Aurora kinase A-A

Overview
NameAurora kinase A-A
Smed IDSMED30014970
Length (bp)1149
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aurora kinase A-A (SMED30014970) t-SNE clustered cells

Violin plots show distribution of expression levels for Aurora kinase A-A (SMED30014970) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aurora kinase A-A (SMED30014970) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aurora kinase A-A (SMED30014970) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014970

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014970SMESG000060356.1 SmedASXL_013325SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014970SMESG000060356.1 SmedASXL_013325SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30014970SMESG000060356.1 dd_Smed_v4_15869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30014970SMESG000060356.1 Contig55066newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014970SMESG000060356.1 Contig55066uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
neoblastSMED30014970SMESG000060356.1 SMED_11520_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014970SMESG000060356.1 SMED_11520_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014970SMESG000060356.1 SmWIOct06_000536GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014970SMESG000060356.1 SMED_11520_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014970SMESG000060356.1 SMED_11520_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aurora kinase A-A vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 202.216 bits (513), Expect = 1.314e-60
Identity = 102/253 (40.32%), Postives = 147/253 (58.10%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A EK  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL SAG +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A    E    I  V + FP          ++ LL+ +  +R    +VL  P+I
Sbjct:  131 EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWI 383          
BLAST of Aurora kinase A-A vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 202.216 bits (513), Expect = 1.314e-60
Identity = 102/253 (40.32%), Postives = 147/253 (58.10%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A EK  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL SAG +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A    E    I  V + FP          ++ LL+ +  +R    +VL  P+I
Sbjct:  131 EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWI 383          
BLAST of Aurora kinase A-A vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 202.216 bits (513), Expect = 1.314e-60
Identity = 102/253 (40.32%), Postives = 147/253 (58.10%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A EK  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL SAG +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A    E    I  V + FP          ++ LL+ +  +R    +VL  P+I
Sbjct:  131 EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWI 383          
BLAST of Aurora kinase A-A vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 202.216 bits (513), Expect = 1.314e-60
Identity = 102/253 (40.32%), Postives = 147/253 (58.10%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A EK  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL SAG +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A    E    I  V + FP          ++ LL+ +  +R    +VL  P+I
Sbjct:  131 EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWI 383          
BLAST of Aurora kinase A-A vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 202.216 bits (513), Expect = 1.314e-60
Identity = 102/253 (40.32%), Postives = 147/253 (58.10%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A EK  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL SAG +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A    E    I  V + FP          ++ LL+ +  +R    +VL  P+I
Sbjct:  131 EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWI 383          
BLAST of Aurora kinase A-A vs. Ensembl Celegans
Match: air-2 (Aurora/IPL1-related protein kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O01427])

HSP 1 Score: 187.193 bits (474), Expect = 2.074e-56
Identity = 95/252 (37.70%), Postives = 140/252 (55.56%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQV 805
             K +  DF I   +G G+F  VY A  K     VA+K+  KS+      ++ +E E++I   L HPN+++L+  F D    YL+LE+   GEM + +   K +    AA Y+Y+I+ AL YCH  ++IHRDIK EN+L+ S G +KI DFG S       R T CGT+ ++ PE++NGA+ +  VD+W++GVLCYE L  + PF  E+ S+    I+  R+ +P          +  LL  D   R T  QV
Sbjct:   23 GKFTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPSNKRQTMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQV 274          
BLAST of Aurora kinase A-A vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 178.718 bits (452), Expect = 7.836e-53
Identity = 89/257 (34.63%), Postives = 151/257 (58.75%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYP-NER-AATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            S  DF +   +G G+F  V+ + EK  KR++ALK+  K++  +    + ++ E++I + L+HPN+L L+G F DD   ++IL++   GE+   +    G+  NE  A  +V Q+++AL YCH+  +IHRDIK EN+LL S   +K+ADFG S + +   RHT CGT+ ++APE+++       VDIW++G+L +EML    PF  +   ++   I+  +   P          +N++++K+  ERL    ++A P+I
Sbjct:   40 SLDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWI 296          
BLAST of Aurora kinase A-A vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 178.718 bits (452), Expect = 7.836e-53
Identity = 89/257 (34.63%), Postives = 151/257 (58.75%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYP-NER-AATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            S  DF +   +G G+F  V+ + EK  KR++ALK+  K++  +    + ++ E++I + L+HPN+L L+G F DD   ++IL++   GE+   +    G+  NE  A  +V Q+++AL YCH+  +IHRDIK EN+LL S   +K+ADFG S + +   RHT CGT+ ++APE+++       VDIW++G+L +EML    PF  +   ++   I+  +   P          +N++++K+  ERL    ++A P+I
Sbjct:   40 SLDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWI 296          
BLAST of Aurora kinase A-A vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 147.517 bits (371), Expect = 3.135e-41
Identity = 87/270 (32.22%), Postives = 148/270 (54.81%), Query Frame = 2
Query:   47 MLNKISTK---DFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTS---AGAVKIADFGCS-KLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFP-PKSDI---SVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            M+N  STK   ++ + E++G G F+ V + + K      A KI  +K    R    +E E +I   L+HPN+++L  +  +++  YL+ +    GE+  DI+  + Y    A+  + QI  ++ YCH+N I+HRD+K EN+LL S     AVK+ADFG + ++ + +  H F GT  +++PE+L     +  VDIW+ GV+ Y +L    PF  E+   +   I+   Y++P P+ D      +  ++S+L  +  +R+TA Q L  P+I
Sbjct:    1 MMNA-STKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Aurora kinase A-A vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 147.517 bits (371), Expect = 3.135e-41
Identity = 87/270 (32.22%), Postives = 148/270 (54.81%), Query Frame = 2
Query:   47 MLNKISTK---DFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTS---AGAVKIADFGCS-KLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFP-PKSDI---SVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            M+N  STK   ++ + E++G G F+ V + + K      A KI  +K    R    +E E +I   L+HPN+++L  +  +++  YL+ +    GE+  DI+  + Y    A+  + QI  ++ YCH+N I+HRD+K EN+LL S     AVK+ADFG + ++ + +  H F GT  +++PE+L     +  VDIW+ GV+ Y +L    PF  E+   +   I+   Y++P P+ D      +  ++S+L  +  +R+TA Q L  P+I
Sbjct:    1 MMNA-STKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Aurora kinase A-A vs. Ensembl Fly
Match: aurA (gene:FBgn0000147 transcript:FBtr0082483)

HSP 1 Score: 187.578 bits (475), Expect = 3.373e-55
Identity = 98/259 (37.84%), Postives = 149/259 (57.53%), Query Frame = 2
Query:   71 DFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDIL--KCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSE 838
            +F I   +G G+F  VY A EK  + VVALK+  K + G++  ++ +  E++I   L+HP++L+L+  F DD   YLILE+   G +   +     K +   ++ATY+  + SAL Y H   IIHRDIK EN+LL   G +KIADFG S      +R T CGT+ ++ PE++ G   T  VD+WSLGVLC+E+L    PF+++N  E    I  V Y+ P     +  + ++ LL  +   RL   QV+  P+IL +++
Sbjct:  153 NFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHTQ 411          
BLAST of Aurora kinase A-A vs. Ensembl Fly
Match: aurB (gene:FBgn0024227 transcript:FBtr0080180)

