFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCFGTQIADYSNLYNSAFALLRLILGDFNFSALESCNRFFGPAFFIAYVFFVSFILLNMFLAIINDSYVEVKAELARKKDGEGILDWFMNKVR------------------GLTKRGKRPDAPGEDATYEDYKLMLYRAGYAEKDINEAFTRFN--------------VTSMTEHVPEKVAEDIADEVARM--TEQKRNYME--NHRDYANLNRRVDQMQESVFSIVDRIEGVNATLQTIE 672          
BLAST of PKD2L-1 vs. Ensembl Celegans
Match: lov-1 (Location of vulva defective 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09624])

HSP 1 Score: 77.411 bits (189), Expect = 3.482e-14
Identity = 76/293 (25.94%), Postives = 135/293 (46.08%), Query Frame = 3
Query:   99 NDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYW----LTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKL---IGLARLRQVRVSDKS-CIIANEFQKIIKRCYVTYSTQIESTEPF------------GLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIP 917
            N   K++ G     ++    +   + TE+ K  R+  +  T+R++  +   L I++++ +       YW    ++ +LN   +N +     +F S+  + DFW +A+  L   L   SWY+    + +     Y  +K+   +G+  +RQVR    + C +  +FQ  I  C    +++ E    +            G   S  +TY     L +  + G + +Y GGGY + +   Q    +L N L +  WID  TRAVI++F+ YNA IN F V++L+ E P  G  +P
Sbjct: 2640 NPYGKIEKGLGTEIAD----VTKLRDTENRKM-RDEQLFITIRDMLCFFASLYIMVMLTYYCKDRHGYWYQLEMSTILN---INQKNYGDNTFMSIQHADDFWDWARESLATAL-LASWYDG---NPAYGMRAYMNDKVSRSMGIGTIRQVRTKKSAECTMFKQFQGYINDCGEELTSKNEEKTLYMQAGWTELESENGTDASDEYTYKTSEELSTETVSGLLYSYSGGGYTISMSGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEIPKSGIYLP 2920          
BLAST of PKD2L-1 vs. Ensembl Fly
Match: Pkd2 (gene:FBgn0041195 transcript:FBtr0080365)

HSP 1 Score: 131.724 bits (330), Expect = 4.261e-31
Identity = 91/211 (43.13%), Postives = 136/211 (64.45%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMM 1645
            YF S+ NILD  ++   ++ +++NI+ +  V + L +   +D  + + D L ++   +  ++AI  FL W+KIFK+ISFNKT+ Q ++TL RCSKDLAGF++MF I+F A+AQLG LLFGTK   FR    SI T+ R+ILGDF +     A+ + GP+YFL Y+  V F+L NMFLAII +TY+ +K E+   ++   +G Y   +   M
Sbjct:  618 YFCSMLNILDCAILLGCYLALVYNIWHSFKVMS-LTARAHSDVTYQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETYNTVKGEITQGRS--HLGSYIYRKLSGM 825          

HSP 2 Score: 92.8189 bits (229), Expect = 5.404e-19
Identity = 59/168 (35.12%), Postives = 90/168 (53.57%), Query Frame = 3
Query:  435 NSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            +S   N++    E     +EN L+G  RLRQ+RV  +SC + + F +    CY  YS+  E  +P          +    +L S PI   ++ Y  GGY V+L  D+     ++N+L +  W+DRG+R  +V+F ++N N ++F  IKLIAE P  GGVIP    +TV
Sbjct:  412 DSIQANMSFHHLEGRVFLYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAEDRKPM----HKGSPFRTMHDLDSTPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTV 575          
BLAST of PKD2L-1 vs. Ensembl Zebrafish
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 236.498 bits (602), Expect = 2.751e-122
Identity = 158/353 (44.76%), Postives = 242/353 (68.56%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIIS-EQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLE 2065
            S+F S+WNILD+VVI ++ + I+F+ +RT+ V  +L +LL   + + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQL+STL RC+ D+ GFA+MFFI+FFA+AQLGYLLFGT++  F   +  IFT +RIILGDF +     A+ + GP+YF  YVFFV FVL NMFLAIINDTYSE+K+EL +QK+EF+I D  K+       KL LKK+K+  +Q AL +  +     ++F +++ A++E G    EI + FS++D DGN+ LD  EQ  M+ +LE ++ A++ E+   E S  P  E + T    V  ++YQ L  ++ ++EN ++ ++ K++ V++ + 
Sbjct:  372 SHFTSIWNILDIVVILLAVVAIVFSAFRTIKVDGLLGNLLKQPDIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLTSTLARCALDIFGFAIMFFIVFFAYAQLGYLLFGTEVETFSTFNKCIFTQFRIILGDFDYDAIDRANRVLGPIYFFSYVFFVFFVLLNMFLAIINDTYSEVKSELASQKDEFQIADLIKQSYAKTFMKLKLKKEKISDVQKALDSGASE----LEFKDFRNALKEMGHSDREISAAFSKFDQDGNQTLDKQEQENMKQELEEKRDALSAELRDLENSVEPAEEHRNT----VPPEDYQRLVHKVSQLENSVSAIMSKLDFVMEKMR 716          

HSP 2 Score: 224.172 bits (570), Expect = 2.751e-122
Identity = 117/274 (42.70%), Postives = 170/274 (62.04%), Query Frame = 3
Query:  117 KYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            K G  + F   ++ +W T   +D K N  L ++  L+EL IYIVFL  L ++ +GMT+   Y+ T  + +LFVN   +N  SF+S+    D WT+ +GPLL+ LYW  WYN+  ++    +FIY+EN L+G+ R+RQ++V   SC +  +F+K I  C+  Y+ + E    FGL N TAW Y  +  +      G ++TY G G+Y DL + +  + +LL +L  NLW+DRGTR + +DFT YNANINLFCVI+L+ EFPA GG IP Y  +TV
Sbjct:   58 KSGCCSFFFRAIKGLWGTALRKDTKENPELNVKANLKELLIYIVFLVDLCLLTYGMTSSATYYYTKAMTDLFVNLPGSNGMSFSSIGCMNDVWTYMEGPLLDNLYWTKWYNDEPLENGNQSFIYYENLLLGVPRVRQLKVKQNSCKVPTDFKKEISDCFDVYNIKKEDDGAFGLINGTAWQYHSEKEIKGSSHWGLLTTYSGAGFYQDLTTTRDESAALLEDLRENLWLDRGTRVLFIDFTAYNANINLFCVIRLVVEFPATGGAIPSYQIRTV 331          
BLAST of PKD2L-1 vs. Ensembl Zebrafish
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 232.261 bits (591), Expect = 2.640e-64
Identity = 174/432 (40.28%), Postives = 261/432 (60.42%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG-------------------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLS--EEERKVKIGNMVQEELIKLNQDAVLTQ 2227
            YFKS+WN LDV+++ +S   II NI RT AV   L  LL N + +PNF+ L+  Q  FN L AI VFL+WVK+FK+I+FNKTM QLS+T+ RC+KDL GFA+MFFI+F A+AQL YL+FGT++  F      IFT +RIILGDF F +   AD + GP+YF  +VFF+  +L NMFLAIINDTYSE+K ++  Q++E EI D  K+     + KL LKK  ++ + ++L  A     G + FDE +  ++ KG    EIE++F++YD DG++ L  +E  +M++ LE ++  ++     E S +P   S ++F                            VS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR  + +IL  +   E +    E ++ ++  +V++EL +   D  ++Q
Sbjct:  438 YFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSLQQA----AGKLSFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELTEHEHQQMRDDLEKEREDLDL----EHSSLPRPASGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKMKRRDVLGRILDGVMEDERMGRDPELQREQMDRLVRDELERWESDDTMSQ 861          

HSP 2 Score: 228.794 bits (582), Expect = 4.639e-63
Identity = 116/271 (42.80%), Postives = 179/271 (66.05%), Query Frame = 3
Query:  132 NRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNN--TGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             R    MR +W T+   +  +NR +Y++T LRE+  YI+FL  L II +GM +  MY+ T +++ LF++  +++    +F S+++  DFW F +GP LNG+YW  WYNN ++ +++ + IY+EN L+G+ RLRQ+RV ++SC +  + +  +  CY  YS   E   PFG +N TAW +  +++LG     G +STYGGGGYY DL   +  + + L  L NNLW+DRGTRAV +DF++YN N+NLFC+++L+ EFPA GG +P + F+TV
Sbjct:  127 KRILEKMRVLWDTRLLGESNSNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSGEPTNFKSLSTMEDFWKFTEGPFLNGMYWELWYNNKSLPENQ-SLIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGPKNGTAWRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTV 396          
BLAST of PKD2L-1 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 117.857 bits (294), Expect = 1.833e-26
Identity = 100/304 (32.89%), Postives = 149/304 (49.01%), Query Frame = 3
Query:   45 VEYDAYDEISHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQ-----TTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQ-NST-----------AWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVG 905
            V+ D Y ++S   ++S  +D + V+        +   S +      DI+  RN  I+       +RE+ IY+ FL +L+++A+G      Y+LT+ +   F  G        +   +  D + +A   LL  LY    Y     D +        +KL+G AR+RQVRV   +C IAN  Q  ++ C+  YS + E    +    N T            W Y  Q  L + P+ G ++ Y GGG+ VDL  DQ +A  LL  LF+N W+D  TRAV V+FTVYNAN+NLFC++ LI E   VG
Sbjct: 1917 VDQDEYGDVSIDGTLSNTDDPDAVRIAR----RDSTCSFYKPPPPTDIEKMRNNMIKEQKVFALIREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTG-------ISETLNHKDIFIWANSSLLRNLYGQ--YPGFITDGN--------SKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVG 2199          

HSP 2 Score: 64.3142 bits (155), Expect = 6.747e-10
Identity = 51/187 (27.27%), Postives = 101/187 (54.01%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSE 1570
            +YFKS WN+L++ +I +S+  +   + RT+     +E    N +   +F+  +       YL+A  V LA +K++  +  N  +  ++STL R   D++GF V+  I+F A++    L++G +L  +R L  +  T+  + LG F + + L+ + + G       + F+ FV+ N+F+++I   ++E
Sbjct: 2251 AYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFNE 2437          
BLAST of PKD2L-1 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 114.39 bits (285), Expect = 1.921e-25
Identity = 93/267 (34.83%), Postives = 133/267 (49.81%), Query Frame = 3
Query:  156 SIWATKQTEDIKANRNLYIQ-----TTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQ-NST-----------AWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVG 905
            S +      DI+  RN  I+       +RE+ IY+ FL +L+++A+G      Y+LT+ +   F  G        +   +  D + +A   LL  LY    Y     D +        +KL+G AR+RQVRV   +C IAN  Q  ++ C+  YS + E    +    N T            W Y  Q  L + P+ G ++ Y GGG+ VDL  DQ +A  LL  LF+N W+D  TRAV V+FTVYNAN+NLFC++ LI E   VG
Sbjct:  590 SFYKPPPPTDIEKMRNNMIKEQKVFALIREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTG-------ISETLNHKDIFIWANSSLLRNLYGQ--YPGFITDGN--------SKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVG 839          

HSP 2 Score: 59.3066 bits (142), Expect = 1.847e-8
Identity = 51/187 (27.27%), Postives = 101/187 (54.01%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSE 1570
            +YFKS WN+L++ +I +S+  +   + RT+     +E    N +   +F+  +       YL+A  V LA +K++  +  N  +  ++STL R   D++GF V+  I+F A++    L++G +L  +R L  +  T+  + LG F + + L+ + + G       + F+ FV+ N+F+++I   ++E
Sbjct:  891 AYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFNE 1077          
BLAST of PKD2L-1 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 106.301 bits (264), Expect = 5.567e-23
Identity = 85/254 (33.46%), Postives = 132/254 (51.97%), Query Frame = 3
Query:  213 QTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGL------------QNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            Q  + E+ I++ FL++L+++A+G      ++LT  +   F      + G  +SM ++ D + +A   LL  L+    Y     D +        +KL+G AR+RQVRV   +C +A      + +C   YS   E    +G             +  TAW Y  Q+ L +LP+ G  + Y GGGY +DL  D+ +A   L  LFN+ W+D  TRAV V+FTVYNAN++LFC++ LI E  AVG     + F++V
Sbjct:  517 QALVMEVLIFLGFLSMLLLVAYGQQDPNAFYLTQHIQQSF------SKGISDSMKTN-DVFVWANTVLLKNLFGQ--YPGFITDGN--------SKLVGNARIRQVRVKKDTCKVAKVMLHTVSQCNTPYSWGNEDMMSYGPGWEEFNSVNGSEEGITAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGA----FQFRSV 749          

HSP 2 Score: 53.9138 bits (128), Expect = 7.565e-7
Identity = 47/181 (25.97%), Postives = 96/181 (53.04%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAII 1552
            +YF++ WN+LD+ +I +S+  +   I +TV     ++    + NQ P+F   +    T  Y++A  V L  VK++  +  +  +  ++S+L R   D++   V+ FII  A++    L+FG +L  +R L  +   ++ + +G F + + +N++   G +     V    FV+ ++F++II
Sbjct:  794 AYFRNKWNLLDMAIIILSWSSLSLFIQKTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPALGAVIISSCVLIATFVVLSLFISII 974          
BLAST of PKD2L-1 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 248.054 bits (632), Expect = 1.468e-72
Identity = 125/264 (47.35%), Postives = 182/264 (68.94%), Query Frame = 3
Query:  147 GMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G+R +W T  TE+   NR LYI+TTLREL +YIVFL  + ++ +GMT+   Y+ TN+++ LF++ Q ++  +F ++++  DFW++ QGP+L+GLYW  WYNN+++  +  + IY+EN L+G+ R+RQ++V + SC++  +F+  I  C+  YS   E T  FGL N TAWTY  +  LG     G I+TY GGGYY+DL   +  +   L  L +NLW+DRGTRAV VDF+VYNANINLFCV++L+ EFPA GG IP +  +TV
Sbjct:    6 GIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSTNTYYYTNVMSKLFLDTQSDSGVTFKAISNMDDFWSYLQGPMLDGLYWTKWYNNVSLTDNTNSLIYYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDTSQFGLINGTAWTYYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTV 269          