HSP 1 Score: 176.022 bits (445), Expect = 9.681e-52
Identity = 94/268 (35.07%), Postives = 147/268 (54.85%), Query Frame = 2
Query:   38 SYSMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNER-----AATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +Y      S +DF +   +G G+F +VY A E++   +VA+K+  K +  K   +  +  E++I   LKHP++L+L   F D++  YL LE    GE+ + +   +G PN R     +A Y YQ+++AL YCH N++IHRD+K ENILLTS   +K+ADFG S       R T CGTL ++ PE+++G      VD W LG+LCYE +    PF + +       IR +   +P       +  +  LLRK++  R+T   V+   ++
Sbjct:   41 AYGQPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHL---RGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWV 305          
BLAST of Aurora kinase A-A vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 161.384 bits (407), Expect = 2.032e-43
Identity = 93/260 (35.77%), Postives = 142/260 (54.62%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILK-CKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEK-QLRH-TFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYS 835
            +D+ +   +G G FA VYKA   +  + VA+K I K     T   N +  EV+IH  LKHP++LQL+  F D N  YL+LE    GE+ R +    + +    AA+ + Q+ + L Y H+++I+HRDI   N+LL+    VKIADFG +  L++   RH T CGT  +++PE+++        D+WS+G + Y +L  R PF  + V    + +    Y  P       +  +N LL+K  +ER+T   VL  PF+LK S
Sbjct:   12 EDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLKCS 271          
BLAST of Aurora kinase A-A vs. Ensembl Fly
Match: KP78b (gene:FBgn0026063 transcript:FBtr0082408)

HSP 1 Score: 152.91 bits (385), Expect = 6.329e-41
Identity = 89/249 (35.74%), Postives = 135/249 (54.22%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVY-QISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLE-KQLRHTFCGTLAFVAPEILNGAEQTAM-VDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLA 811
            + I++ +G G FAKV  AI     R VA+K+       T ++  +  EV I   L HPN+++L      +   YL++E+   GE+   ++K  G   ER A  ++ Q+ SA+EYCH+ SI+HRD+K+EN+LL     +KIADFG S   E K    TFCG+  + APE+  G + +   VD WSLGV+ Y ++    PF   N+ E+RD +   +Y  P    I  E  +   L  +  +R + S V+A
Sbjct:   63 YKIIKTLGKGNFAKVKLAIHLPTGREVAIKLIDKTALNTIARQKLYREVNIMKKLNHPNIVRLLQVIESERTLYLVMEYVSGGELFNYLVK-NGRMRERDARVLFRQLVSAIEYCHSKSIVHRDLKAENLLLDQQMKLKIADFGFSTTFEPKAPLETFCGSPPYAAPELFRGKKYSGPEVDSWSLGVVLYTLVSGSLPFDGTNLKELRDRVLRGKYRVPYYVSIECESLIRKFLVLNPTQRTSLSAVMA 310          
BLAST of Aurora kinase A-A vs. Ensembl Fly
Match: KP78b (gene:FBgn0026063 transcript:FBtr0301427)

HSP 1 Score: 152.91 bits (385), Expect = 6.329e-41
Identity = 89/249 (35.74%), Postives = 135/249 (54.22%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVY-QISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLE-KQLRHTFCGTLAFVAPEILNGAEQTAM-VDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLA 811
            + I++ +G G FAKV  AI     R VA+K+       T ++  +  EV I   L HPN+++L      +   YL++E+   GE+   ++K  G   ER A  ++ Q+ SA+EYCH+ SI+HRD+K+EN+LL     +KIADFG S   E K    TFCG+  + APE+  G + +   VD WSLGV+ Y ++    PF   N+ E+RD +   +Y  P    I  E  +   L  +  +R + S V+A
Sbjct:   63 YKIIKTLGKGNFAKVKLAIHLPTGREVAIKLIDKTALNTIARQKLYREVNIMKKLNHPNIVRLLQVIESERTLYLVMEYVSGGELFNYLVK-NGRMRERDARVLFRQLVSAIEYCHSKSIVHRDLKAENLLLDQQMKLKIADFGFSTTFEPKAPLETFCGSPPYAAPELFRGKKYSGPEVDSWSLGVVLYTLVSGSLPFDGTNLKELRDRVLRGKYRVPYYVSIECESLIRKFLVLNPTQRTSLSAVMA 310          
BLAST of Aurora kinase A-A vs. Ensembl Zebrafish
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 202.986 bits (515), Expect = 4.002e-61
Identity = 101/263 (38.40%), Postives = 154/263 (58.56%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKE 853
            ++F I   +G G+F  VY A E+  K ++ALK+  K +  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILEF   GE+  ++ +C  + ++R+ATY+ +++ AL YCH+ ++IHRDIK EN+LL + G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  R PF  ++  E    I  V + +P          +N LL+ +   RL    V+  P+++   EN+ K+
Sbjct:  136 ENFDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSATYIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSNGSRDLINRLLKHNPMHRLPIQGVMEHPWVV---ENSTKK 395          
BLAST of Aurora kinase A-A vs. Ensembl Zebrafish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:791894])

HSP 1 Score: 195.667 bits (496), Expect = 2.911e-59
Identity = 100/264 (37.88%), Postives = 147/264 (55.68%), Query Frame = 2
Query:   59 ISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            +S  DF I   +G G+F  VY A E+ +K V+ALK+  KS+  K   ++ +  E++I   L+HPN+L+ +  F DD   +LILE+   GEM +++ +   + ++R ATY+ ++S AL+YCH   +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G      VD+WS+GVLCYE L    PF   + +E    I  V  +FP          ++ LLR     RL    V+  P++   S   L
Sbjct:   48 LSIDDFDIGRPLGKGKFGNVYLARERKLKVVIALKVLFKSQMVKEGVEHQLRREIEIQSHLRHPNILRFYNYFHDDTRVFLILEYAPRGEMYKELQRYGHFDDQRTATYMEEVSDALQYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHSHDEKVDLWSIGVLCYECLVGNPPFETASHAETYKRITKVDLQFPKLVSEGARDLISKLLRHSPSMRLPLRSVMEHPWVKANSRRVL 311          
BLAST of Aurora kinase A-A vs. Ensembl Zebrafish
Match: si:ch211-117c9.1 (si:ch211-117c9.1 [Source:ZFIN;Acc:ZDB-GENE-110411-282])

HSP 1 Score: 154.066 bits (388), Expect = 1.301e-43
Identity = 83/228 (36.40%), Postives = 130/228 (57.02%), Query Frame = 2
Query:   50 LNKISTKD-FSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCS-KLLEKQLRHTFCGTLAFVAPEILNGAE-QTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFP 721
            L+K S K  F +LE +G G + KV +A+E+   + VA+K I K +      +  I+ E++I  SL HPN+++L+  F       +++E+   GE+   I   +    + A  +  QI+SA+ YCH N ++HRD+K ENILL     VK+ADFG S + +  +   TFCG+  + +PEI+NG       VD WSLGVL Y +++   PF   N S +++ IR+  Y+ P
Sbjct:   25 LHKHSLKRRFEVLETLGRGTYGKVKRAVERQYGKTVAIKSIRKERLRNDLDRAHIQREIEITSSLVHPNIIRLYEVFESRERIVMVMEYASGGELYEYIQDKQRLSEDEARHFFRQITSAVHYCHQNGVVHRDLKLENILLDKDLTVKLADFGLSNRYMRGRCLDTFCGSPLYASPEIINGLPYHGPEVDCWSLGVLLYALVYGSMPFDGTNYSILKEQIRHGLYKTP 252          
BLAST of Aurora kinase A-A vs. Ensembl Zebrafish
Match: nuak1a (NUAK family, SNF1-like kinase, 1a [Source:ZFIN;Acc:ZDB-GENE-041210-122])