HSP 2 Score: 186.422 bits (472), Expect = 3.515e-50
Identity = 120/206 (58.25%), Postives = 158/206 (76.70%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKE 1630
            YF S+WNILDV+VI +S + I F+I+RT+ V  ++ +LL N   + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFA+MFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ + GP+YF+ YVFFV FVL NMFLAIINDTYSE+K EL NQKNE +  D  K+
Sbjct:  311 YFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYDAIDNANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELSNQKNELQFSDILKQ 516          
BLAST of PKD2L-1 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 249.595 bits (636), Expect = 1.842e-72
Identity = 125/264 (47.35%), Postives = 182/264 (68.94%), Query Frame = 3
Query:  147 GMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G+R +W T  TE+   NR LYI+TTLREL +YIVFL  + ++ +GMT+   Y+ TN+++ LF++ Q ++  +F ++++  DFW++ QGP+L+GLYW  WYNN+++  +  + IY+EN L+G+ R+RQ++V + SC++  +F+  I  C+  YS   E T  FGL N TAWTY  +  LG     G I+TY GGGYY+DL   +  +   L  L +NLW+DRGTRAV VDF+VYNANINLFCV++L+ EFPA GG IP +  +TV
Sbjct:    6 GIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSTNTYYYTNVMSKLFLDTQSDSGVTFKAISNMDDFWSYLQGPMLDGLYWTKWYNNVSLTDNTNSLIYYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDTSQFGLINGTAWTYYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTV 269          

HSP 2 Score: 149.443 bits (376), Expect = 4.262e-37
Identity = 87/158 (55.06%), Postives = 120/158 (75.95%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGP 1486
            YF S+WNILDV+VI +S + I F+I+RT+ V  ++ +LL N   + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFA+MFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ + GP
Sbjct:  311 YFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYDAIDNANRVLGP 468          
BLAST of PKD2L-1 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 249.595 bits (636), Expect = 9.024e-72
Identity = 125/264 (47.35%), Postives = 182/264 (68.94%), Query Frame = 3
Query:  147 GMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G+R +W T  TE+   NR LYI+TTLREL +YIVFL  + ++ +GMT+   Y+ TN+++ LF++ Q ++  +F ++++  DFW++ QGP+L+GLYW  WYNN+++  +  + IY+EN L+G+ R+RQ++V + SC++  +F+  I  C+  YS   E T  FGL N TAWTY  +  LG     G I+TY GGGYY+DL   +  +   L  L +NLW+DRGTRAV VDF+VYNANINLFCV++L+ EFPA GG IP +  +TV
Sbjct:   82 GIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSTNTYYYTNVMSKLFLDTQSDSGVTFKAISNMDDFWSYLQGPMLDGLYWTKWYNNVSLTDNTNSLIYYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDTSQFGLINGTAWTYYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTV 345          

HSP 2 Score: 149.443 bits (376), Expect = 7.589e-37
Identity = 87/158 (55.06%), Postives = 120/158 (75.95%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGP 1486
            YF S+WNILDV+VI +S + I F+I+RT+ V  ++ +LL N   + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFA+MFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ + GP
Sbjct:  387 YFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYDAIDNANRVLGP 544          
BLAST of PKD2L-1 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 243.432 bits (620), Expect = 5.324e-70
Identity = 123/261 (47.13%), Postives = 179/261 (68.58%), Query Frame = 3
Query:  156 SIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             +W T  TE+   NR LYI+TTLREL +YIVFL  + ++ +GMT+   Y+ TN+++ LF++ Q ++  +F ++++  DFW++ QGP+L+GLYW  WYNN+++  +  + IY+EN L+G+ R+RQ++V + SC++  +F+  I  C+  YS   E T  FGL N TAWTY  +  LG     G I+TY GGGYY+DL   +  +   L  L +NLW+DRGTRAV VDF+VYNANINLFCV++L+ EFPA GG IP +  +TV
Sbjct:   23 GLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSTNTYYYTNVMSKLFLDTQSDSGVTFKAISNMDDFWSYLQGPMLDGLYWTKWYNNVSLTDNTNSLIYYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDTSQFGLINGTAWTYYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTV 283          

HSP 2 Score: 187.193 bits (474), Expect = 6.934e-50
Identity = 120/207 (57.97%), Postives = 159/207 (76.81%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKER 1633
            YF S+WNILDV+VI +S + I F+I+RT+ V  ++ +LL N   + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFA+MFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ + GP+YF+ YVFFV FVL NMFLAIINDTYSE+K EL NQKNE +  D  K++
Sbjct:  325 YFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYDAIDNANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELSNQKNELQFSDILKQQ 531          
BLAST of PKD2L-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 237.654 bits (605), Expect = 1.767e-67
Identity = 120/270 (44.44%), Postives = 181/270 (67.04%), Query Frame = 3
Query:  135 RFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            +  + +R +W T+ TE+    R  Y++   REL  YIVFL I+ ++ + M T  M++ T  ++ LF++G V  +   +F ++ +  DFW F +GPL++GLYW+ WYNN  + ++  +FIY+EN L+G+ RLRQ+RV + SC +  + +  IK CY +YS + E T PFGL+N TAWTYT++ +L      G IS Y G GYY+DL  ++  + + +  L NNLW+DRGTRAV +DF+VYNAN+NLFCV++L+ EFPA GG+I  + F+TV
Sbjct:   21 KLLHRVRGLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTV 289          

HSP 2 Score: 197.208 bits (500), Expect = 5.222e-53
Identity = 131/292 (44.86%), Postives = 195/292 (66.78%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTA 1888
            YF+S+WN LD+V+IG+S   I  ++Y+  +V+  L   L + N  PN + L+Y+Q  FN + A+ VF AWVK+FK+ +FN+TMTQLS+T+ RC+KD+ GFA+MFFIIF A+AQ  YL+FGT++  F    + IFT +RIILGDF F +   A+ I GP+YF  +VFF+ F+L NMFLAIINDTYSE+K ++  QK+E E+ D  K+     + KL LKK  +    + ++ +     G ++FDE +     KG    EIE++F++YD DG++ L  NE  +M++ LE ++ +
Sbjct:  331 YFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTV----DDISESIRQGGGKLNFDELR-----KGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKERVS 613          
BLAST of PKD2L-1 vs. Ensembl Mouse
Match: Pkd2 (polycystin 2, transient receptor potential cation channel [Source:MGI Symbol;Acc:MGI:1099818])

HSP 1 Score: 227.639 bits (579), Expect = 6.967e-120
Identity = 117/271 (43.17%), Postives = 168/271 (61.99%), Query Frame = 3
Query:  132 NRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGS--FNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             R   G+R +W T+  E+  ANR  Y+++ LREL  Y+ FL +L I+ +GM +  +Y+ T  L+ LF++  V+ T    F +++S  DFW F +G  L+GLYW +  +N +      +FI++EN L+G+ RLRQ+RV + SC I  + +  IK CY  YS   E   PFG +N TAW YT +  L      G I++Y G GYY+DL   +    + L  L  N W+DRGTRA  +DF+VYNANINLFCV++L+AEFPA GGV+P + F+ V
Sbjct:  189 ERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSN-HTQADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPV 458          

HSP 2 Score: 224.942 bits (572), Expect = 6.967e-120
Identity = 164/433 (37.88%), Postives = 262/433 (60.51%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG-------------------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSE--EERKVKIGNMVQEELIKLNQDAVLTQ 2227
            SYF+S WN LDVV++ +S + ++ NIYR    + +L+  L + N  PNF++++Y+Q  FN + A+ VFL W+K+FK+I+FN+TM+QLS+T+ RC+KDL GF +MF IIF A+AQL YL+FGT++  F      IFT +RIILGD  F +   A+ + GPLYF  +VFF+ F+L NMFLAIIND+YSE+K++L  QK E E+ D  ++  Q  L KL LK++ +    +A++ +     G ++FDE +  ++ KG    EIE++F++YD DG++ L   E  +M++ LE ++  ++     E S +P   S ++F                            VS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR+ + ++L  ++    L    E  + ++  +V+EEL +   D   +Q
Sbjct:  499 SYFRSFWNCLDVVIVVLSVVAMVINIYRMSNAEGLLQ-FLEDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTV----DAISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDLD----LEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDARLGRDSEIHREQMERLVREELERWESDDAASQ 922          
BLAST of PKD2L-1 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 188.734 bits (478), Expect = 1.904e-90
Identity = 102/257 (39.69%), Postives = 155/257 (60.31%), Query Frame = 3
Query:  180 EDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQ-GSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             D+   R   + TTL EL +Y +FL  L I+ FGM    MY+L  ++++LFV+  +  +   SF S+ S  +FW F +GPL++GLYW+SWY N  +      + IY+EN L+G+ R+RQ+RV + +C +   FQ ++  CY  Y+ + E    FGL+ +  WT+T  +   + P   G +  Y  GGY V L   +    +   +L  N WI RGTRAV +DF++YNAN+NLFC+I+L+AEFPA GG++  + F +V
Sbjct:   15 HDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSR--TAPWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSV 269          

HSP 2 Score: 165.622 bits (418), Expect = 1.904e-90
Identity = 103/203 (50.74%), Postives = 150/203 (73.89%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNEL-INQKNEFEIG 1615
            +YF+SVWN L+++++ + F+ + F  Y  +    +L  LL N + +P+F +L+Y+   +N ++AIT+F AW+KIFK+ISFN+TM+QLSSTL RC KD+ GFA+MFFIIF A+AQLG+L+FG+++  F     SIF  +RI+LGDF F     A+ I GP+YF+ ++FFV FVL NMFLAIINDTYSE+K +  I ++ +FE+G
Sbjct:  310 AYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELG 512          
BLAST of PKD2L-1 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 188.734 bits (478), Expect = 1.904e-90
Identity = 102/257 (39.69%), Postives = 155/257 (60.31%), Query Frame = 3
Query:  180 EDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQ-GSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             D+   R   + TTL EL +Y +FL  L I+ FGM    MY+L  ++++LFV+  +  +   SF S+ S  +FW F +GPL++GLYW+SWY N  +      + IY+EN L+G+ R+RQ+RV + +C +   FQ ++  CY  Y+ + E    FGL+ +  WT+T  +   + P   G +  Y  GGY V L   +    +   +L  N WI RGTRAV +DF++YNAN+NLFC+I+L+AEFPA GG++  + F +V
Sbjct:   15 HDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSR--TAPWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSV 269          

HSP 2 Score: 165.622 bits (418), Expect = 1.904e-90
Identity = 103/203 (50.74%), Postives = 150/203 (73.89%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNEL-INQKNEFEIG 1615
            +YF+SVWN L+++++ + F+ + F  Y  +    +L  LL N + +P+F +L+Y+   +N ++AIT+F AW+KIFK+ISFN+TM+QLSSTL RC KD+ GFA+MFFIIF A+AQLG+L+FG+++  F     SIF  +RI+LGDF F     A+ I GP+YF+ ++FFV FVL NMFLAIINDTYSE+K +  I ++ +FE+G
Sbjct:  310 AYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELG 512          
BLAST of PKD2L-1 vs. Ensembl Mouse
Match: Pkd2l1 (polycystic kidney disease 2-like 1 [Source:MGI Symbol;Acc:MGI:1352448])

HSP 1 Score: 256.914 bits (655), Expect = 6.456e-74
Identity = 125/263 (47.53%), Postives = 179/263 (68.06%), Query Frame = 3
Query:  150 MRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            +R +W T  TE+   NR LY++TTLREL +YIVFL  + ++ +GMT+ + Y+ T +++ LF++   ++  SF +++S +DFW FAQGPLL+ LYW  WYNN ++ +   +FIY+EN L+G  RLRQ+RV + SC++  +F++ I  CY  YS   E   PFG QN TAWTY  Q  LG     G +++Y GGGYY+DLP  + ++   L  L   LW+DRGTR V +DF+VYNANINLFC+++L+ EFPA GG IP +  +TV
Sbjct:   77 IRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPQNGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTV 339          

HSP 2 Score: 228.794 bits (582), Expect = 8.001e-64
Identity = 156/360 (43.33%), Postives = 237/360 (65.83%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEI---PNSESKKTFIHG---VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMD 2074
            Y  SVWNILD+VVI +S + + F+I+RT+ V  ++  LL   + + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFA+MFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ I GP+YF+ YVFFV FVL NMFLAIINDTYSE+K EL  QK++ ++ D+ K+     L +L L+K+++  +Q  L   +      + F+++ + ++E G E +EI + F+R+D DG+ +LD  EQ +M+  LE ++  +N EI +    +   P  E       G   VS +E+  L  R+ +++ V+  +V +I+ V   L+ ++
Sbjct:  381 YLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLKQSYNKTLLRLRLRKERVSDVQKVLKGGEPE----IQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQGLEEERVTLNAEIENLGRSVGHSPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEGVVSQIDAVGSKLKMLE 736          
BLAST of PKD2L-1 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 104.375 bits (259), Expect = 3.042e-22
Identity = 82/239 (34.31%), Postives = 119/239 (49.79%), Query Frame = 3
Query:  222 LRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFG-------LQNST----AWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVG 905
            +RE+  Y+ FL +L+++A+G      Y     L   F  G       F+ +     F+ +A   L+  LY +  +     D +        +KL+G A +RQVRV + SC +A + Q  +  C+  YS  IE    +G         NS     AW Y  Q+     P+ G ++ YGGGGY V L +D  SA  +L  LF+N W+D  TRAV V+FTVYNAN+NLFC + L  E   +G
Sbjct: 1943 IREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQG-------FSPVLGFRGFFEWANTTLVKNLYGH--HPGFVTDGN--------SKLVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGEGWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLG 2164          

HSP 2 Score: 61.6178 bits (148), Expect = 4.002e-9
Identity = 51/186 (27.42%), Postives = 97/186 (52.15%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSE 1570
            YF S WN+L+V +I  S+  ++  + RT+     L+    + ++  +F   +       Y++A  V L+ VK++  +  N  M  ++S L R   D++GF  +  I+  A++    L+FG KL  ++ L  +  T+  + LG F +++ L+   I G L     + F+ FV+ N+F+++I   +SE
Sbjct: 2217 YFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHRDEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSCIVFMTFVVLNLFISVILVAFSE 2402          
BLAST of PKD2L-1 vs. UniProt/SwissProt
Match: sp|O35245|PKD2_MOUSE (Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 4.236e-119
Identity = 117/271 (43.17%), Postives = 168/271 (61.99%), Query Frame = 3
Query:  132 NRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGS--FNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             R   G+R +W T+  E+  ANR  Y+++ LREL  Y+ FL +L I+ +GM +  +Y+ T  L+ LF++  V+ T    F +++S  DFW F +G  L+GLYW +  +N +      +FI++EN L+G+ RLRQ+RV + SC I  + +  IK CY  YS   E   PFG +N TAW YT +  L      G I++Y G GYY+DL   +    + L  L  N W+DRGTRA  +DF+VYNANINLFCV++L+AEFPA GGV+P + F+ V
Sbjct:  189 ERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSN-HTQADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPV 458          