HSP 1 Score: 152.91 bits (385), Expect = 8.878e-41
Identity = 82/222 (36.94%), Postives = 126/222 (56.76%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEK-QLRHTFCGTLAFVAPEILNGAE-QTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKS 730
            + +LE +G G + KV KAIE++  RVVA+K I K K    +    I  E++I  SL+HP+++ ++  F + +   +++E+   GE+   I + +         +  QI SA+ YCH   ++HRD+K ENILL   G +KIADFG S L  K +L  TFCG+  + +PEI+NG   +   VD W+LGVL Y +++   PF   +   +   I N  Y  PP+S
Sbjct:   53 YELLETLGRGTYGKVKKAIERHTGRVVAIKSIRKEKIKDEQDMVHIRREIEIMSSLRHPHIISIYEVFENKDKIVIVMEYASKGELYDYISERRRLTERETRHFFRQIVSAVHYCHKKGVVHRDLKLENILLDDNGNIKIADFGLSNLYHKDKLLQTFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGGDHQRLIRQISNGEYREPPQS 274          
BLAST of Aurora kinase A-A vs. Ensembl Zebrafish
Match: sgk1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:324140])

HSP 1 Score: 147.132 bits (370), Expect = 1.104e-39
Identity = 85/244 (34.84%), Postives = 135/244 (55.33%), Query Frame = 2
Query:   71 DFSILEKVGDGQFAKVYKAIEKNIKRVVALKI-SKSKFGKTRSKNTIESEVKIHF-SLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFG-CSKLLEKQ-LRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERL 790
            DF  L+ +G G F KV  A  ++ ++  A+K+  K    K + +  I SE  +   ++KHP L+ L  +F   +  Y +L++   GE+   + + + +   RA  Y  +I+SAL Y H+ +I++RD+K ENILL S G + + DFG C + +E      TFCGT  ++APE+L+       VD W LG + YEML+   PF++ N +E+ DNI N   +  P    +  + L  LL+KD  +RL
Sbjct:   99 DFDFLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNISNAARHLLEGLLQKDRTKRL 342          
BLAST of Aurora kinase A-A vs. Ensembl Xenopus
Match: zbtb39 (zinc finger and BTB domain containing 39 [Source:Xenbase;Acc:XB-GENE-957946])

HSP 1 Score: 196.823 bits (499), Expect = 2.052e-58
Identity = 99/268 (36.94%), Postives = 153/268 (57.09%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAI 868
            +DF I   +G G+F  VY A E+  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLIL++   GE+ R++ K   +  +++A Y+ Q++ AL YCH+ ++IHRDIK EN+LL + G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF  +   E    I  V +++P          ++ LL+ +   RL+   VL  P+I+  S    K  +  +
Sbjct:  144 EDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKTQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILDYAPGGELFRELQKVTRFDEQKSALYIKQLAEALLYCHSKNVIHRDIKPENLLLGANGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPSYVSEGARDLVSKLLKHNPNHRLSLKGVLEHPWIIDNSAQKPKRKEGPV 411          
BLAST of Aurora kinase A-A vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 187.963 bits (476), Expect = 1.138e-55
Identity = 96/265 (36.23%), Postives = 149/265 (56.23%), Query Frame = 2
Query:   56 KISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            K +  DF I   +G G+F  VY A +K  K ++ALK+  KS+  K   ++ +  E++I   L+HPN+L+++  F D    YL+LEF   GE+ +++ K   +  +R+AT++ +++ AL+YCH   +IHRDIK EN+L+   G +KIADFG S       R T CGTL ++ PE++ G      VD+W  GVLC+E L    PF + + +E    I NV  +FPP      +  ++ LLR    +RL    V+  P++   S   L
Sbjct:   87 KFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL 351          
BLAST of Aurora kinase A-A vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 188.348 bits (477), Expect = 1.188e-55
Identity = 96/266 (36.09%), Postives = 149/266 (56.02%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
             K +  DF I   +G G+F  VY A +K  K ++ALK+  KS+  K   ++ +  E++I   L+HPN+L+++  F D    YL+LEF   GE+ +++ K   +  +R+AT++ +++ AL+YCH   +IHRDIK EN+L+   G +KIADFG S       R T CGTL ++ PE++ G      VD+W  GVLC+E L    PF + + +E    I NV  +FPP      +  ++ LLR    +RL    V+  P++   S   L
Sbjct:   96 RKFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL 361          
BLAST of Aurora kinase A-A vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 187.963 bits (476), Expect = 1.597e-55
Identity = 96/265 (36.23%), Postives = 149/265 (56.23%), Query Frame = 2
Query:   56 KISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            K +  DF I   +G G+F  VY A +K  K ++ALK+  KS+  K   ++ +  E++I   L+HPN+L+++  F D    YL+LEF   GE+ +++ K   +  +R+AT++ +++ AL+YCH   +IHRDIK EN+L+   G +KIADFG S       R T CGTL ++ PE++ G      VD+W  GVLC+E L    PF + + +E    I NV  +FPP      +  ++ LLR    +RL    V+  P++   S   L
Sbjct:  102 KFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL 366          
BLAST of Aurora kinase A-A vs. Ensembl Xenopus
Match: exosc4 (exosome component 4 [Source:Xenbase;Acc:XB-GENE-969649])