HSP 2 Score: 224.942 bits (572), Expect = 4.236e-119
Identity = 164/433 (37.88%), Postives = 262/433 (60.51%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG-------------------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSE--EERKVKIGNMVQEELIKLNQDAVLTQ 2227
            SYF+S WN LDVV++ +S + ++ NIYR    + +L+  L + N  PNF++++Y+Q  FN + A+ VFL W+K+FK+I+FN+TM+QLS+T+ RC+KDL GF +MF IIF A+AQL YL+FGT++  F      IFT +RIILGD  F +   A+ + GPLYF  +VFF+ F+L NMFLAIIND+YSE+K++L  QK E E+ D  ++  Q  L KL LK++ +    +A++ +     G ++FDE +  ++ KG    EIE++F++YD DG++ L   E  +M++ LE ++  ++     E S +P   S ++F                            VS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR+ + ++L  ++    L    E  + ++  +V+EEL +   D   +Q
Sbjct:  499 SYFRSFWNCLDVVIVVLSVVAMVINIYRMSNAEGLLQ-FLEDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTV----DAISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDLD----LEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDARLGRDSEIHREQMERLVREELERWESDDAASQ 922          
BLAST of PKD2L-1 vs. UniProt/SwissProt
Match: sp|Q9JLG4|PK2L2_MOUSE (Polycystic kidney disease 2-like 2 protein OS=Mus musculus OX=10090 GN=Pkd2l2 PE=2 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 1.158e-89
Identity = 102/257 (39.69%), Postives = 155/257 (60.31%), Query Frame = 3
Query:  180 EDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQ-GSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
             D+   R   + TTL EL +Y +FL  L I+ FGM    MY+L  ++++LFV+  +  +   SF S+ S  +FW F +GPL++GLYW+SWY N  +      + IY+EN L+G+ R+RQ+RV + +C +   FQ ++  CY  Y+ + E    FGL+ +  WT+T  +   + P   G +  Y  GGY V L   +    +   +L  N WI RGTRAV +DF++YNAN+NLFC+I+L+AEFPA GG++  + F +V
Sbjct:   15 HDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSR--TAPWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSV 269          

HSP 2 Score: 165.622 bits (418), Expect = 1.158e-89
Identity = 103/203 (50.74%), Postives = 150/203 (73.89%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNEL-INQKNEFEIG 1615
            +YF+SVWN L+++++ + F+ + F  Y  +    +L  LL N + +P+F +L+Y+   +N ++AIT+F AW+KIFK+ISFN+TM+QLSSTL RC KD+ GFA+MFFIIF A+AQLG+L+FG+++  F     SIF  +RI+LGDF F     A+ I GP+YF+ ++FFV FVL NMFLAIINDTYSE+K +  I ++ +FE+G
Sbjct:  310 AYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELG 512          
BLAST of PKD2L-1 vs. UniProt/SwissProt
Match: sp|Q9NZM6|PK2L2_HUMAN (Polycystic kidney disease 2-like 2 protein OS=Homo sapiens OX=9606 GN=PKD2L2 PE=2 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 1.323e-85
Identity = 101/256 (39.45%), Postives = 155/256 (60.55%), Query Frame = 3
Query:  180 EDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
              +   + + I TTL+EL +Y +FL  L I+ FGM    MY+L  ++++LF++  V      +F S+ S  DFW F +GPLL GLYW+SWYNN  + +    + IY+EN L+G+ R+RQ++V + +C + + FQ ++  CY  Y++  E    FGLQ +T W Y+  +N  S    G +  Y  GGY   L   +    +   +L  N WI RGTR + +DF++YNAN+NLFC+I+L+AEFPA GG++  + F +V
Sbjct:   15 HKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYS-TSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSV 269          

HSP 2 Score: 155.992 bits (393), Expect = 1.323e-85
Identity = 139/381 (36.48%), Postives = 223/381 (58.53%), Query Frame = 2
Query:  932 NC*ITEILFXXXXXXXXXXXXXXXXXSYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNEL-INQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENM 2071
            +C IT  +F+  +T +E+ +IK  K +YFKS+WN L+++++ + F+ + FN Y  V +  +L  LL +  ++ +F +L+ +   +N ++AIT+F AW+KIFK+ISFNKTM+QLSSTL RC KD+ GFA+MFFIIFFA+AQLG+L+FG+++  F     SIF  +RI+LGDF F     A+ I GP+YF+ ++FFV FVL NMFLAIINDTYSE+K +  I ++ +FE+G   K+  + +         +   L+ A  + D    G  D  E     + +GF              D N + +A +  + + +LE  K   + EI  +   +   E ++ F++ V             E+E  ++ + LK+N V++ +  +
Sbjct:  284 SCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNV--------LEKFRLKKAQKDEDKKTKGSGDLAE---QARREGF--------------DENEIQNAEQMKKWKERLE--KKYYSMEIQDDYQPVTQEEFRELFLYAV-------------ELEKELHYINLKLNQVVRKVSAL 624          
BLAST of PKD2L-1 vs. UniProt/SwissProt
Match: sp|Q9P0L9|PK2L1_HUMAN (Polycystic kidney disease 2-like 1 protein OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 8.736e-74
Identity = 127/268 (47.39%), Postives = 177/268 (66.04%), Query Frame = 3
Query:  135 RFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
                G+R +W T  TE+   NR LYI+TTLREL +YIVFL  + ++ +GMT+ + Y+ T +++ LF++   +   SF +++S ADFW FAQGPLL+ LYW  WYNN ++     +FIY+EN L+G+ RLRQ++V + SC++  +F++ I  CY  YS   E   PFG  N TAWTY  Q  LG     G +++Y GGGYY+DLP  +  +   L  L   LW+DRGTR V +DF+VYNANINLFCV++L+ EFPA GG IP +  +TV
Sbjct:   72 HICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTV 339          

HSP 2 Score: 227.639 bits (579), Expect = 2.451e-62
Identity = 160/363 (44.08%), Postives = 235/363 (64.74%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEI---ESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMD 2074
            Y  S+WNILD+VVI +S + + F+I+RT+ V  ++  LL   N + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFAVMFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ I GP YF+ YVFFV FVL NMFLAIINDTYSE+K EL  QK+E ++ D  K+     L +L L+K+++  +Q  L   +      + F+++   ++E G   +EI    + F+++D DGNR+LD  EQ +M+  LE ++ A+N EI      I +S   K+          VS +E+  L  R+ ++E V+  +V +I+ V   L+ ++
Sbjct:  381 YLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQE----IQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLE 739          
BLAST of PKD2L-1 vs. UniProt/SwissProt
Match: sp|A2A259|PK2L1_MOUSE (Polycystic kidney disease 2-like 1 protein OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 4.516e-73
Identity = 125/263 (47.53%), Postives = 179/263 (68.06%), Query Frame = 3
Query:  150 MRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            +R +W T  TE+   NR LY++TTLREL +YIVFL  + ++ +GMT+ + Y+ T +++ LF++   ++  SF +++S +DFW FAQGPLL+ LYW  WYNN ++ +   +FIY+EN L+G  RLRQ+RV + SC++  +F++ I  CY  YS   E   PFG QN TAWTY  Q  LG     G +++Y GGGYY+DLP  + ++   L  L   LW+DRGTR V +DF+VYNANINLFC+++L+ EFPA GG IP +  +TV
Sbjct:   77 IRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPQNGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTV 339          

HSP 2 Score: 228.794 bits (582), Expect = 5.597e-63
Identity = 156/360 (43.33%), Postives = 237/360 (65.83%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEI---PNSESKKTFIHG---VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMD 2074
            Y  SVWNILD+VVI +S + + F+I+RT+ V  ++  LL   + + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+KD+ GFA+MFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF +    NA+ I GP+YF+ YVFFV FVL NMFLAIINDTYSE+K EL  QK++ ++ D+ K+     L +L L+K+++  +Q  L   +      + F+++ + ++E G E +EI + F+R+D DG+ +LD  EQ +M+  LE ++  +N EI +    +   P  E       G   VS +E+  L  R+ +++ V+  +V +I+ V   L+ ++
Sbjct:  381 YLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLKQSYNKTLLRLRLRKERVSDVQKVLKGGEPE----IQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQGLEEERVTLNAEIENLGRSVGHSPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEGVVSQIDAVGSKLKMLE 736          
BLAST of PKD2L-1 vs. TrEMBL
Match: A0A0H3YJL0 (PKD2L-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=PKD2L-1 PE=2 SV=1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 418/419 (99.76%), Postives = 419/419 (100.00%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDAVLTQKRKQNFKSDFEQN 2266
            SYFKSVWNILDVVVIGISFICIIFNIYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPLYFLLYVFFVLFVLFNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMLAKLNLKKDKLDVLQNALTNADTNNDGLMDFDEWKTAMQEKGFES+EIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDNSKNKRRKSMRKILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDAVLTQKRKQNFKSDFEQN
Sbjct:  355 SYFKSVWNILDVVVIGISFICIIFNIYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPLYFLLYVFFVLFVLFNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMLAKLNLKKDKLDVLQNALTNADTNNDGLMDFDEWKTAMQEKGFESHEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDNSKNKRRKSMRKILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDAVLTQKRKQNFKSDFEQN 773          

HSP 2 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 311/312 (99.68%), Postives = 311/312 (99.68%), Query Frame = 3
Query:    3 KMAKGWSTEDMKANVEYDAYDEISHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            KMAKGWSTEDMKANVEYDAYDEISHADSVS DNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTYGGGGYYVDLPSDQFSAFSLLNNLFNNLWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV
Sbjct:    3 KMAKGWSTEDMKANVEYDAYDEISHADSVSLDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTYGGGGYYVDLPSDQFSAFSLLNNLFNNLWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 314          
BLAST of PKD2L-1 vs. TrEMBL
Match: A0A077L755 (Transient receptor potential ion channel P a (Fragment) OS=Dugesia japonica OX=6161 GN=DjTRPPa PE=2 SV=1)

HSP 1 Score: 509.605 bits (1311), Expect = 0.000e+0
Identity = 316/417 (75.78%), Postives = 353/417 (84.65%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSE--SKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDAVLTQKRKQNFKSD 2254
            SYF SVWN LDV+VI ISF+C+IFNIYRT+AVQTIL  LLMN NQHPNFD LSY Q TFNYLLA+TVFLAWVKIFKYISFNKTMTQLS+TLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFG +L  FRELHYSIFTLYRIILGDFTF DF    II GPLYF+LYVFFV FVLFNMFLAIINDTYSE+KNEL N KNEFEIGDYFKERT  ML KLNLKK+K+  +QNA+TNADTNNDGLMDF+EWK AM+ +GFE  EIE+VFS+YDTDGNRVLD  EQIEMQ QLEN K  VN EI+ EQ+E+ + +   KK  I GVSIDEY  LN R+EEMEN I ++V KI+ VL++LENMD +K KRRK+M KIL  L+SKEHLSEEERKV++  MVQEELIKL+ D VLTQ+R+ N KSD
Sbjct:  312 SYFHSVWNCLDVIVISISFVCVIFNIYRTIAVQTILGDLLMNSNQHPNFDNLSYNQTTFNYLLAVTVFLAWVKIFKYISFNKTMTQLSTTLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGAQLQSFRELHYSIFTLYRIILGDFTFSDFQTVHIILGPLYFILYVFFVFFVLFNMFLAIINDTYSEVKNELANVKNEFEIGDYFKERTIKMLEKLNLKKEKIADIQNAITNADTNNDGLMDFEEWKAAMKVRGFEESEIENVFSKYDTDGNRVLDQTEQIEMQRQLENLKAEVNNEIMVEQAELTDCDLGLKKGVIRGVSIDEYNILNSRVEEMENNIISMVSKIDMVLRNLENMDKAKAKRRKAMGKILNTLTSKEHLSEEERKVQLETMVQEELIKLDHDTVLTQRRRSNHKSD 728          

HSP 2 Score: 329.717 bits (844), Expect = 0.000e+0
Identity = 176/252 (69.84%), Postives = 209/252 (82.94%), Query Frame = 3
Query:  186 IKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNS-MASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            +K NR+LYIQTTLREL +YI+FLAILMIIAFGMTTGTMYW TNLL+NLF+NG  NN  +    M++ ADFW FA G LLNGLYWN+WYNNLN+D SEINFI++ENKLIGL R+RQVR+ + +CII  EF+ I+ +CY +Y    EST+ FGLQNSTAW YT  + LGS P QG+ISTY GGG+Y+DLP DQ +A  +LN L+ NLWIDRGTRAVI+DFTVYNANINLFCVIKL+AEFPAVGGVIP YDF+T+
Sbjct:   20 VKGNRDLYIQTTLRELILYIIFLAILMIIAFGMTTGTMYWYTNLLSNLFLNGNGNNNTNTFLTMSADADFWNFATGALLNGLYWNTWYNNLNLDPSEINFIFYENKLIGLPRMRQVRMKNNTCIIPLEFKNIVNQCYASYKMSDESTDSFGLQNSTAWNYTSGSVLGSYPFQGTISTYSGGGFYIDLPIDQPTALGVLNFLYTNLWIDRGTRAVIIDFTVYNANINLFCVIKLVAEFPAVGGVIPTYDFRTI 271          
BLAST of PKD2L-1 vs. TrEMBL
Match: R7T913 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_169289 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 7.127e-164
Identity = 215/422 (50.95%), Postives = 296/422 (70.14%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREI---------------------ISEQSEIPNSESK------KTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEEL 2194
             YFKS WNILD++V+ I+  CI FN+YRTVAV  +L++LL + N++ +F++LSY+Q  FN  LAI VF AW+K+FKYISFNKTMTQLSSTL RC+KDLAGFAVMFFIIF AFAQLGYL+FGT++  F     ++FTL+RIILGDF F +   A+ + GP YF+LYVFFV FVL NMFLAIINDTYSE+K E+ NQKNEFE+GDYFK+    ML KLNLK+DK+  +Q AL  AD NND  +DFDEW+  ++ +G+   EIE+VF++YD DG+RVLD  EQ +MQ  LE QK  +++E                        E+ E   ++S       +  ++GVS +E+  L+ R++ ME+ I ++V KI+ VL  LE M+ +K+KRR++M KIL  ++  +  ++E ++ ++ ++V+EEL
Sbjct:  326 GYFKSFWNILDIIVLMIAVCCIGFNVYRTVAVADMLDTLLDSPNEYADFEFLSYWQVVFNSALAIMVFFAWIKVFKYISFNKTMTQLSSTLARCAKDLAGFAVMFFIIFLAFAQLGYLIFGTQVKDFSSFDDAVFTLFRIILGDFNFHELEQANRVLGPAYFILYVFFVFFVLLNMFLAIINDTYSEVKEEISNQKNEFEMGDYFKQGYNKMLDKLNLKRDKIVDIQKALQTADINNDDRLDFDEWRQELKTRGYAEAEIEAVFAKYDIDGDRVLDKTEQRKMQADLEGQKAKLSKEYDQLENKGDAKGSRVSFDSDENTDEEDESHGTKSSSRGGSNRNVVNGVSYEEFTVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKSKRRETMSKILDSITESDGTTDEVKRHQMEHLVREEL 747          

HSP 2 Score: 288.115 bits (736), Expect = 7.127e-164
Identity = 142/273 (52.01%), Postives = 203/273 (74.36%), Query Frame = 3
Query:  123 GFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNT-GSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G W++FS G+RS+WAT+ TE+IK N+ L+I+TTLREL +YIVFL IL I+ FGMT+ TMY+ T +++ LF++ Q   T  +F  M +  DFW FA+ PL++GLYW +WYN+ NV   E+ +I++ENKL+G+ R+RQ++V + SC++ ++F++ IK CY TY++ IE   PFGL N +AW+Y+ +  L      G I+TYGGGG+Y DL  ++  + +L+ +L  NLW+DRGTR V VDFTVYNANINLFCVI+L+ EFPA GG IP ++F+TV
Sbjct:   13 GCWHKFSQGIRSLWATRHTEEIKDNQELHIKTTLRELVVYIVFLVILCIVTFGMTSSTMYYYTKVMSELFLDSQFPETKNTFRGMTTMHDFWRFAESPLVDGLYWETWYNDRNVSSDELGYIFYENKLLGVPRVRQLKVRNDSCVVHDDFKENIKACYDTYASSIEDKNPFGLINGSAWSYSSEDELDGSSHWGYITTYGGGGFYQDLALNKADSLALIADLKQNLWLDRGTRVVFVDFTVYNANINLFCVIRLVVEFPATGGAIPSWNFRTV 285          
BLAST of PKD2L-1 vs. TrEMBL
Match: A0A267E5C4 (EF-hand domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009305g2 PE=4 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 4.912e-163
Identity = 219/440 (49.77%), Postives = 296/440 (67.27%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSE-----------------------------IPNSESKKTFIHG----------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEEL 2194
            +YF S WN LD+VVI I+ +C  FNIYRT++V   L  LL ++ Q+P+FD+LS++Q  FN  +AITVF AWVKIFKYISFNKTMTQLSSTLG C+KDL GFAVMFFI+FFAFAQLGYL+FGTK+  FRE   +IFTL+RIILGDF F    NA  + GP+YF+LYVFFV FVL NMFLAIINDTYSE+K+ L NQ N+FE+ DYFK+R   +L KL+L++DK+  +Q A+ +AD NND  +DF+EW+T ++ +G+   EIE++F+RYD DG+RVLD  EQ +MQ +LE QK A+N +I SE++E                             +    S ++   G                V IDE+  L+ R++ ME+ I  +V +I+ VL  LE+M+ +K KRR++M ++L  +   E  SE E++ K+  MV++EL
Sbjct:  412 AYFSSFWNWLDIVVIVIALVCAAFNIYRTISVGNKLTRLLEDETQYPDFDFLSFWQEQFNQAIAITVFFAWVKIFKYISFNKTMTQLSSTLGACAKDLLGFAVMFFIVFFAFAQLGYLIFGTKVEDFREFQQAIFTLFRIILGDFDFASLQNAHRVLGPIYFILYVFFVFFVLINMFLAIINDTYSEVKSNLANQPNDFEMTDYFKQRAGRVLDKLHLRRDKIVDIQRAMQSADMNNDRQLDFEEWRTELKMRGYADGEIEALFARYDMDGDRVLDEEEQRKMQWELEGQKAALNSQIESERAEQQRQGSAGVGADDGDADNDELAGDDRDGAVSLRGSMRSATRGGRPNTSGSNSGGGGSGVPIDEFTTLSRRVDRMEHSIGGIVNRIDSVLLKLESMERAKLKRRETMSRLLDSIGKCEGDSEAEKREKMERMVRQEL 851          

HSP 2 Score: 287.73 bits (735), Expect = 4.912e-163
Identity = 148/290 (51.03%), Postives = 200/290 (68.97%), Query Frame = 3
Query:   72 SHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            S A  +  +N  +    G W +F  G+R++W TK TED+  N  L I+TTLREL +Y +FL ++ I+ FGMT+ TMY+ T ++N+LF+     +  +F S+ + AD+W FAQGPL++GLYW++WYNN NV D  E NFIY+ENKL+G+ R+RQVRV + SC IA +F+  I+ CY  YS   ES EPFG  NSTAW Y+ +  L      G ++TY GGGYY+DL   +  + + ++ LF+ LWIDR TRAV +DFTVYNANINLFCVIKLIAEFPA GG    ++F+TV
Sbjct:   82 SQAAIMPANNGTDDEATGCWGKFKRGVRAVWMTKDTEDVSQNAELKIKTTLRELVMYCLFLVVICILTFGMTSSTMYYYTFVMNSLFLTTPTASGATFTSVKNFADWWGFAQGPLISGLYWDTWYNNANVTDPRERNFIYYENKLLGVPRMRQVRVRNDSCSIATDFRANIRACYAMYSRSAESREPFGYMNSTAWNYSTEQQLDGRGYSGKLATYNGGGYYIDLGRSREESTAKIDELFHGLWIDRATRAVFIDFTVYNANINLFCVIKLIAEFPATGGGFTSWEFRTV 371          
BLAST of PKD2L-1 vs. TrEMBL
Match: A0A267G6B3 (EF-hand domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009305g3 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.712e-162
Identity = 219/440 (49.77%), Postives = 297/440 (67.50%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSE-----------------------------IPNSESKKTFIHG----------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEEL 2194
            +YF S WN LD+VVI I+ +C  FNIYRT++V   L  LL ++ Q+P+FD+LS++Q  FN  +AITVF AWVKIFKYISFNKTMTQLSSTLG C+KDL GFAVMFFI+FFAFAQLGYL+FGTK+  FRE   +IFTL+RIILGDF F    NA  + GP+YF+LYVFFV FVL NMFLAIINDTYSE+K+ L NQ N+FE+ DYFK+R   +L KL+L++DK+  +Q A+ +AD NND  +DF+EW+T ++ +G+   EIE++F+RYD DG+RVLD +EQ +MQ +LE QK A+N +I SE++E                             +    S ++   G                V IDE+  L+ R++ ME+ I  +V +I+ VL  LE+M+ +K KRR++M ++L  +   E  SE E++ K+  MV++EL
Sbjct:  412 AYFSSFWNWLDIVVIVIALVCAAFNIYRTISVGNKLTRLLEDETQYPDFDFLSFWQEQFNQAIAITVFFAWVKIFKYISFNKTMTQLSSTLGACAKDLLGFAVMFFIVFFAFAQLGYLIFGTKVEDFREFQQAIFTLFRIILGDFDFASLQNAHRVLGPIYFILYVFFVFFVLINMFLAIINDTYSEVKSNLANQPNDFEMTDYFKQRAGRVLDKLHLRRDKIVDIQLAMQSADMNNDRQLDFEEWRTELKMRGYADGEIEALFARYDMDGDRVLDEDEQRKMQWELEGQKAALNSQIESERAEQQRQGSAGVGADDGDADNDELAGDDRDGAVSLRGSMRSATRGGRPNTSGSNSGGGGSGVPIDEFTTLSRRVDRMEHSIGGIVNRIDSVLLKLESMERAKLKRRETMSRLLDSIGECEGDSEAEKREKMERMVRQEL 851          

HSP 2 Score: 286.96 bits (733), Expect = 1.712e-162
Identity = 148/290 (51.03%), Postives = 200/290 (68.97%), Query Frame = 3
Query:   72 SHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV-DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            S A  +  +N  +    G W +F  G+R++W TK TED+  N  L I+TTLREL +Y +FL ++ I+ FGMT+ TMY+ T ++N+LF+     +  +F S+ + AD+W FAQGPL++GLYW++WYNN NV D  E NFIY+ENKL+G+ R+RQVRV + SC IA +F+  I+ CY  YS   ES EPFG  NSTAW Y+ +  L      G ++TY GGGYY+DL   +  + + ++ LF+ LWIDR TRAV +DFTVYNANINLFCVIKLIAEFPA GG    ++F+TV
Sbjct:   82 SQAAIMPANNGTDDEATGCWGKFKRGVRAVWMTKDTEDVSQNAELKIKTTLRELVMYCLFLVVICILTFGMTSSTMYYYTFVMNSLFLTTPTASGATFTSVKNFADWWGFAQGPLISGLYWDTWYNNANVTDPRERNFIYYENKLLGVPRMRQVRVRNDSCSIATDFRANIRACYAMYSGSAESREPFGYMNSTAWNYSTEQQLDGRGYSGKLATYNGGGYYIDLGRSREESTAKIDELFHGLWIDRATRAVFIDFTVYNANINLFCVIKLIAEFPATGGGFTSWEFRTV 371          
BLAST of PKD2L-1 vs. Ensembl Cavefish
Match: pkd2l1 (polycystic kidney disease 2-like 1 protein [Source:NCBI gene;Acc:103031316])

HSP 1 Score: 240.736 bits (613), Expect = 6.899e-127
Identity = 125/264 (47.35%), Postives = 179/264 (67.80%), Query Frame = 3
Query:  147 GMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G++ +W T  T+D   NR L+++TTLREL +YIVFL  + ++ +GMT+ T Y+ T ++ +LFVN   ++  +F S+ +  DFW++AQGPLL+GLYW SWYNN ++     +FIY+EN L+G+ R+RQ++V +KSC +  +F++ I  C+  Y+ + E    FGL N TAW Y  +  L      G ++TY GGGYY DL   +  +  +L NL NNLW+D GTRAV +DF+ YNANINLFCVI+L+ EFPA GG IP Y  +TV
Sbjct:   95 GIKGLWGTTLTKDTTENRELFVRTTLRELVVYIVFLVDMCLLTYGMTSSTTYYYTKVMTDLFVNAPSDSGVTFQSIGTMDDFWSYAQGPLLDGLYWTSWYNNQSLQTGTHSFIYYENMLLGVPRVRQLKVKNKSCKVHKDFEEEISDCFDVYNEKKEDDSSFGLINGTAWQYHTEKELKGSNHWGMLATYSGGGYYQDLALTKEESAGVLANLNNNLWLDHGTRAVFIDFSTYNANINLFCVIRLVVEFPATGGAIPSYQIRTV 358          

HSP 2 Score: 234.958 bits (598), Expect = 6.899e-127
Identity = 171/396 (43.18%), Postives = 261/396 (65.91%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIIS-----EQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMV 2182
            SYFKS+WNILDVV+I ++ + I+FN++RT+ V  +L +LL   + + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLSSTL RC+ D+ GFA+MFFI+FFA+AQLGYLLFGT++  F   H  IFT +RIILGDF +     A+ + GP+YF  YVFFV FVL NMFLAIINDTYSE+K EL +QK++ +I D  K+       KL LKK+K+  +Q  L +        ++F +++  ++E G   +EI + FS++D DGN++LD  EQ  M+ +LE ++ A++ E+ +     E++     +++KT    V+  ++Q L  ++ E+E  + T + KI+ V++ L   D  K  ++ +  K LTI       +E+ER V  GN++
Sbjct:  399 SYFKSIWNILDVVIIMLAIVAIVFNVFRTIKVDKLLGNLLKEPSIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCATDILGFAIMFFIVFFAYAQLGYLLFGTEVESFSTFHKCIFTQFRIILGDFDYDGIERANRVLGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEELASQKDDLQITDLIKQSYSKTFMKLKLKKEKISDVQKVLRSGSKE----LEFKDFRETLKEMGHADHEISAAFSKFDYDGNQILDKEEQETMKQELEEKRDALSVELHNLGINYEKNGKETDDNEKTNSVLVTAQQFQMLVKQVVELECSLATTMAKIDVVMEKLGLQDAGKTNKKDATGKHLTI------RNEQERPVSGGNVL 784          
BLAST of PKD2L-1 vs. Ensembl Cavefish
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:103043751])

HSP 1 Score: 237.269 bits (604), Expect = 3.582e-66
Identity = 175/436 (40.14%), Postives = 264/436 (60.55%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG-------------------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSE--EERKVKIGNMVQEELIKLNQDAVLTQKRKQ 2239
            YFKS+WN LDV+++ +S   II NIYRT AV   L  LL N + +PNF  L+  Q  FN+L A+ VFLAWVK+FK+I+FNKTM+QLS+T+ RC+KDL GFA+MFFI+F A+AQL YL+FG +L  F      IFT +RIILGDF F +    + + GP+YF  +VFF+  +L NMFLAIINDTYSE+K ++  Q++E EI D  K+  Q  + KL L+K  +D + ++L  A     G ++FDE +  ++ KG    EIE++F++YD DG++ L  +E  +M++ LE ++  ++     E+S +P   S ++F                            VS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR+ + ++L  +   E +    E  +  +  +V+EEL +   D  ++Q   Q
Sbjct:  441 YFKSLWNCLDVIIVTLSAPAIIMNIYRTSAVSNRLRYLLENHSTYPNFQPLAQVQVQFNHLAAVIVFLAWVKLFKFINFNKTMSQLSTTMSRCAKDLLGFAIMFFIVFLAYAQLAYLVFGNQLNDFSTFQACIFTQFRIILGDFDFSEIEETNRVLGPIYFTTFVFFMFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKGYQKAMVKLRLRKTTVDDISDSLRQA----GGKLNFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELSEHEHQQMKDDLEKEREDLDL----ERSSLPRPMSGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLDGVMEDERMGRDTEVHREHMEKLVREELERWESDDAISQVSHQ 868          