HSP 1 Score: 151.369 bits (381), Expect = 6.011e-42
Identity = 89/257 (34.63%), Postives = 142/257 (55.25%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSA---GAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEF--PPKSDI--SVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            ++I EK+G G F++V  A EKN +R+VALK    K  + + +  +E+E+ +   + H N++ L   +      YL +E    GE+   I++   Y  + A+  + Q+  A++Y HN  I+HRD+K EN+L  +      + I+DFG SK+ +  +  T CGT  +VAPE+L        VD+W++GV+ Y +L    PF+ EN SE+ + I    YEF  P   DI  S + F+  LL ++  +RLT  Q L  P+I
Sbjct:   18 YNIKEKLGAGAFSEVVLAQEKNSERLVALKCIPKKALRGK-EAVVENEIAVLKKITHKNIVSLEDIYESPTHLYLAMELVTGGELFDRIIERGYYTEKDASQLIRQVLDAVQYLHNMGIVHRDLKPENLLYATPFEDSKIMISDFGLSKIEDGGMMATACGTPGYVAPELLEQKPYGKAVDVWAIGVISYILLCGYPPFYDENDSELFNQILKAEYEFDSPYWDDISESAKDFIRHLLEREPEKRLTCEQALQHPWI 273          
BLAST of Aurora kinase A-A vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 202.986 bits (515), Expect = 4.416e-61
Identity = 102/253 (40.32%), Postives = 148/253 (58.50%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A E+  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL S G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L    PF A    E    I  V + FP          ++ LL+ +  +RLT ++VL  P+I
Sbjct:  122 EDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWI 374          
BLAST of Aurora kinase A-A vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 202.986 bits (515), Expect = 4.416e-61
Identity = 102/253 (40.32%), Postives = 148/253 (58.50%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A E+  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL S G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L    PF A    E    I  V + FP          ++ LL+ +  +RLT ++VL  P+I
Sbjct:  122 EDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWI 374          
BLAST of Aurora kinase A-A vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 202.216 bits (513), Expect = 1.408e-60
Identity = 102/253 (40.32%), Postives = 148/253 (58.50%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            +DF I   +G G+F  VY A E+  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL S G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L    PF A    E    I  V + FP          ++ LL+ +  +RLT ++VL  P+I
Sbjct:  144 EDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWI 396          
BLAST of Aurora kinase A-A vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 197.208 bits (500), Expect = 2.224e-60
Identity = 104/274 (37.96%), Postives = 155/274 (56.57%), Query Frame = 2
Query:   29 IKKSYSMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            ++ S S     +  DF I   +G G+F +VY A  K    +VALK+  KS+  K   ++ +  EV+I   L+H N+L+L+  F DD   YLILE+   GE+ +++ + +    +R AT + ++S AL YCH   +IHRDIK EN+LL   G VKI+DFG S       R T CGTL ++ PE++       MVD+W +GVLCYE+L  + PF +   SE    IR V ++FP       +  ++ LLR    ERL+ +QVL  P++ ++S   L
Sbjct:    1 MEPSTSTRKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVL 274          
BLAST of Aurora kinase A-A vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 197.208 bits (500), Expect = 2.224e-60
Identity = 104/274 (37.96%), Postives = 155/274 (56.57%), Query Frame = 2
Query:   29 IKKSYSMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            ++ S S     +  DF I   +G G+F +VY A  K    +VALK+  KS+  K   ++ +  EV+I   L+H N+L+L+  F DD   YLILE+   GE+ +++ + +    +R AT + ++S AL YCH   +IHRDIK EN+LL   G VKI+DFG S       R T CGTL ++ PE++       MVD+W +GVLCYE+L  + PF +   SE    IR V ++FP       +  ++ LLR    ERL+ +QVL  P++ ++S   L
Sbjct:    1 MEPSTSTRKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVL 274          
BLAST of Aurora kinase A-A vs. UniProt/SwissProt
Match: sp|Q9M077|AUR1_ARATH (Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana OX=3702 GN=AUR1 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.713e-65
Identity = 110/262 (41.98%), Postives = 160/262 (61.07%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEY--FLNSLLRKDTYERLTASQVLAFPFILK 829
             + +  DF I + +G G+F  VY A EK    VVALK+  KS+  +++ ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   GE+ +D+ KCK +   RAATYV  ++ AL YCH   +IHRDIK EN+L+ + G +KIADFG S +     R T CGTL ++ PE++   E  A VDIWSLG+LCYE L+   PF A   S+    I  V  +FPPK  IS      ++ +L K++ +RL   ++L  P+I++
Sbjct:   24 KRWTLSDFDIGKPLGRGKFGHVYLAREKRSNHVVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAARGELYKDLQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWS-VHTFNRRRTMCGTLDYLPPEMVESVEHDASVDIWSLGILCYEFLYGVPPFEAMEHSDTYRRIVQVDLKFPPKPIISASAKDLISQMLVKESSQRLPLHKLLEHPWIVQ 284          
BLAST of Aurora kinase A-A vs. UniProt/SwissProt
Match: sp|Q683C9|AUR2_ARATH (Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana OX=3702 GN=AUR2 PE=2 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 1.759e-65
Identity = 108/262 (41.22%), Postives = 162/262 (61.83%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDI--SVEYFLNSLLRKDTYERLTASQVLAFPFILK 829
             + +T DF I + +G G+F  VY A EK    +VALK+  K++  +++ ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   GE+ +++ KCK +   RAATYV  ++ AL YCH   +IHRDIK EN+L+ + G +KIADFG S +     R T CGTL ++ PE++   E  A VDIWSLG+LCYE L+   PF A   SE    I  V  +FPPK  +  S +  ++ +L K++ +RL   ++L  P+I++
Sbjct:   12 KRWTTSDFDIGKPLGRGKFGHVYLAREKRSDHIVALKVLFKAQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAVRGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWS-VHTFNRRRTMCGTLDYLPPEMVESVEHDASVDIWSLGILCYEFLYGVPPFEAREHSETYKRIVQVDLKFPPKPIVSSSAKDLISQMLVKESTQRLALHKLLEHPWIVQ 272          
BLAST of Aurora kinase A-A vs. UniProt/SwissProt
Match: sp|Q91820|AURAA_XENLA (Aurora kinase A-A OS=Xenopus laevis OX=8355 GN=aurka-a PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.722e-63
Identity = 104/258 (40.31%), Postives = 154/258 (59.69%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSE 838
            +DF I   +G G+F  VY A E+  K ++ALK+  KS+  K   ++ +  EV+I   L+HPN+L+L+G F D +  YLIL++   GE+ R++ KC  + ++R+A Y+ Q++ AL YCH+  +IHRDIK EN+LL S G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF  +   E    I  V +++PP         ++ LL+ +   RL    VL  P+I+K S+
Sbjct:  138 EDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKSQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILDYAPGGELFRELQKCTRFDDQRSAMYIKQLAEALLYCHSKKVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDETVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPPYVSEEARDLVSKLLKHNPNHRLPLKGVLEHPWIIKNSQ 395          
BLAST of Aurora kinase A-A vs. UniProt/SwissProt
Match: sp|Q91819|AURAB_XENLA (Aurora kinase A-B OS=Xenopus laevis OX=8355 GN=aurka-b PE=2 SV=3)