HSP 2 Score: 228.409 bits (581), Expect = 5.408e-63
Identity = 113/277 (40.79%), Postives = 182/277 (65.70%), Query Frame = 3
Query:  114 VKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN--NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            +++G+  R    +R +W T+  ED +++R +Y++  LRE   YI FL  L II +GM +  MY+ T +++ LF++  ++  +  +F ++++  DFW + +GP LNG+YW+ WYNN ++ +++ + IY+EN L+G+ RLRQV+V +KSC +  + +  +  CY  YS   E   PFGL+N+TAW Y+ +  LG     G ++TY GGGYY DL   +  +   L  L +NLW+DRGTRAV +DF+VYN N+NLFC+++++ EFPA GG +  + F+TV
Sbjct:  124 MQHGWGKRILAKLRILWGTRLMEDSESSREVYLKNVLRETVTYIFFLITLCIITYGMVSTNMYFYTKVMSQLFLDTPLSKGDPTTFKTLSTMEDFWKYTEGPFLNGMYWDVWYNNKSLPENQ-SLIYYENLLLGVPRLRQVKVLNKSCPVHEDLKDEVYDCYSIYSPASEDKAPFGLKNNTAWVYSEENILGESSYWGEVATYRGGGYYQDLARSREESARQLKELKDNLWLDRGTRAVFLDFSVYNGNVNLFCIVRMLVEFPATGGAVTSWQFQTV 399          
BLAST of PKD2L-1 vs. Ensembl Cavefish
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:103044173])

HSP 1 Score: 116.316 bits (290), Expect = 4.611e-26
Identity = 97/306 (31.70%), Postives = 151/306 (49.35%), Query Frame = 3
Query:   45 VEYDAYDEISHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTT-----LRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFEN-KLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFG----------LQNS--TAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGG 908
            V+ + Y ++    ++   +D + V+  F  R S    S +      +I+  RN  I+       +RE+ IY+ FL +L+++A+G      ++LT  +   F NG        +   +  + + +A   LLN L+             +  FI   N KL+G ARLRQVRV D SC +    +  +  C+  YS  +E    +G          L  +  T W Y  Q+ L + PI G ++ Y GGG+ VDL  ++ +A S L  LF N W+D  TRA+ V+FTVYNAN+NLFC++ L+ E  AVG 
Sbjct: 2030 VDQEEYGDVPIDGNLPNSDDPDAVR--FARRDSTC--SFYQPPPPSNIEKMRNNMIKEQKVFGLIREILIYMGFLWMLLLVAYGQRDPNAFYLTQHIQQSFSNG-------ISDSMTHGEVFQWANSTLLNNLFGQ-----------QPGFITDGNSKLVGNARLRQVRVQDGSCRVDRSMRNSVPDCHAPYSWDMEDLGSYGPGWNPSIDANLSKTLPTPWQYQTQSRLRAHPIWGGVAVYRGGGFVVDLGPNRENASSSLQYLFENTWLDMFTRAIFVEFTVYNANVNLFCIVTLMFETTAVGA 2313          

HSP 2 Score: 69.707 bits (169), Expect = 1.210e-11
Identity = 61/204 (29.90%), Postives = 110/204 (53.92%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQK--NEFEIGD 1618
            YF+S WN+LD+ +I +S+  +   I RT+     +E    + +++  F+  +       Y++A  V LA VK++  +  N  +  ++STL R   D++GF V+  I+F A++    LL+G KL  +R L  +  T+  + LG F +++ L+ + + G       + F+ FV+ N+F+++I   +SE   E I+ K   E EI D
Sbjct: 2365 YFRSKWNLLDMAIIILSWSALPVFIKRTLLGNQSIEYYQNHKDEYAGFNETATADAVLGYIIAFLVLLATVKLWHLLRLNPKLHMITSTLQRAWNDISGFIVVMTIMFLAYSVACNLLYGWKLYSYRTLLNAAQTIVSLQLGIFNYEEVLDYNPVLGAFIVGSCIIFMTFVVLNLFISVILVAFSE---EQIHHKPSEEEEIVD 2565          
BLAST of PKD2L-1 vs. Ensembl Cavefish
Match: ENSAMXT00000006495.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:35007331:35041448:1 gene:ENSAMXG00000006274.2 transcript:ENSAMXT00000006495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 1.574e-22
Identity = 81/239 (33.89%), Postives = 123/239 (51.46%), Query Frame = 3
Query:  228 ELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFG-----LQNS-------TAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGG 908
            E+ IY+ F  +L++ A+       ++LT  +   F NG        +   S  D + +A   LL  L+    Y+    D +        +KL+G ARLRQVRV   SC  A+  +  +  C+  YS ++E    +G     L +S       T W Y  Q+ L +  + G ++ Y GGG+ VDL  DQ ++ S+L  LF N W+D  TRA+ ++FTVYNAN+NLFC++ L+ E  AVG 
Sbjct: 1211 EILIYLGFFCMLLMAAYSQRDPNAFFLTRHIQQSFSNG-------ISDSMSQQDVFIWANSSLLTNLFGQ--YSGFITDGN--------SKLVGTARLRQVRVQKSSCRKASSVRSSVPDCHAPYSWEVEDMGSYGPGWTSLIDSNMSKALFTPWQYQTQSRLRAHTVWGGMALYRGGGFVVDLEPDQQNSSSVLQYLFENAWLDIYTRALFIEFTVYNANVNLFCIVTLMLETTAVGA 1432          

HSP 2 Score: 54.6842 bits (130), Expect = 4.256e-7
Identity = 50/186 (26.88%), Postives = 100/186 (53.76%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSE 1570
            YF++ WNIL++ +I +S+      I + V     L+    + NQ P+F   +       YL A+ V LA +K++  +  N  +  +++TL +   D++ F V+  I+F A++ +  LLFG KL  ++ L  +   +  + LG F +++ L+ + + G       + F+ FV+ N+F+++I + +S+
Sbjct: 1482 YFRNKWNILELAIILLSWSAFSVFIKKMVQGDQDLKYYQDHRNQFPSFYETAAADSVLGYLTAVLVLLATIKMWHLMRLNSKLNMITNTLQQAWSDISSFIVVIVIMFLAYSIVSNLLFGWKLYTYKTLIDAATAMVSLQLGIFNYEEILDLNPVLGAFIIGSCIIFMTFVVLNLFISVILEAFSQ 1667          
BLAST of PKD2L-1 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 247.669 bits (631), Expect = 2.835e-72
Identity = 169/351 (48.15%), Postives = 243/351 (69.23%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLE 2065
            YFKSVWN LD++VI +S + IIFNI RT+AV  +L +LL + N + +F+YL+++Q  FN +LAI VF AW+KIFKY+SFNKT+TQLSSTL RC+KD+ GFAVMFFIIFFA+AQ GYL+FG+++  F      IFT +RIILGDF F    NA+ I GP+YF  Y+FFV FVL NMFLAIINDTY+++K EL + K++FEIGD+FK+  + ML KL +KKD +  +Q AL +A  +    +++D W+  +   G    EI + FS++D D + VLD +EQ +++ +LE QK  +N +I  E  +  ++  K      V+ D++     R+ +ME+ +++L+ K+  +L  LE
Sbjct:  312 YFKSVWNCLDIIVIVLSMVAIIFNICRTIAVSNLLGALLNDPNIYADFEYLAFWQTQFNNMLAINVFFAWIKIFKYVSFNKTLTQLSSTLARCAKDVLGFAVMFFIIFFAYAQTGYLVFGSQVEDFSSFVNCIFTQFRIILGDFDFHAIENANRILGPIYFTTYIFFVFFVLLNMFLAIINDTYTDVKAELADTKDDFEIGDFFKQGYKNMLNKLKMKKDDIADMQRALDSAGKH----LEYDIWRKNLIRLGHSDEEIAAAFSKFDKDSDNVLDEDEQKQLRAELEGQKDKLNEDI--EALKTMDNSGKPGDASRVTKDDFNRFASRVAKMESSMDSLMSKVESLLTKLE 656          

HSP 2 Score: 207.223 bits (526), Expect = 1.256e-57
Identity = 117/263 (44.49%), Postives = 159/263 (60.46%), Query Frame = 3
Query:  162 WATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN--NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEIN--FIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            W T+ TE + + R  Y +TTLREL IY+VFL  L ++ FGM     Y+ T ++ +LFV   V+  +  +FNS++S  DFW   QGP+L+GLYW  WYN    DQ  +N  FI +EN ++G+ R+RQ++V + SC I   F+ II  CY  YS   E  E FG    TAW Y  +  L      G ++ Y G GYY DL   +  +  +L  L + LW+D GTRAV +DFT YN NINLFCV++L+ EFP  GG +P Y F+TV
Sbjct:   12 WGTRLTE-VNSTREQYFKTTLRELIIYVVFLIDLCLLTFGMMNTNTYYYTKVMMDLFVESPVSPIDGTNFNSISSMDDFWKVVQGPVLDGLYWEKWYNG---DQLPVNLSFIQYENVMLGVPRVRQLKVRNGSCTIYPLFRNIIPGCYDGYSCGEEDKETFGRGTGTAWKYWSEEELSGSSHWGLLAQYSGAGYYRDLSRRKNESAPMLQELKDYLWLDHGTRAVFIDFTTYNGNINLFCVVRLVVEFPLTGGALPSYQFRTV 270          
BLAST of PKD2L-1 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 226.868 bits (577), Expect = 6.357e-64
Identity = 146/293 (49.83%), Postives = 207/293 (70.65%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXX--XXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQK 1882
            +YFKSVWN LD++VI +S + IIFN+YRTV V  +L++LL   N++ NF +L+++Q  +N ++A+ VF  W+K FKY+SFNKTMTQLSSTL RC+KD+ GFAVMFFIIFFA+AQLGYLLFGT++  F      IFT +RIILGDF F    NA+ + GPLYF  YVF V  + +  NMFLAIINDTY+E+KNEL  ++NEF++G YFK +  + + K   K     V   ++ +A +     +++D+W+  ++  G    EIE+ F+++D D N VLD+NE   M+++L++QK
Sbjct:  397 AYFKSVWNCLDLLVIMLSVVAIIFNVYRTVTVNKLLKALLDEPNRYGNFQFLAFWQTQYNNMVAVNVFFCWIKFFKYVSFNKTMTQLSSTLARCAKDVLGFAVMFFIIFFAYAQLGYLLFGTQVEDFSTFSNCIFTQFRIILGDFDFNAIENANRVLGPLYFTTYVFVVFFVLLPKNMFLAIINDTYAEVKNELAEKENEFDVGGYFK-KVYLDIRKKLGKNRGNIVDMISVLDASSQK---INYDDWRLKLKRLGHSDEEIEAAFAKFDKDKNSVLDSNEMKLMRDELKSQK 685          

HSP 2 Score: 222.631 bits (566), Expect = 2.292e-62
Identity = 117/258 (45.35%), Postives = 174/258 (67.44%), Query Frame = 3
Query:  150 MRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQV--NNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIP 917
            +R +W T+ TEDI  +R+ Y++TTLRELF+YI FL  L+I+ FGMT+  MY  T  ++NLF+   V  N++ +FNS+ +  DFW   QGP+LNGLYW  WYN++ + +++ +FIY+EN L+G+ R+RQ++V + SC +  +FQK ++ CY  YS   E    FG    T W Y+  +++      G ++TY GGGYY+DL   +  +  LL +LF+  W+DRGTRA+++DF+ YN NINLF VI+L+ EFP  GG +P
Sbjct:   94 LRGLWGTRLTEDI-TDRDKYVKTTLRELFVYIAFLINLIILTFGMTSDLMYKYTLAMDNLFLQNTVSPNDSVNFNSIFTFDDFWKVVQGPVLNGLYWEKWYNDIPLVENQ-SFIYYENFLLGVPRIRQLKVRNDSCTVHADFQKDVQGCYAAYSEDAEDKASFGPATGTPWKYSTSSDMNGSSHWGLLATYSGGGYYLDLTRSKSESAILLQDLFDKQWLDRGTRAILIDFSSYNGNINLFSVIRLLVEFPPTGGAVP 349          
BLAST of PKD2L-1 vs. Ensembl Sea Lamprey
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 134.035 bits (336), Expect = 8.792e-33
Identity = 109/379 (28.76%), Postives = 187/379 (49.34%), Query Frame = 2
Query: 1184 FNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHG---------------------------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLS---EEERKVKIGNMVQEELIKLNQD 2212
            F  +  + VF+AW+K+ ++ S  +T+T     L RC+ DL G+ ++F  +F AFAQL +L+FG  L  F      I T  RI+LGDF F     A  I GP+YF+ YVF V  ++  MFLAI+++ YSE K+E  + + +F++    K+          + +      + A         G ++F  W+  ++ +GF   EIE+VF+RYD DG   L   EQ++M+  L  +K  +   I    S  P  + KK  +                                   VS +E++ L  R+ +ME+ I ++V K++ V+  LE M+  + +RR  + ++++ +  +E  S   +E R+  +  +V++EL + + D
Sbjct:  359 FIIVTGVIVFVAWIKVVRFGSMCRTLTMCGCALTRCAWDLLGYTLVFATVFLAFAQLAFLIFGGALPDFSSFSSCILTQVRILLGDFDFSSLEAASRIMGPIYFVSYVFCVGLIMMVMFLAIVSEAYSEEKSEQAHSQPQFQLSSVIKQ-------VKVVDRLSCKKPRVAGIQKTLPPSGQINFATWRQNLKGQGFADAEIEAVFARYDGDG--ALTRAEQLQMRRDLRLEKQTIRLHI----SVSPREKKKKHQVTSRDDDDDDDDGDSDEDDDITVVRRGNHHQGGGGGVSREEFRVLVRRVNQMEHSIGSVVSKMDAVMVKLEAMERQRLRRRDVLSRLISGMGEEERGSWPGQEVRRDHMERLVRDELKRWDSD 724          

HSP 2 Score: 117.087 bits (292), Expect = 2.700e-27
Identity = 86/280 (30.71%), Postives = 140/280 (50.00%), Query Frame = 3
Query:  159 IWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTG--SFNSMASSADFWTFAQGPLLNGLYW---NSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSC-IIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSD-QFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVI-------------PLYDFKTV 938
            +WAT+ TE    NR  Y++  +RE   + VFLA+L ++A+       Y  T+ ++ +F +  ++N    +F+++A+    W    G L   L W   NS   NL       + +  EN ++    + Q RV + SC  ++         CY  YS+  E+ +PFG  NST W +  +     +P QG++  YG GGY V LP+D + +A+  L  L +  W+DR TR + VD  + N N+ L+ V++L  EFP  GG++             PL+D + V
Sbjct:    2 LWATRWTESPVLNRERYVKLAIREAVTFSVFLALLCVVAYSSRIPLAYEYTHAVSEMFTSSPLSNADPTTFHNLATIEQVWQVFHGYLTGPLLWALHNSGSRNLTN-----SMVSGENLVVEPVIIWQARVHNNSCWSLSTNLGTGTTECYGPYSSANENKDPFGPANSTVWRFDSEAG---VPWQGALGWYGPGGYAVRLPADSRTAAWQELAALRDASWLDRATRLLSVDAALLNPNLRLYMVVRLSMEFPPTGGILTALSLTPGRPLGTPLWDARAV 273          
BLAST of PKD2L-1 vs. Ensembl Nematostella
Match: EDO47023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN85])