HSP 1 Score: 209.534 bits (532), Expect = 1.085e-62
Identity = 105/263 (39.92%), Postives = 156/263 (59.32%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKE 853
            +DF I   +G G+F  VY A E+  K ++ALK+  KS+  K   ++ +  EV+I   L+HPN+L+L+G F D    YLIL++   GE+ R++ KC  + ++R+A Y+ Q++ AL YCH+  +IHRDIK EN+LL S G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF  +   E    I  V +++PP      +  ++ LL+ +   RL    VL  P+I+K S+   K+
Sbjct:  138 EDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKSQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDACRVYLILDYAPGGELFRELQKCTRFDDQRSALYIKQLAEALLYCHSKKVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPPYVSEEAKDLVSKLLKHNPNHRLPLKGVLEHPWIVKNSQQPKKK 400          
BLAST of Aurora kinase A-A vs. UniProt/SwissProt
Match: sp|Q2TA06|AURKA_BOVIN (Aurora kinase A OS=Bos taurus OX=9913 GN=AURKA PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.516e-61
Identity = 104/260 (40.00%), Postives = 153/260 (58.85%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENT 844
            +DF I   +G G+F  VY A EK  K ++ALK+  K++  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   G + R++ K   +  +R ATY+ ++++AL YCH+  +IHRDIK EN+LL SAG +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A+   E    I  V + FP          ++ LL+ +  +R T  +VL  P+I+  S+ +
Sbjct:  131 EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEADTYQETYRRISRVEFTFPDCVPEGARDLISRLLKHNPSQRPTLKEVLEHPWIIANSKPS 390          
BLAST of Aurora kinase A-A vs. TrEMBL
Match: A0A2T7NIA0 (Protein kinase domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19057 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.109e-65
Identity = 113/261 (43.30%), Postives = 155/261 (59.39%), Query Frame = 2
Query:   50 LNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILK 829
            + K S  DF I + +G G+F  VY A EK  K +VALK+  KS+  K   ++ +  E++I   L+H N+L++FG F D    YLILEF   GE+ +++ +C  +  +R ATY++Q+SSAL YCH+  +IHRDIK EN+LL+  G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L    PF AEN SE    I  V   FP          ++ LLR D  +RL   QV+  P+IL+
Sbjct:   69 MKKWSLDDFDIGKPLGKGKFGNVYLAREKQSKYIVALKLMFKSQLQKAGVEHQLRREIEIQSHLRHENILRMFGYFHDKTRVYLILEFAPRGELYKELQRCGRFDEKRTATYIHQLSSALTYCHSKKVIHRDIKPENLLLSLRGDLKIADFGWSVHAPSSRRTTMCGTLDYLPPEMVEGKTHDENVDLWSLGVLCYEFLVGSPPFEAENHSETYARITKVDLRFPDFVSSGARDLISKLLRHDPKKRLPLQQVMTHPWILE 329          
BLAST of Aurora kinase A-A vs. TrEMBL
Match: A0A540L7Z8 (Protein kinase domain-containing protein OS=Malus baccata OX=106549 GN=C1H46_031854 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.067e-64
Identity = 111/267 (41.57%), Postives = 165/267 (61.80%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEY--FLNSLLRKDTYERLTASQVLAFPFILKYSENT 844
             + +  DF I + +G G+F  VY A EK    +VALK+  KS+  +++ ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   GE+ +++ KCK +   RAATYV  ++ AL YCH   +IHRDIK EN+L+ + G +KIADFG S +     R T CGTL ++ PE++   E  A VDIWSLGVLCYE L+   PF A+  S+    I  V  +FPPK  +S +    ++ +L KD+ ERL   ++L  P+I++ +E +
Sbjct:   24 RRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVVSLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWS-VHTFNRRRTMCGTLDYLPPEMVESVEHDASVDIWSLGVLCYEFLYGVPPFEAKEHSDTYRRIVQVDLKFPPKPIVSAQAKDLISQMLVKDSAERLPLHKLLEHPWIVQNAEPS 289          
BLAST of Aurora kinase A-A vs. TrEMBL
Match: M1VA81 (Aurora kinase OS=Cyanidioschyzon merolae (strain 10D) OX=280699 GN=CYME_CMQ044C PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.326e-64
Identity = 110/257 (42.80%), Postives = 151/257 (58.75%), Query Frame = 2
Query:   71 DFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSE 838
            DF I   +G G+F  VY A EK  + +VALK+  K++  K   ++ +  E++I   L+HPN+L+LFG F DD   +LILE+ G GE+ R++ +C  +   R ATY+ Q++ ALEYCH   +IHRDIK EN+LL   G +KIADFG S    +  R+T CGTL ++ PE++ GA   A VDIWSLGVL YE L    PF A++  E    I  V   FPP         +  LL +D  ERL    +L  P+I   +E
Sbjct:  178 DFEIGRPLGRGKFGNVYLAREKRTRYIVALKVLFKAQLQKAGVEHQLRREIEIQSHLRHPNILRLFGYFHDDTRVFLILEYAGRGELYRELQRCGRFSERRTATYIAQLAHALEYCHRKHVIHRDIKPENLLLGIFGELKIADFGWSVHAPQSRRNTLCGTLDYLPPEMVEGAPHDARVDIWSLGVLTYEFLVGNPPFEAQSHEETYRRIARVDLRFPPSVSAGARDLIRKLLVRDPAERLPLDALLKHPWIQANAE 434          
BLAST of Aurora kinase A-A vs. TrEMBL
Match: I3K012 (Aurora kinase A OS=Oreochromis niloticus OX=8128 GN=LOC100694808 PE=3 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 2.418e-64
Identity = 107/263 (40.68%), Postives = 158/263 (60.08%), Query Frame = 2
Query:   56 KISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDIS--VEYFLNSLLRKDTYERLTASQVLAFPFILKYS 835
            + S ++F I   +G G+F  VY A E+  K ++ALK+  K +  K   ++ +  EV+I   L+HPN+L+L+G F D +  YLILEF   GE+  ++ +C  +P +R+ATY+ +++ AL YCH   +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A+   E    I  V Y +PP+S IS   +  +  LL+ +   RL    VL+ P++++YS
Sbjct:  122 RWSLENFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPRGELYSELQRCGHFPEDRSATYIMELADALNYCHTKKVIHRDIKPENLLLGGNGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTHEETYRRISRVEYSYPPQSSISAGAKDLVARLLKHNPMHRLPIQGVLSHPWVVEYS 384          
BLAST of Aurora kinase A-A vs. TrEMBL
Match: A0A5N5GUP7 (Serine/threonine-protein kinase Aurora-2 OS=Pyrus ussuriensis x Pyrus communis OX=2448454 GN=D8674_015205 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 2.551e-64
Identity = 110/267 (41.20%), Postives = 165/267 (61.80%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEY--FLNSLLRKDTYERLTASQVLAFPFILKYSENT 844
             + +  DF I + +G G+F  VY A EK    +VALK+  KS+  +++ ++ +  EV+I   L+HPN+L+L+G F D    YLILE+   GE+ +++ KCK +   RAATYV  ++ AL YCH   +IHRDIK EN+L+ + G +KIADFG S +     R T CGTL ++ PE++   E  A VDIWSLGVLCYE L+   PF A+  S+    I  V  +FPPK  +S +    ++ +L KD+ +RL   ++L  P+I++ +E +
Sbjct:   24 RRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVVSLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWS-VHTFNRRRTMCGTLDYLPPEMVESVEHDASVDIWSLGVLCYEFLYGVPPFEAKEHSDTYRRIVQVDLKFPPKPIVSAQAKDLISQMLVKDSAQRLALHKLLEHPWIVQNAEPS 289          
BLAST of Aurora kinase A-A vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 201.06 bits (510), Expect = 1.651e-61
Identity = 104/263 (39.54%), Postives = 148/263 (56.27%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            + KDF I   +G G+F  VY A EK +K VVALK+  KS+  K   ++ +  E++IH  L+HPN+L+ +  F D +  +LILE+   GEM +++ +C  + ++R AT++ +IS AL+YCH N +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G      VD+W +GVLCYE L    PF   + SE    I  V   FP          ++ LLR     RL    V+  P++   S   L
Sbjct:   31 TIKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKLLRHSPTMRLPLKSVIDHPWVKTNSRRVL 293          
BLAST of Aurora kinase A-A vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 202.986 bits (515), Expect = 2.017e-61
Identity = 100/259 (38.61%), Postives = 151/259 (58.30%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYS 835
            S ++F I   +G G+F  VY A E+  K ++ALK+  K +  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILEF   GE+  ++ +C  + ++R+ATY+ +++ AL YCH+  +IHRDIK EN+LL + G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  R PF  ++  E    I  V + +P          +N LL+ +   RL    VL   +++++S
Sbjct:  104 SLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLINGLLKHNPMHRLPIQGVLTHYWVVEHS 362          
BLAST of Aurora kinase A-A vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 201.06 bits (510), Expect = 2.106e-61
Identity = 104/263 (39.54%), Postives = 148/263 (56.27%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            + KDF I   +G G+F  VY A EK +K VVALK+  KS+  K   ++ +  E++IH  L+HPN+L+ +  F D +  +LILE+   GEM +++ +C  + ++R AT++ +IS AL+YCH N +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G      VD+W +GVLCYE L    PF   + SE    I  V   FP          ++ LLR     RL    V+  P++   S   L
Sbjct:   44 TIKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKLLRHSPTMRLPLKSVIDHPWVKTNSRRVL 306          
BLAST of Aurora kinase A-A vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 202.601 bits (514), Expect = 7.300e-61
Identity = 100/259 (38.61%), Postives = 151/259 (58.30%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYS 835
            S ++F I   +G G+F  VY A E+  K ++ALK+  K +  K   ++ +  EV+I   L+HPN+L+L+G F D    YLILEF   GE+  ++ +C  + ++R+ATY+ +++ AL YCH+  +IHRDIK EN+LL + G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  R PF  ++  E    I  V + +P          +N LL+ +   RL    VL   +++++S
Sbjct:  150 SLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLINGLLKHNPMHRLPIQGVLTHYWVVEHS 408          
BLAST of Aurora kinase A-A vs. Ensembl Cavefish
Match: nuak1a (NUAK family kinase 1 [Source:NCBI gene;Acc:103029612])