HSP 1 Score: 293.893 bits (751), Expect = 5.061e-87
Identity = 211/445 (47.42%), Postives = 302/445 (67.87%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREI--ISEQSEI-PNSESKKTF-----------------IHG-----------------VSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTIL--SSKEHLSEEERKV-KIGNMVQEELIKLNQDAVLTQ 2227
            YFKS WN+LDVVVI + ++ ++FN+YRT+AV  +L SLL + +Q+ NFD L ++Q  FN ++A+ VF AW+K+FKYISFNKTMTQLSSTL +C+KD+AGFA+MFFIIFFA+AQLGYL+FGT++  F     SIFTL+RIILGDF F    NA+ + GPL+F+ YVFFV FVL NMFLAIINDTY+E+K+++ +Q++EFEI DYFK+  Q ML KL+ K++K+  +Q AL +AD N D  +DF+EW+  ++ +G    EIE+VF++YD DG+R+LD +EQ  MQ  LE QK  +N EI  +  Q E  P S S+ +F                 + G                 VS +E+  L+ R++ ME+ I ++V KI+ VL  LE M+ +K KRR++M K+L  +  S +   SE+E+K  ++  MV+EEL + + +A +++
Sbjct:  398 YFKSFWNVLDVVVIMLGYVAVVFNLYRTMAVGDLLSSLLEDGSQYANFDSLGFWQTQFNNMVAVAVFFAWIKVFKYISFNKTMTQLSSTLSKCAKDVAGFAIMFFIIFFAYAQLGYLIFGTQVRDFSTFEDSIFTLFRIILGDFDFHQIENANRVLGPLFFMTYVFFVFFVLLNMFLAIINDTYAEVKSDIASQESEFEITDYFKKGYQNMLNKLSFKREKILDIQKALKSADVNQDNKLDFEEWRANLKSRGHADAEIEAVFAKYDLDGDRILDEDEQRRMQEDLEGQKAELNDEIEEMERQKESRPKSASRMSFRGSDADSDDDDDDSQGGLSGRVGSAAGHRRGGGGGGGVSYEEFNVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMAKLLDSITESDRSGRSEDEKKREQMERMVREELERWDSEASMSR 842          

HSP 2 Score: 258.84 bits (660), Expect = 3.344e-74
Identity = 129/298 (43.29%), Postives = 191/298 (64.09%), Query Frame = 3
Query:   63 DEISHADSVSFD----NDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNV--DQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            + +SH   ++ D      KN V  G W RF   +R +W T+QTED  ++R ++I+TTLREL IY+VF+ IL I+ FGMT+ TMY+ T ++ +LFV   ++N  +F  + +  +FW +    L +GLYW  +YNN NV   + ++ FIYFENK++G  R RQ+RV + SC + ++F+ +IK CY  YS  +E    FG  N +AWTY  + +L      G ++TY GGG+   L   +     ++ +L  NLW+DRGTRAV +DFTVYNANINLFC+++L+ E+P  GG IP ++F+TV
Sbjct:   60 EPVSHQKRIAADVRVPGAKN-VPVGCWTRFKRIIRGLWRTRQTEDTDSDREMHIKTTLRELIIYLVFITILCILTFGMTSSTMYYFTKVMRDLFVESSMSNRNTFKDITTMNEFWMYTTETLSDGLYWEQYYNNQNVTKPKDDLGFIYFENKILGRPRFRQLRVLNDSCTVHDDFKSVIKECYAAYSPNVEDMNTFGKMNGSAWTYQTEKDLQGRSYWGRMTTYSGGGFTQLLAPTKAETQQIIEDLKQNLWLDRGTRAVFIDFTVYNANINLFCIVRLVFEYPPTGGCIPSFNFRTV 356          
BLAST of PKD2L-1 vs. Ensembl Nematostella
Match: EDO40051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8E5])

HSP 1 Score: 103.605 bits (257), Expect = 2.908e-23
Identity = 70/245 (28.57%), Postives = 121/245 (49.39%), Query Frame = 3
Query:  210 IQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENK----LIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTE---PFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXX----WIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGV 911
            + + +RE+  Y++FL I++ I++G        +TN + N+F+    N +  F+ + S+ D+W + +  ++  ++   WYN+      + +  Y  +     ++ +ARLRQ+R+   +C +    Q +I  C   YS+  E      P   +  TAW Y     L + P  G  +TY  GGY    P      +     L + L    W+D+ TRAV  +F++YNAN NLFCV+ L+ E    GG+
Sbjct:    5 MASIMREIVWYLIFLFIVLSISYGNRDPYTQLVTNNVENVFLQASYNGSTKFDEIGSTRDYWPWLKDTVIPSIFIEKWYND-----QDYHLGYLADTPTAWVLAVARLRQLRMQKHTCPLLPALQHVIPSCNDFYSSDEEERGMLLPGWKEPKTAWQYQTGEELKTFPYWGQKATYSAGGYVQVFPPSTAKNYDKAQALADALNENDWLDKYTRAVFTEFSIYNANSNLFCVVTLLIEQLPTGGI 244          

HSP 2 Score: 82.4185 bits (202), Expect = 1.725e-16
Identity = 59/201 (29.35%), Postives = 115/201 (57.21%), Query Frame = 2
Query: 1019 KSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDY 1621
            K+ W+IL++ V  +S   ++    R      +++ +  +  +  +  Y ++       L+ + VF +++KI + + FN+ M+ L+ TL  C   +  F +++ I FFA+AQL  L+FG    GF  +  S  TL   +LG FT ++  + + + GP +F +Y   ++F+L NMF++IIND+++E+ +++  Q N++EI D+
Sbjct:  297 KNPWSILEIFVTCLSLSMVVLYFLRIKFTAEVVKDMRNDPTRFVSLHYTAFLDEWIKCLMGLIVFFSFIKIVRLLRFNRRMSLLAQTLKLCIPKIGAFVIVYGIAFFAYAQLACLVFGQNAEGFMTIPRSAATLMDTLLGKFTLKEMSDINRLIGPTFFYIYTLSMIFILINMFMSIINDSFAEVNSDVSKQANDYEIVDF 497          
BLAST of PKD2L-1 vs. Ensembl Nematostella
Match: EDO39106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB30])

HSP 1 Score: 80.4925 bits (197), Expect = 1.398e-21
Identity = 68/195 (34.87%), Postives = 97/195 (49.74%), Query Frame = 3
Query:  363 FNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENK---LIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            F  ++   D  T+  G LL GLY   WYN L    SE N  Y  +K   L+GL+RL+Q RV    C I  E +     CY +YS   E T    L     +T +  T L +LP  G  + YGGGG+  +L   +  A  ++N+L  + W DR TRAV+  F+V+NAN +    +  +AE    G + P +   T+
Sbjct:    2 FFQISKKTDLITWLNGSLLAGLYPAPWYNGL----SESNTAYIGDKCSILLGLSRLKQSRVQTGHCTIPKEVRLRFSTCYASYSHSREDTTLANLPGWKPFTPSPLT-LATLPYWGQKAVYGGGGFVANLGYSESVARRVINDLARDGWFDRQTRAVLAIFSVFNANTDYVSFVNFLAEALTTGTIRPSHRITTI 191          

HSP 2 Score: 41.5874 bits (96), Expect = 1.398e-21
Identity = 53/193 (27.46%), Postives = 97/193 (50.26%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFT-LYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNEL 1585
             YFK +WN L++++I  S         + + +  I+  +  N     +FDY+         L+A  VF + +K+ K +  +  +  +SST+      L  F+ +F +I  A+AQLG L+FGT  T +  ++ ++ T L   I GD    +    + +  P Y + ++ F+ F+L N+F+AI+N+   + K  L
Sbjct:  228 PYFKDIWNWLEMLIILFSVATTAVQFVKGIYLTDIVTKIRSNPYGDFSFDYIVMGTELEESLMACLVFFSSLKLMKLVLLHVRVVVISSTMRVSFIRLLPFSFIFIVILLAYAQLGILVFGTMETSYATVYNALVTELMLFIGGDTRINELREVNRVMAPFYVISFMVFMGFILMNVFVAILNEAQFQQKTSL 420          
BLAST of PKD2L-1 vs. Ensembl Nematostella
Match: EDO44884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUD7])

HSP 1 Score: 97.0561 bits (240), Expect = 1.160e-20
Identity = 69/169 (40.83%), Postives = 102/169 (60.36%), Query Frame = 2
Query: 1133 NDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQ 1639
            N N + NF Y+S +Q +F  +L I VF++ +K  K + FNK M  L+ TL R +KDLA + +MF I+F +FAQ  YLL G+    F     SI  L  ++LG F+F++FL    I G   F LY+    F+L NMF+AII ++++E+K      +NEFEI ++  ER +
Sbjct:  888 NPNDYTNFQYISAWQMSFESILGILVFISTIKFIKLLRFNKKMFLLAYTLSRSAKDLAHYGIMFLIVFLSFAQFYYLLLGSDYDSFSTFVKSIEKLINVLLGRFSFEEFLIPFRIMGAFGFFLYMTLTNFLLLNMFIAIIVESFTEVKLSPELARNEFEIMEFTVERVR 1056          

HSP 2 Score: 81.6481 bits (200), Expect = 7.567e-16
Identity = 71/266 (26.69%), Postives = 118/266 (44.36%), Query Frame = 3
Query:  165 ATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNN------TGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYS--TQIEST-----EPFGLQN-----STAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGG 908
            A ++  D + ++   +   L ++  Y+ FL +L++IA        YW +  ++++ +     +      T +F  +++ ++ W +    LL  LY   WY         +        ++G AR RQ+R    +C+I    + +I  C   YS  TQ E+       PF   +     ST W++   + L   P  G ISTY GGGY V   S  + A   + +  NN WIDR T  +  +FT+YN   NLF    ++ E    GG
Sbjct:  534 ALEKARD-RNDKERKMSVILTDIGTYLTFLWVLLVIAHSRVDSAAYWQSRSISDVLMKTTYESPPESGLTKTFQKISNDSEIWLWTNHVLLPALYNLDWYYYTKTAPKLVR--GGAGLVVGFARWRQLRKKKDTCLITGVMRGVIHHCTDPYSMSTQDETNYNSRWRPFNTSDVPPSPSTIWSFNSASKLNGYPYFGEISTYSGGGYIVPFSSIYYKAVKEIKHARNNSWIDRYTAGLFTEFTLYNPYSNLFTASTVLVEVLPTGG 796          
BLAST of PKD2L-1 vs. Ensembl Nematostella
Match: EDO44744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR6])

HSP 1 Score: 95.1301 bits (235), Expect = 4.335e-20
Identity = 73/252 (28.97%), Postives = 122/252 (48.41%), Query Frame = 3
Query:  222 LRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFN-------SMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENK-LIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPF---GLQNST--------AWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPL 920
            ++E+  Y +F+ +++++A+G      + +   L ++F +G+  +  S          ++    FW + +  L+ GLY  SWYN  +    +  F+      ++G AR+RQ+RV    C + + +   + +C   YS   E T P    G + +         AW Y   + L SLP  G ++ Y GGGY  DL   +  A ++L  L  + W+DR TRA+ V+FTVY+   NL CV  L+ E    GG  P 
Sbjct:  611 IQEILFYALFVWVVLVVAYGHRDPNAHVMNQGLEDVF-SGRAKHDHSVPDGHSLLFQVSDITSFWNWTEAVLIPGLYSESWYNGRS---DKPGFLADHTSWMLGTARMRQLRVKAGDCKVHDVYSGYLAQCNGPYSWDTEDTTPVFRPGWRPAPSNYSTAQNAWKYRDSSELRSLPYLGKLALYSGGGYAFDLGKKE-KAMAMLAQLKRDKWVDRSTRAIFVEFTVYSPYTNLHCVGYLLLEVLPSGGTSPF 857          

HSP 2 Score: 73.9442 bits (180), Expect = 1.790e-13
Identity = 54/161 (33.54%), Postives = 92/161 (57.14%), Query Frame = 2
Query: 1151 NFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKER 1633
            NF  L+     F Y+ A   F   +K  +   FNK M+ L++TL   +K+LA F+++F ++F AF    YL+F T+L  F  +  ++ TL  ++LG F+++  L  + +  P  F  Y   V+F+L NMF++II + +  +K++   Q NE+EI D+  E+
Sbjct:  952 NFHALAASDQVFGYVYAFVAFFVSLKFLRLFRFNKRMSLLATTLKCSAKELAHFSIVFGLVFMAFVHFCYLIFSTELYIFHTVLSTVETLISVMLGKFSYERLLQTNRLLAPFMFFFYSIVVVFILINMFISIIIENFQRVKSQNDLQSNEYEIVDFMTEQ 1112          
BLAST of PKD2L-1 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 228.794 bits (582), Expect = 3.250e-117
Identity = 155/298 (52.01%), Postives = 211/298 (70.81%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREI 1903
            SY KSVWNILD+VVI ++ + I FN++RT+ V  +L  LL N N + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLS+TLGRC+KD+ GFAVMFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF F     A+ + GP+YF+ YVFFV FVL NMFLAIINDTYSE+K EL +QK+E +I D  K+       +L LKKDK+  +Q AL        G + F ++K  + E G    EI + FS++D DGN+VLDA EQ  M+ +L+ ++ A++ E+
Sbjct:  389 SYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQAG----SGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTEL 682          

HSP 2 Score: 214.542 bits (545), Expect = 3.250e-117
Identity = 115/263 (43.73%), Postives = 170/263 (64.64%), Query Frame = 3
Query:  150 MRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            ++ +W T  TE++  NR  YI+TTLREL +Y++FL  + ++ +GMT+ + Y+ T  + +LFVN   +   +F S+ + ADFW+FAQGPLL+GLYW  WYN  +++    +FIY+EN L+G+ R+RQ+++ + SC +  +F+  I  CY  Y  + E    FGL N TAWTY  +  +      G +STY G GYY DL   +  +  +L+ L +N W+ RGTR V +DF+ YNANIN+FCVI L+ EFPA GG +P Y  +TV
Sbjct:   86 IKGLWGTALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSGGDAGVAFQSIGTMADFWSFAQGPLLDGLYWTKWYNQQSLNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGLINGTAWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTV 348          
BLAST of PKD2L-1 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 229.18 bits (583), Expect = 4.238e-117
Identity = 155/298 (52.01%), Postives = 211/298 (70.81%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREI 1903
            SY KSVWNILD+VVI ++ + I FN++RT+ V  +L  LL N N + +F++L+++Q  +N + A+ +F AW+KIFKYISFNKTMTQLS+TLGRC+KD+ GFAVMFFI+FFA+AQLGYLLFGT++  F      IFT +RIILGDF F     A+ + GP+YF+ YVFFV FVL NMFLAIINDTYSE+K EL +QK+E +I D  K+       +L LKKDK+  +Q AL        G + F ++K  + E G    EI + FS++D DGN+VLDA EQ  M+ +L+ ++ A++ E+
Sbjct:  389 SYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQAG----SGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTEL 682          

HSP 2 Score: 213.772 bits (543), Expect = 4.238e-117
Identity = 115/263 (43.73%), Postives = 170/263 (64.64%), Query Frame = 3
Query:  150 MRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            ++ +W T  TE++  NR  YI+TTLREL +Y++FL  + ++ +GMT+ + Y+ T  + +LFVN   +   +F S+ + ADFW+FAQGPLL+GLYW  WYN  +++    +FIY+EN L+G+ R+RQ+++ + SC +  +F+  I  CY  Y  + E    FGL N TAWTY  +  +      G +STY G GYY DL   +  +  +L+ L +N W+ RGTR V +DF+ YNANIN+FCVI L+ EFPA GG +P Y  +TV
Sbjct:   86 IKGLWGTALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSGGDAGVAFQSIGTMADFWSFAQGPLLDGLYWTKWYNQQSLNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGLINGTAWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTV 348          
BLAST of PKD2L-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 217.624 bits (553), Expect = 1.876e-59
Identity = 113/274 (41.24%), Postives = 172/274 (62.77%), Query Frame = 3
Query:  123 GFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN--NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G   R    +R +W T+  ED  +NR  Y+   LREL  YI FL  + I+ +GM +  MY+ T  ++ LF++  ++  N  +F S+++  DFW + QGP L G+YW  WYNN ++  ++ +FIY+EN L+G+ RLRQVRV +++C I  + +  ++ CY  Y+   E   PFG QN TAW +T ++ + +    G +S YGGGGYY DL   +  +   L  L ++LW+DRGTRA+ +DF+VYN N+NL C+ +L+ EFPA GGV+  + F+TV
Sbjct:  130 GCMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTV 402          

HSP 2 Score: 139.043 bits (349), Expect = 2.095e-33
Identity = 139/435 (31.95%), Postives = 233/435 (53.56%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLN-ADIIFG--PXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIH-------------------------GVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEE--RKVKIGNMVQEELIKLNQDAVLTQ 2227
            YFK++WN LDV+++ +S + II +I R      +L+ L  N   H +FD L+  Q  FN + A+ VF  WVK+FK+I+FNKTM+QLS+T+ RC+KDL GFA+MFFIIF A+AQL YL+FGT++  F                  TFQ  ++  D+++   PL+FL           ++F          +K ++   ++E E+ D+ K+     L KL LKK  +D + ++L  A     G +++DE    ++EKG    EI+++F++YD DG+  L  ++  +M++ LE ++     ++  E++ +    S ++F                           GVS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR  + ++L  +   E L  +    + ++  +V+EEL +   D V +Q
Sbjct:  444 YFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGL-ENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFS-----------------TFQGSVSRTDLLYNLRPLHFLYSHGEKGICTVSLF----------VKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQAG----GKLNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKER----EDLDLERNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLDGVMEDERLGRDADTHREQMERLVKEELERWETDDVASQ 842          
BLAST of PKD2L-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 217.624 bits (553), Expect = 2.824e-59
Identity = 113/274 (41.24%), Postives = 172/274 (62.77%), Query Frame = 3
Query:  123 GFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN--NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G   R    +R +W T+  ED  +NR  Y+   LREL  YI FL  + I+ +GM +  MY+ T  ++ LF++  ++  N  +F S+++  DFW + QGP L G+YW  WYNN ++  ++ +FIY+EN L+G+ RLRQVRV +++C I  + +  ++ CY  Y+   E   PFG QN TAW +T ++ + +    G +S YGGGGYY DL   +  +   L  L ++LW+DRGTRA+ +DF+VYN N+NL C+ +L+ EFPA GGV+  + F+TV
Sbjct:  130 GCMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTV 402          

HSP 2 Score: 203.371 bits (516), Expect = 1.708e-54
Identity = 163/432 (37.73%), Postives = 259/432 (59.95%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIH-------------------------GVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEE--RKVKIGNMVQEELIKLNQDAVLTQ 2227
            YFK++WN LDV+++ +S + II +I R      +L+ L  N   H +FD L+  Q  FN + A+ VF  WVK+FK+I+FNKTM+QLS+T+ RC+KDL GFA+MFFIIF A+AQL YL+FGT++  F     S+FT +RIILGDF F +   A+ + GP+YF+ +V F+ F+L NMFLAIINDTYSE+K ++   ++E E+ D+ K+     L KL LKK  +D + ++L  A     G +++DE    ++EKG    EI+++F++YD DG+  L  ++  +M++ LE ++     ++  E++ +    S ++F                           GVS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR  + ++L  +   E L  +    + ++  +V+EEL +   D V +Q
Sbjct:  444 YFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGL-ENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQA----GGKLNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKER----EDLDLERNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLDGVMEDERLGRDADTHREQMERLVKEELERWETDDVASQ 866          
BLAST of PKD2L-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 218.009 bits (554), Expect = 3.074e-59
Identity = 113/274 (41.24%), Postives = 172/274 (62.77%), Query Frame = 3
Query:  123 GFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN--NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            G   R    +R +W T+  ED  +NR  Y+   LREL  YI FL  + I+ +GM +  MY+ T  ++ LF++  ++  N  +F S+++  DFW + QGP L G+YW  WYNN ++  ++ +FIY+EN L+G+ RLRQVRV +++C I  + +  ++ CY  Y+   E   PFG QN TAW +T ++ + +    G +S YGGGGYY DL   +  +   L  L ++LW+DRGTRA+ +DF+VYN N+NL C+ +L+ EFPA GGV+  + F+TV
Sbjct:  130 GCMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTV 402          

HSP 2 Score: 202.986 bits (515), Expect = 3.879e-54
Identity = 164/444 (36.94%), Postives = 262/444 (59.01%), Query Frame = 2
Query: 1013 YFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIH-------------------------GVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEE--RKVKIGNMVQEELIKLNQDAVLTQKRKQNFKSDFEQ 2263
            YFK++WN LDV+++ +S + II +I R      +L+ L  N   H +FD L+  Q  FN + A+ VF  WVK+FK+I+FNKTM+QLS+T+ RC+KDL GFA+MFFIIF A+AQL YL+FGT++  F     S+FT +RIILGDF F +   A+ + GP+YF+ +V F+ F+L NMFLAIINDTYSE+K ++   ++E E+ D+ K+     L KL LKK  +D + ++L  A     G +++DE    ++EKG    EI+++F++YD DG+  L  ++  +M++ LE ++  ++     E++ +    S ++F                           GVS +E+Q L  R++ ME+ I ++V KI+ V+  LE M+ +K KRR  + ++L  +   E L  +    + ++  +V+EEL +   D V +Q   +    D  +
Sbjct:  444 YFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGL-ENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQA----GGKLNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLDL----ERNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLDGVMEDERLGRDADTHREQMERLVKEELERWETDDVASQSAMRILPEDIHK 878          
BLAST of PKD2L-1 vs. Planmine SMEST
Match: SMESG000018514.1 (SMESG000018514.1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 310/311 (99.68%), Postives = 310/311 (99.68%), Query Frame = 3
Query:    6 MAKGWSTEDMKANVEYDAYDEISHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            MAKGWSTEDMKANVEYDAYDEISHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLREL IYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTYGGGGYYVDLPSDQFSAFSLLNNLFNNLWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV
Sbjct:    1 MAKGWSTEDMKANVEYDAYDEISHADSVSFDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELVIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTYGGGGYYVDLPSDQFSAFSLLNNLFNNLWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 311          

HSP 2 Score: 218.779 bits (556), Expect = 0.000e+0
Identity = 133/134 (99.25%), Postives = 134/134 (100.00%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSI 1411
            SYFKSVWNILDVVVIGISFICIIFNIYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGTKLTGFRELHYS+
Sbjct:  352 SYFKSVWNILDVVVIGISFICIIFNIYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGTKLTGFRELHYSM 485          
BLAST of PKD2L-1 vs. Planmine SMEST
Match: SMESG000018504.1 (SMESG000018504.1)

HSP 1 Score: 308.531 bits (789), Expect = 7.493e-160
Identity = 163/306 (53.27%), Postives = 217/306 (70.92%), Query Frame = 3
Query:   54 DAYDEISHA-DSVSFDNDKNKV----KYGF-----WNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN-NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            D++D    A D   FDN K  +    + GF     WN+F  G+RS+WATK TE+   ++NLY  TT+REL +Y++FL +L II F M  G M++ TN LNNLF+  Q N N+G+F+S+ + +DFW F  GPLLNGLYWN WYN+ N+  +E N+IYFENKL+G+ R+RQ+RV + SCII N  Q  + +CY  YS  IE  E FG QNS+AW YT  + L S   QG I+TYGGGG+YVDL + Q ++ +++ +LFNN W+DR TRAV+VDFT+YNANINLFC+IKL+ EFP VGGV+P Y+F+TV
Sbjct:   16 DSHDNAPCAMDGEYFDNGKITIIDYQEIGFKNENCWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRNMPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTV 321          

HSP 2 Score: 276.559 bits (706), Expect = 7.493e-160
Identity = 192/405 (47.41%), Postives = 275/405 (67.90%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISE---QSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDA 2215
            +YF S+WN+LDV+V+ +  IC+ F+IYR   +QT+L  LL N N HPNF+YLS++Q  ++ L A  +FLA  KIFKYISFNK MTQL STL  C KDL GF++MFFI+F AFAQ GYL+FG++L  +RE +  IFTL+RIIL D  F++ L  + I GPLYF+LYVFFV F+LFNMFLAI++D Y                 D+ KE+++ +  KL+LK++K+  L+NA+   DTNNDG+MDFDEWKT ++ +G+   EIES+F+++DTDG+RVLD  EQ++M  +L +QKTA+  E+I E   Q ++  S++    I  +S  +Y  L+  I+++EN+I  L  K + +L + +N+  +K K R+S   IL   S     SE+ RK KI  ++Q+EL KLN++ 
Sbjct:  362 AYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAY-----------------DFLKEKSRKVFEKLHLKREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIESDA----IQPISYAKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILNAFSMMVENSEDYRKEKIEAIIQDELYKLNRET 745          
BLAST of PKD2L-1 vs. Planmine SMEST
Match: SMESG000018504.1 (SMESG000018504.1)

HSP 1 Score: 308.531 bits (789), Expect = 8.419e-160
Identity = 163/306 (53.27%), Postives = 217/306 (70.92%), Query Frame = 3
Query:   54 DAYDEISHA-DSVSFDNDKNKV----KYGF-----WNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN-NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            D++D    A D   FDN K  +    + GF     WN+F  G+RS+WATK TE+   ++NLY  TT+REL +Y++FL +L II F M  G M++ TN LNNLF+  Q N N+G+F+S+ + +DFW F  GPLLNGLYWN WYN+ N+  +E N+IYFENKL+G+ R+RQ+RV + SCII N  Q  + +CY  YS  IE  E FG QNS+AW YT  + L S   QG I+TYGGGG+YVDL + Q ++ +++ +LFNN W+DR TRAV+VDFT+YNANINLFC+IKL+ EFP VGGV+P Y+F+TV
Sbjct:   27 DSHDNAPCAMDGEYFDNGKITIIDYQEIGFKNENCWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRNMPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTV 332          

HSP 2 Score: 276.174 bits (705), Expect = 8.419e-160
Identity = 192/405 (47.41%), Postives = 275/405 (67.90%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISE---QSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDA 2215
            +YF S+WN+LDV+V+ +  IC+ F+IYR   +QT+L  LL N N HPNF+YLS++Q  ++ L A  +FLA  KIFKYISFNK MTQL STL  C KDL GF++MFFI+F AFAQ GYL+FG++L  +RE +  IFTL+RIIL D  F++ L  + I GPLYF+LYVFFV F+LFNMFLAI++D Y                 D+ KE+++ +  KL+LK++K+  L+NA+   DTNNDG+MDFDEWKT ++ +G+   EIES+F+++DTDG+RVLD  EQ++M  +L +QKTA+  E+I E   Q ++  S++    I  +S  +Y  L+  I+++EN+I  L  K + +L + +N+  +K K R+S   IL   S     SE+ RK KI  ++Q+EL KLN++ 
Sbjct:  373 AYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAY-----------------DFLKEKSRKVFEKLHLKREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIESDA----IQPISYAKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILNAFSMMVENSEDYRKEKIEAIIQDELYKLNRET 756          
BLAST of PKD2L-1 vs. Planmine SMEST
Match: SMESG000018504.1 (SMESG000018504.1)

HSP 1 Score: 307.375 bits (786), Expect = 1.287e-159
Identity = 160/296 (54.05%), Postives = 212/296 (71.62%), Query Frame = 3
Query:   81 DSVSFDNDKNKV----KYGF-----WNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN-NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTXXXXXXXVDLPSDQFSAFSXXXXXXXXXWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTV 938
            D   FDN K  +    + GF     WN+F  G+RS+WATK TE+   ++NLY  TT+REL +Y++FL +L II F M  G M++ TN LNNLF+  Q N N+G+F+S+ + +DFW F  GPLLNGLYWN WYN+ N+  +E N+IYFENKL+G+ R+RQ+RV + SCII N  Q  + +CY  YS  IE  E FG QNS+AW YT  + L S   QG I+TYGGGG+YVDL + Q ++ +++ +LFNN W+DR TRAV+VDFT+YNANINLFC+IKL+ EFP VGGV+P Y+F+TV
Sbjct:    2 DGEYFDNGKITIIDYQEIGFKNENCWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRNMPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTV 297          