HSP 1 Score: 152.14 bits (383), Expect = 1.701e-40
Identity = 80/222 (36.04%), Postives = 128/222 (57.66%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEK-QLRHTFCGTLAFVAPEILNGAE-QTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKS 730
            + +LE +G G + KV KA+EK+  RVVA+K I K K  + +    I  E++I  SL+HP+++ ++  F + +   +++E+   GE+   I + +         +  QI SA+ +CH N ++HRD+K EN+LL     +KIADFG S L +K +L  TFCG+  + +PEI+NG   +   VD W+LGVL Y +++   PF   +   +   I N  Y  PP+S
Sbjct:   51 YELLETLGRGTYGKVKKAVEKHTGRVVAIKSIRKEKIKEEQDMVHIRREIEIMSSLRHPHIISIYEVFENKDKIVIVMEYASKGELYDYISERRKLSERETRHFFRQIVSAVHHCHKNGVVHRDLKLENVLLDDNCNIKIADFGLSNLYQKDKLLQTFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGGDHKRLIRQISNGEYREPPQS 272          
BLAST of Aurora kinase A-A vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 187.578 bits (475), Expect = 3.211e-57
Identity = 102/255 (40.00%), Postives = 149/255 (58.43%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            S  +F I   +G G+F  VY A EK+ K ++ALK+  KS+  K+  ++ +  E++I   L+HPN+L+L+G F D    YLILE+   GE+ + + K   +  ER+A+YV  ++ AL YCH+  +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  R PF +E  +E    I  V   FP       +  + +LL+ + + RL  + VL  P++
Sbjct:   11 SLDNFDIGRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRHPNILRLYGYFHDRTRVYLILEYAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSSRRATLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLVGRPPFESETHNETYRRISKVDLRFPSHLSDGAKDLIANLLKHNPHTRLQLASVLQHPWV 265          
BLAST of Aurora kinase A-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002824.1 (pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215:-1 gene:ENSPMAG00000002574.1 transcript:ENSPMAT00000002824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.762 bits (395), Expect = 3.144e-45
Identity = 96/258 (37.21%), Postives = 137/258 (53.10%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYP---NERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSK--LLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI 823
            KDF ++  +G G FA VY+A   +    VA+K I K    +    + + +EV+IH  LKHP +L+++G F DDN  YL+LE C  GEM R  LK +G P    + A  ++ +ISS L Y H + +IHRD+   N+LL S  + +IADFG +    L  + R T CGT  +++PE+ +        D W+LG   Y ML  R PF A  V      +   R+E PP    +    L  LLR+D  +R     VL  PF+
Sbjct:   11 KDFQVMNLLGKGSFACVYRARSCHTGIEVAIKMIDKQAMRRAGMVDRVRAEVEIHSQLKHPAILEMYGCFEDDNYVYLVLEMCHNGEMSR-YLKNQGRPFTEEQEARQFLREISSGLLYLHAHGVIHRDLTLANLLLASDMSTRIADFGLAARLPLPGESRLTVCGTPNYMSPEVASRGPHGTPADAWALGCAAYAMLVGRPPFQASAVPATLARVL-ARFELPPTLSPAARDLLRRLLRRDPGKRPGLPAVLEHPFL 266          
BLAST of Aurora kinase A-A vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 139.813 bits (351), Expect = 8.483e-38
Identity = 89/265 (33.58%), Postives = 141/265 (53.21%), Query Frame = 2
Query:   71 DFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVY-QISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSK--LLEKQLRHTFCGTLAFVAPEILNGAE-QTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI-LKYSENTLK 850
            ++ +L+ +G G FAKV  A      + VA+KI       T S   +  EV+I   L HPN+++LF     +   YL++E+   GE+  D L   G   E+ A   + QI SA++YCH   I+HRD+K+EN+LL +   +KIADFG S    L  +L  TFCG+  + APE+  G +     VD+WSLGV+ Y ++    PF  +N+ E+R+ +   +Y  P       E  L   L     +R +  Q++   ++ +K+ ++ LK
Sbjct:   67 NYRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMKVLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVF-DYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKL-DTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLHPLKRGSLEQIMKDRWMNVKHEDDELK 329          
BLAST of Aurora kinase A-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 8.507e-38
Identity = 82/273 (30.04%), Postives = 146/273 (53.48%), Query Frame = 2
Query:   65 TKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTS---AGAVKIADFGCSKLLE--KQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFP-PKSDI---SVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKEC 856
            T ++ + E++G G F+ V + ++ +  +  A KI  +K    R    +E E +I   LKH N+++L  +  ++   YL+ +    GE+  DI+  + Y    A+  + QI  ++ +CH + I+HRD+K EN+LL S     AVK+ADFG +  ++  +Q    F GT  +++PE+L        VD+W+ GV+ Y +L    PF  E+  ++   I+   Y+FP P+ D      +  +N +L  +  +R+TA++ L  P+I + S  T+  C
Sbjct:   11 TDEYQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQRS--TVASC 281          
BLAST of Aurora kinase A-A vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 138.272 bits (347), Expect = 4.577e-36
Identity = 89/264 (33.71%), Postives = 139/264 (52.65%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVY-QISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSK--LLEKQLRHTFCGTLAFVAPEILNGAE-QTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFI-LKYSENTLK 850
            + +L+ +G G FAKV  A      R VA+KI         S   +  EV+I   L HPN+++LF     +   YL++E+   GE+  D L   G   E+ A   + QI SA++YCH   I+HRD+K+EN+LL +   +KIADFG S    L  +L  TFCG+  + APE+  G +     VD+WSLGV+ Y ++    PF  +N+ E+R+ +   +Y  P       E  L   L  +  +R +  Q++   ++ + + E+ LK
Sbjct:   54 YRLLKTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVF-DYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKL-DTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMKDRWMNVGHEEDELK 315          
BLAST of Aurora kinase A-A vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 159.073 bits (401), Expect = 1.991e-45
Identity = 87/250 (34.80%), Postives = 133/250 (53.20%), Query Frame = 2
Query:   56 KISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQ 802
            K S  DF IL  +G G F +V+     +  R  ALK + K    K +       E ++   + HP +++++GTF D    ++++++   GE+   + K + +PN  A  Y  ++  ALEY H+  II+RD+K ENILL   G +KI DFG +K +   + +T CGT  ++APE+++       VD WS GVL YEML   TPF+  N  +  +NI N   +FPP      +  L  L+ +D  ERL   Q
Sbjct:   82 KYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV-PDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQ 330          
BLAST of Aurora kinase A-A vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 154.451 bits (389), Expect = 1.176e-43
Identity = 82/247 (33.20%), Postives = 137/247 (55.47%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSL-KHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERL 790
             K S +DF IL  +G G F +V+    ++  R  A+K+ K +      +    ++ ++  S+  HP +++++GTF D    ++I+++   GE+   + K + +PN  A  Y  ++  ALEY H+  II+RD+K ENILL   G +KI DFG +K +   + +T CGT  ++APE+++       +D WS G+L YEML   TPF+  N  +  + I N    FPP  +  V+  L+ L+ +D  +RL
Sbjct:   80 GKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV-PDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRL 325          
BLAST of Aurora kinase A-A vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 149.828 bits (377), Expect = 2.508e-40
Identity = 83/266 (31.20%), Postives = 144/266 (54.14%), Query Frame = 2
Query:   35 KSYSMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLL--EKQLRHTFCGTLAFVAPEILNG--AEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVE--YFLNSLLRKDTYERLTASQVLAF 814
            K+   L K   KD+     +G+G FA+ ++  + + +   A  ++K+     +++  + SE++IH S+ HPN++Q    F DD+  Y++LE C  G +   + + K         +  QI  A++Y H+  +IHRD+K  NI   S   +KI DFG + +L  E + ++T CGT  ++APE+L G  +  +  VDIWSLGV+ Y +L  + PF A +V+ I + I+   + FP    IS E    +  +L  D  ER + ++++ +
Sbjct:   69 KTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDY 334          
BLAST of Aurora kinase A-A vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 144.821 bits (364), Expect = 3.437e-40
Identity = 82/254 (32.28%), Postives = 134/254 (52.76%), Query Frame = 2
Query:   32 KKSYSMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKI-SKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERL 790
            +KS     K +  DF I+  +G G F +V+     +  R  A+K+  K +  K +       E ++   ++HP L++++GTF D    ++++++   GE+   + K + +PN  A  Y  ++  ALEY H ++II+RD+K ENILL   G +KI DFG +K ++  +  T CGT  ++APE++        VD WSLGVL YEML   TPF+     +  + I   +  +PP     V   L+ L+  D   R+
Sbjct:   56 QKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT-VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRI 308          
BLAST of Aurora kinase A-A vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 141.354 bits (355), Expect = 4.362e-39
Identity = 90/260 (34.62%), Postives = 142/260 (54.62%), Query Frame = 2
Query:   59 ISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKI-SKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNE-RAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKL-LEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILK 829
            +S  DF + +K+G G+F KVY    ++   + ALK+  K +  K   +     EV+I  SL HPNL + +G F D+   YL++E+   GEM + +L+  G  N+  A+ Y+YQI++AL+Y H  +IIHRDIK ENIL+     +K+ DFG S +   +  R T CGT+ +++PE++   E    +D W+LGVL +E+L    PF  E        I  +  + P       +  +  LL+ D  +R+    V   P+IL+
Sbjct:   99 LSLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYK-LLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWILR 357          
BLAST of Aurora kinase A-A vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 211.075 bits (536), Expect = 8.049e-66
Identity = 108/272 (39.71%), Postives = 157/272 (57.72%), Query Frame = 2
Query:   53 NKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAA 865
             K +  DF I + +G G+F  VY A EK  K +VALK+  KS+  K+  ++ +  E++I   L+H N+L+LFG F DD   YLILE+   GE+ +++  C+ +  +RAA Y+ Q++ AL YCH+  +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G E    VD+WS+GVLCYE L  + PF AE  +E    I  V   FP          ++ LL+ +   RL    VL  P+I  ++   L++  A+
Sbjct:   41 GKWNLSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLNHPWIRMHATPVLEQKPAS 312          
BLAST of Aurora kinase A-A vs. Ensembl Nematostella
Match: EDO34707 (Serine/threonine-protein kinase PLK4 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN5])

HSP 1 Score: 150.984 bits (380), Expect = 4.820e-40
Identity = 92/266 (34.59%), Postives = 144/266 (54.14%), Query Frame = 2
Query:   62 STKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSK-NTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATY--VYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFG-CSKL-LEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENT 844
            S +DF +L+ +G G FA VY+       + VA+K+   K  +T    N + +EV+IH  LKHP++L+L+  F DDN  YL+LE    GE  R  L+ +G+  + +     + Q+   + Y H++ IIHRD+   NILL+S    KIADFG  ++L L  +  +T CGT  +++PEI          D+WS+G + + +L  + PF  E V    + +    Y+ P    I     ++ LL+K+  +RLT S +L  PFI   + NT
Sbjct:    9 SIEDFQVLDLLGKGGFACVYRGRCLATGQEVAIKMIDKKAMRTAGMVNRVCNEVEIHCRLKHPSILELYTYFEDDNYVYLVLELAENGEANR-YLRKQGHTLKESEVRRIMLQVVKGVLYLHSHGIIHRDLSLGNILLSSDMDAKIADFGLATRLSLPDEKHYTMCGTPNYISPEIATRDPHGLESDVWSIGCMLFTLLVGKPPFDTEAVRSTLNKVVLAEYDIPNHVSIEARDLISKLLKKNPQDRLTLSGILDHPFITNQTLNT 273          
BLAST of Aurora kinase A-A vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 144.05 bits (362), Expect = 3.558e-39
Identity = 90/262 (34.35%), Postives = 137/262 (52.29%), Query Frame = 2
Query:   56 KISTKDFSILEKVGDGQFAKVYKAIEKN----IKRVVALKISKSKFGKTRSKNT--IESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSK--LLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFP 817
            K+  + F +L+ +G G + KV+  ++KN     +++ A+K+ K        K+T   ++E  I   +KHP ++ L   F      YLILE+   GE+   + +   +  + A  Y+ +IS ALE+ H   I++RD+K ENILL + G VK+ DFG  K  + E  L HTFCGT+ ++APEIL  +     VD WSLG L Y+ML    PF A+N  +  D I   +   PP      + F+  LL++    RL      A P
Sbjct:   59 KVGPESFELLKVLGKGGYGKVF-LVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANP 319          
BLAST of Aurora kinase A-A vs. Ensembl Nematostella
Match: EDO41399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I8])

HSP 1 Score: 140.584 bits (353), Expect = 9.182e-39
Identity = 86/259 (33.20%), Postives = 145/259 (55.98%), Query Frame = 2
Query:   71 DFSILEKVGDGQFAKVYKAIEKNIKR-VVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSA--GAVKIADFG-CSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVR-YEFPPKSDISVEY--FLNSLLRKDTYERLTASQVLAFPFI 823
            +F + EK+G G +A VYKA +K   R VVA+K I K    K  ++N + +E+++  +L+H +++QL     D+N  +LI+E+CG G++ R I   +  P   A  ++ Q++ AL+Y  +  + H D+K +N+LL+S     +KIADFG   KL          G+  ++APE++      A VD+WS+GV+ YE LF   PF ++   E+   +R+    + PP   +S +    L +LL++D  +R++       PFI
Sbjct:   16 NFVVAEKLGQGSYATVYKAFKKGDNRDVVAIKCIKKKTLSKAATENLL-TEIELLRNLEHEHIVQLKDFQWDENHIFLIMEYCGGGDLSRFIHSKRALPERMARKFLRQLACALQYMRSYDVAHMDLKPQNLLLSSRHNPVLKIADFGFAQKLHPNSEASNIRGSPLYMAPEMICCQSYDASVDLWSVGVILYETLFGEPPFKSKTFVELEAKLRSSEPIKLPPGPRVSADCRDLLIALLQRDPKQRISFEAFFTHPFI 273          
BLAST of Aurora kinase A-A vs. Ensembl Nematostella
Match: EDO47961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKT6])