HSP 2 Score: 276.944 bits (707), Expect = 1.287e-159
Identity = 192/405 (47.41%), Postives = 275/405 (67.90%), Query Frame = 2
Query: 1010 SYFKSVWNILDXXXXXXXXXXXXXXXYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMXXXXXXXXXQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPXXXXXXXXXXXXXXXNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISE---QSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDA 2215
            +YF S+WN+LDV+V+ +  IC+ F+IYR   +QT+L  LL N N HPNF+YLS++Q  ++ L A  +FLA  KIFKYISFNK MTQL STL  C KDL GF++MFFI+F AFAQ GYL+FG++L  +RE +  IFTL+RIIL D  F++ L  + I GPLYF+LYVFFV F+LFNMFLAI++D Y                 D+ KE+++ +  KL+LK++K+  L+NA+   DTNNDG+MDFDEWKT ++ +G+   EIES+F+++DTDG+RVLD  EQ++M  +L +QKTA+  E+I E   Q ++  S++    I  +S  +Y  L+  I+++EN+I  L  K + +L + +N+  +K K R+S   IL   S     SE+ RK KI  ++Q+EL KLN++ 
Sbjct:  338 AYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAY-----------------DFLKEKSRKVFEKLHLKREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIESDA----IQPISYAKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILNAFSMMVENSEDYRKEKIEAIIQDELYKLNRET 721          
BLAST of PKD2L-1 vs. Planmine SMEST
Match: SMESG000018510.1 (SMESG000018510.1)

HSP 1 Score: 424.476 bits (1090), Expect = 1.216e-144
Identity = 242/244 (99.18%), Postives = 244/244 (100.00%), Query Frame = 2
Query: 1535 MFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMXXXXXXXXXXXXXXQNALTNADTNNDGLMDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDXXXXXXXXXXXXILTILSSKEHLSEEERKVKIGNMVQEELIKLNQDAVLTQKRKQNFKSDFEQN 2266
            MFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMLAKLNLKKDKLDVLQNALTNADTNNDGLMDFDEWKTAMQEKGFES+EIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDNSKNKRRKSMRKILTILSSKEHLSEEERKVKIGNMVQ+ELIKLNQDAVLTQKRKQNFKSDFEQN
Sbjct:    1 MFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMLAKLNLKKDKLDVLQNALTNADTNNDGLMDFDEWKTAMQEKGFESHEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDNSKNKRRKSMRKILTILSSKEHLSEEERKVKIGNMVQKELIKLNQDAVLTQKRKQNFKSDFEQN 244          
The following BLAST results are available for this feature:
BLAST of PKD2L-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKD2L23.004e-8639.45polycystin 2 like 2, transient receptor potential ... [more]
PKD2L21.116e-8539.45polycystin 2 like 2, transient receptor potential ... [more]
PKD2L11.819e-7447.39polycystin 2 like 1, transient receptor potential ... [more]
PKD22.706e-6239.35polycystin 2, transient receptor potential cation ... [more]
PKD2L29.320e-5339.45polycystin 2 like 2, transient receptor potential ... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkd-21.874e-3638.33Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U... [more]
lov-13.482e-1425.94Location of vulva defective 1 [Source:UniProtKB/S... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pkd24.261e-3143.13gene:FBgn0041195 transcript:FBtr0080365[more]
back to top
BLAST of PKD2L-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l12.751e-12244.76polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd22.640e-6440.28polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
pkd1l2a1.833e-2632.89polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2a1.921e-2534.83polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2b5.567e-2333.46polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKD2L11.468e-7247.35polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
PKD2L11.842e-7247.35polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
PKD2L19.024e-7247.35polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
PKD2L15.324e-7047.13polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
usp331.767e-6744.44ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd26.967e-12043.17polycystin 2, transient receptor potential cation ... [more]
Pkd2l21.904e-9039.69polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd2l21.904e-9039.69polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd2l16.456e-7447.53polycystic kidney disease 2-like 1 [Source:MGI Sym... [more]
Pkd1l23.042e-2234.31polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
back to top
BLAST of PKD2L-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35245|PKD2_MOUSE4.236e-11943.17Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1... [more]
sp|Q9JLG4|PK2L2_MOUSE1.158e-8939.69Polycystic kidney disease 2-like 2 protein OS=Mus ... [more]
sp|Q9NZM6|PK2L2_HUMAN1.323e-8539.45Polycystic kidney disease 2-like 2 protein OS=Homo... [more]
sp|Q9P0L9|PK2L1_HUMAN8.736e-7447.39Polycystic kidney disease 2-like 1 protein OS=Homo... [more]
sp|A2A259|PK2L1_MOUSE4.516e-7347.53Polycystic kidney disease 2-like 1 protein OS=Mus ... [more]
back to top
BLAST of PKD2L-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJL00.000e+099.76PKD2L-1 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A077L7550.000e+075.78Transient receptor potential ion channel P a (Frag... [more]
R7T9137.127e-16450.95Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A267E5C44.912e-16349.77EF-hand domain-containing protein OS=Macrostomum l... [more]
A0A267G6B31.712e-16249.77EF-hand domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pkd2l16.899e-12747.35polycystic kidney disease 2-like 1 protein [Source... [more]
pkd23.582e-6640.14polycystin 2, transient receptor potential cation ... [more]
pkd1l2a4.611e-2631.70polycystin 1 like 2 [Source:NCBI gene;Acc:10304417... [more]
ENSAMXT00000006495.21.574e-2233.89pep primary_assembly:Astyanax_mexicanus-2.0:5:3500... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pkd2l12.835e-7248.15polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd2l16.357e-6449.83polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd28.792e-3328.76polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD2L-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470235.061e-8747.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400512.908e-2328.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391061.398e-2134.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448841.160e-2040.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447444.335e-2028.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD2L-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l13.250e-11752.01polycystin 2 like 1, transient receptor potential ... [more]
pkd2l14.238e-11752.01polycystin 2 like 1, transient receptor potential ... [more]
pkd21.876e-5941.24polycystin 2, transient receptor potential cation ... [more]
pkd22.824e-5941.24polycystin 2, transient receptor potential cation ... [more]
pkd23.074e-5941.24polycystin 2, transient receptor potential cation ... [more]
back to top
BLAST of PKD2L-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018514.10.000e+099.68SMESG000018514.1[more]
SMESG000018504.17.493e-16053.27SMESG000018504.1[more]
SMESG000018504.18.419e-16053.27SMESG000018504.1[more]
SMESG000018504.11.287e-15954.05SMESG000018504.1[more]
SMESG000018510.11.216e-14499.18SMESG000018510.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014978
GenBankAKN21731.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014978 ID=SMED30014978|Name=PKD2L-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2337bp
TTAAGATGGCAAAAGGATGGTCAACTGAAGACATGAAAGCAAATGTTGAA
TATGATGCATATGATGAAATATCGCATGCAGATTCTGTGTCATTTGACAA
TGACAAAAATAAAGTTAAATATGGTTTTTGGAATCGTTTTTCTAATGGGA
TGAGATCCATTTGGGCAACAAAGCAAACTGAAGATATCAAGGCAAATAGA
AATTTATATATTCAGACAACACTGAGAGAACTTTTTATTTATATAGTATT
CCTAGCAATTTTAATGATCATTGCATTTGGAATGACTACTGGCACAATGT
ATTGGCTTACAAATTTACTCAACAATTTGTTTGTGAATGGACAAGTCAAT
AATACTGGAAGTTTCAATTCAATGGCATCTAGTGCTGATTTCTGGACATT
TGCACAAGGACCACTTTTAAATGGACTCTATTGGAATTCATGGTACAATA
ATTTGAATGTAGATCAATCAGAAATTAACTTCATATACTTCGAAAATAAG
TTAATCGGATTAGCTAGATTGAGACAAGTTCGAGTCAGCGATAAAAGTTG
TATTATTGCTAACGAATTTCAGAAAATTATCAAACGATGTTATGTTACGT
ATTCTACGCAAATAGAATCAACTGAACCTTTTGGTCTACAAAATTCAACT
GCATGGACATATACTAGACAAACGAATTTAGGATCATTACCAATTCAAGG
CAGTATATCTACTTACGGAGGGGGAGGATATTATGTTGATTTACCATCTG
ATCAATTTTCTGCTTTCTCTTTGTTGAATAATTTATTTAATAATTTATGG
ATTGATCGGGGAACTCGTGCAGTTATAGTTGATTTCACAGTTTACAATGC
AAATATCAATTTATTTTGTGTAATTAAATTAATTGCTGAGTTTCCTGCAG
TTGGAGGAGTTATTCCTTTGTATGATTTTAAAACTGTTAAATTACTGAGA
TATTATTTATTATTTACTACACTGTTGAAGAAATAATAGAAATAAAAATT
CATAAAATTTCCTATTTTAAATCGGTGTGGAATATTTTGGATGTTGTAGT
AATCGGGATAAGCTTCATTTGTATAATCTTCAATATATATCGCACAGTTG
CTGTACAAACAATTTTGGAAAGTTTACTAATGAACGATAATCAGCATCCC
AATTTCGATTATTTGAGTTATTACCAATTCACGTTCAATTACTTATTAGC
TATTACCGTTTTTCTAGCATGGGTAAAAATATTTAAATACATCAGTTTCA
ACAAAACAATGACTCAATTAAGTTCTACATTAGGTAGATGTTCAAAGGAT
CTAGCTGGTTTTGCTGTTATGTTTTTCATCATATTTTTTGCATTTGCTCA
GCTAGGATATTTGTTGTTCGGAACAAAACTCACTGGTTTCCGAGAATTAC
ATTACAGCATATTCACTCTGTATCGAATAATTTTGGGCGATTTCACATTC
CAAGATTTTCTAAATGCCGATATTATATTTGGACCTTTATACTTCCTTTT
ATATGTGTTCTTTGTTTTGTTCGTTCTTTTCAACATGTTTCTGGCTATCA
TCAATGACACATACTCTGAAATTAAAAATGAACTAATCAATCAGAAAAAT
GAATTCGAAATCGGAGATTATTTTAAAGAAAGAACTCAAATGATGTTGGC
TAAGTTGAATTTGAAGAAAGATAAGCTAGATGTTTTACAGAATGCACTGA
CAAATGCCGATACCAACAACGATGGATTAATGGATTTTGATGAGTGGAAA
ACTGCAATGCAAGAAAAAGGATTTGAATCGTATGAAATAGAGTCTGTGTT
TTCACGGTATGACACGGATGGCAATCGAGTTCTAGATGCAAATGAACAAA
TAGAAATGCAAAATCAACTTGAAAATCAGAAAACTGCAGTGAATAGAGAA
ATAATTTCTGAGCAATCTGAAATCCCGAATTCAGAATCGAAGAAAACTTT
TATCCATGGTGTTTCAATTGATGAGTATCAAGACTTAAATTTTAGAATTG
AGGAAATGGAAAATGTTATCAACACTCTCGTGTTAAAAATTAATGACGTT
TTGAAAGATCTAGAAAATATGGATAATTCTAAGAATAAAAGAAGAAAGTC
AATGAGAAAAATTTTAACCATTTTATCGTCAAAAGAACATCTTAGCGAAG
AAGAAAGAAAAGTAAAAATTGGAAATATGGTCCAAGAAGAATTAATCAAG
TTAAATCAAGATGCTGTTTTAACTCAGAAACGTAAGCAAAATTTCAAGTC
GGACTTTGAACAAAATTGACGTAACTTAACATTCCTCATGTTATTCTCAG
CAATAATTATTTTATTTAATAAATGGCATTGATGAAA
back to top

protein sequence of SMED30014978-orf-1

>SMED30014978-orf-1 ID=SMED30014978-orf-1|Name=SMED30014978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSST
LGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGTKLTGFRELHYSIFTLYRI
ILGDFTFQDFLNADIIFGPLYFLLYVFFVLFVLFNMFLAIINDTYSEIKN
ELINQKNEFEIGDYFKERTQMMLAKLNLKKDKLDVLQNALTNADTNNDGL
MDFDEWKTAMQEKGFESYEIESVFSRYDTDGNRVLDANEQIEMQNQLENQ
KTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTL
VLKINDVLKDLENMDNSKNKRRKSMRKILTILSSKEHLSEEERKVKIGNM
VQEELIKLNQDAVLTQKRKQNFKSDFEQN*
back to top

protein sequence of SMED30014978-orf-2

>SMED30014978-orf-2 ID=SMED30014978-orf-2|Name=SMED30014978-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=328bp
KMAKGWSTEDMKANVEYDAYDEISHADSVSFDNDKNKVKYGFWNRFSNGM
RSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMY
WLTNLLNNLFVNGQVNNTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNN
LNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTY
STQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTYGGGGYYVDLPSD
QFSAFSLLNNLFNNLWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAV
GGVIPLYDFKTVKLLRYYLLFTTLLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR003915PKD_2
IPR002048EF_hand_dom
IPR027359Volt_channel_dom_sf
IPR011992EF-hand-dom_pair
IPR013122PKD1_2_channel
IPR018247EF_Hand_1_Ca_BS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005262calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0050982detection of mechanical stimulus
GO:0070588calcium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 237..264
NoneNo IPR availableCOILSCoilCoilcoord: 138..158
NoneNo IPR availableCOILSCoilCoilcoord: 290..310
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 169..261
e-value: 1.7E-18
score: 68.1
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 276..339
e-value: 5.3E-12
score: 47.5
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 42..150
e-value: 1.4E-8
score: 36.6
NoneNo IPR availablePANTHERPTHR10877:SF114POLYCYSTIN-2coord: 2..298
NoneNo IPR availablePANTHERPTHR10877POLYCYSTIN-RELATEDcoord: 2..298
NoneNo IPR availableTMHMMTMhelixcoord: 115..137
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
IPR003915Polycystic kidney disease type 2 proteinPRINTSPR01433POLYCYSTIN2coord: 13..38
score: 49.23
coord: 289..307
score: 40.0
coord: 121..142
score: 70.91
coord: 60..81
score: 74.55
coord: 161..180
score: 34.0
IPR002048EF-hand domainSMARTSM00054efh_1coord: 185..213
e-value: 0.0042
score: 26.3
coord: 219..247
e-value: 7.9
score: 10.5
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 181..216
score: 12.477
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 219..250
score: 6.563
IPR013122Polycystin cation channel, PKD1/PKD2PFAMPF08016PKD_channelcoord: 3..148
e-value: 2.1E-44
score: 151.9
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 194..206
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 170..275