HSP 1 Score: 138.272 bits (347), Expect = 1.558e-38
Identity = 84/252 (33.33%), Postives = 129/252 (51.19%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALKI-SKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEK-QLRHTFCGTLAFVAPEILNGAEQTAMV-DIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPF 820
            ++++  +G+G FAKV  A  K     VA+KI  K K  K      +  E+++   L HPN++QL+     +   YLILE    G++   I K    P ERA     Q  + + YCH   ++HRD+K EN+LL + G +KI DFG +    K  +  TFCG+ A+ +PEIL G        DIWS+GV+ Y ++  R PF  +++  I  N    +  F  K+       +  +L  D  +R TA ++L  P+
Sbjct:    8 YTVMRNLGEGAFAKVKLAKSKKHNCHVAIKIIDKRKAPKDYIYKFLPREIRVMHKLNHPNVIQLYEAIETETKVYLILELAEGGDLLEYINKNALLPEERARVIFCQFVATMAYCHKERVVHRDLKCENLLLDANGRLKITDFGFACNTHKTNILQTFCGSYAYCSPEILRGDLYDGQASDIWSMGVVLYALVCARLPFGDDDLRAIM-NREPRKLRFSKKTSKECRELIRKMLALDEKKRPTAEELLHEPW 258          
BLAST of Aurora kinase A-A vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 213.001 bits (541), Expect = 3.429e-65
Identity = 105/263 (39.92%), Postives = 156/263 (59.32%), Query Frame = 2
Query:   56 KISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDIS--VEYFLNSLLRKDTYERLTASQVLAFPFILKYS 835
            + S +DF I   +G G+F  VY A E+  K ++ALK+  K +  +   ++ +  EV+I   L+HPN+L+L+G F D +  YLILEF   GE+  ++ +C  +P +R+ATY+ +++ AL YCH   +IHRDIK EN+LL + G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A+   E    I  V Y +P  + IS   +  +  LL+ +   RL    VL  P++L++S
Sbjct:  116 RWSLEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWLLQHS 378          
BLAST of Aurora kinase A-A vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 213.386 bits (542), Expect = 7.030e-65
Identity = 105/263 (39.92%), Postives = 156/263 (59.32%), Query Frame = 2
Query:   56 KISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDIS--VEYFLNSLLRKDTYERLTASQVLAFPFILKYS 835
            + S +DF I   +G G+F  VY A E+  K ++ALK+  K +  +   ++ +  EV+I   L+HPN+L+L+G F D +  YLILEF   GE+  ++ +C  +P +R+ATY+ +++ AL YCH   +IHRDIK EN+LL + G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A+   E    I  V Y +P  + IS   +  +  LL+ +   RL    VL  P++L++S
Sbjct:  152 RWSLEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWLLQHS 414          
BLAST of Aurora kinase A-A vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 213.386 bits (542), Expect = 8.234e-65
Identity = 106/267 (39.70%), Postives = 157/267 (58.80%), Query Frame = 2
Query:   44 SMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDIS--VEYFLNSLLRKDTYERLTASQVLAFPFILKYS 835
            S   + S +DF I   +G G+F  VY A E+  K ++ALK+  K +  +   ++ +  EV+I   L+HPN+L+L+G F D +  YLILEF   GE+  ++ +C  +P +R+ATY+ +++ AL YCH   +IHRDIK EN+LL + G +KIADFG S       R T CGTL ++ PE++ G      VD+WSLGVLCYE L  + PF A+   E    I  V Y +P  + IS   +  +  LL+ +   RL    VL  P++L++S
Sbjct:  159 SYRKRWSLEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWLLQHS 425          
BLAST of Aurora kinase A-A vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 191.045 bits (484), Expect = 1.321e-57
Identity = 101/271 (37.27%), Postives = 150/271 (55.35%), Query Frame = 2
Query:   38 SYSMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            S S   KIS  DF I   +G G+F  VY A  K ++ +VALK+  KS+  K   ++ +  E++I   LKHPN+L+ +  F D    +L+LE+   GEM +++ K + + ++R ATY+ +IS AL YCH   +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G   +  VD+W +GVLC+E L    PF   + ++    I  V   FP          ++ LLR +  +RL   +V+  P++   S   L
Sbjct:   33 SVSPPKKISIDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKLLRHNPNDRLPLQKVMDHPWVRTNSHRLL 303          
BLAST of Aurora kinase A-A vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 191.045 bits (484), Expect = 2.147e-57
Identity = 101/271 (37.27%), Postives = 150/271 (55.35%), Query Frame = 2
Query:   38 SYSMLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTL 847
            S S   KIS  DF I   +G G+F  VY A  K ++ +VALK+  KS+  K   ++ +  E++I   LKHPN+L+ +  F D    +L+LE+   GEM +++ K + + ++R ATY+ +IS AL YCH   +IHRDIK EN+LL   G +KIADFG S       R T CGTL ++ PE++ G   +  VD+W +GVLC+E L    PF   + ++    I  V   FP          ++ LLR +  +RL   +V+  P++   S   L
Sbjct:   53 SVSPPKKISIDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKLLRHNPNDRLPLQKVMDHPWVRTNSHRLL 323          
BLAST of Aurora kinase A-A vs. Planmine SMEST
Match: SMESG000060356.1 (SMESG000060356.1)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 331/331 (100.00%), Postives = 331/331 (100.00%), Query Frame = 2
Query:   47 MLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWAMIQKIENSITNSQTSSAFSNVICPNFDFANEIQNLDVEFGEAENNDSLSFKKS 1039
            MLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWAMIQKIENSITNSQTSSAFSNVICPNFDFANEIQNLDVEFGEAENNDSLSFKKS
Sbjct:    1 MLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWAMIQKIENSITNSQTSSAFSNVICPNFDFANEIQNLDVEFGEAENNDSLSFKKS 331          
BLAST of Aurora kinase A-A vs. Planmine SMEST
Match: SMESG000060356.1 (SMESG000060356.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 331/332 (99.70%), Postives = 331/332 (99.70%), Query Frame = 2
Query:   47 MLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWAMIQKIENSITNSQTSSAFSNVICPNFDFANEIQNLDVEFGEAENNDSLSFKKS 1039
            MLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALK ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWAMIQKIENSITNSQTSSAFSNVICPNFDFANEIQNLDVEFGEAENNDSLSFKKS
Sbjct:    1 MLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWAMIQKIENSITNSQTSSAFSNVICPNFDFANEIQNLDVEFGEAENNDSLSFKKS 332          
BLAST of Aurora kinase A-A vs. Planmine SMEST
Match: SMESG000006604.1 (SMESG000006604.1)

HSP 1 Score: 205.297 bits (521), Expect = 2.001e-63
Identity = 105/271 (38.75%), Postives = 160/271 (59.04%), Query Frame = 2
Query:   71 DFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRS-KNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWA 880
            +F I +K+G GQF  VY   EK    V+A+K+ +  + K     N ++ E++IH  L HPN+L+L+G F D    YL++E    GE+  DI K   Y NERAATY++Q++ AL+YCH   ++HRDIK ENIL+ S G  K+ADFG S   +  +R+T CGTL ++APE++     T  +DIW LGVL YEML    PF   +  +  + I++V +  P   + +    +  +L  +   RL+  Q++  P+I ++SE    +C+A+   WA
Sbjct:   11 NFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWA 281          
BLAST of Aurora kinase A-A vs. Planmine SMEST
Match: SMESG000036830.1 (SMESG000036830.1)

HSP 1 Score: 171.4 bits (433), Expect = 1.481e-50
Identity = 101/273 (37.00%), Postives = 150/273 (54.95%), Query Frame = 2
Query:   74 FSILEKVGDGQFAKVYKAIEKNIKRVVALK-ISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPE-ILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVE--YFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWA 880
            F I   +GDG+F KV+   EK       LK I+KS   +      ++ E++I  +L HPN+L+L   F D    Y++LEF   G++  DI K   Y N RAATY+ Q+  ++ YCH+  ++HRDIKS NIL+ S G +K+ADFG S          + G++ + APE +L         DIWS+GV+ YEML    PF+ EN   +  + R V  +F    +IS +    L  +L  +  +R+T + +L   F+  +SENTL+ECKA+   W 
Sbjct:   10 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTV--DKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMWT 280          
BLAST of Aurora kinase A-A vs. Planmine SMEST
Match: SMESG000004605.1 (SMESG000004605.1)

HSP 1 Score: 164.081 bits (414), Expect = 2.514e-47
Identity = 98/260 (37.69%), Postives = 143/260 (55.00%), Query Frame = 2
Query:   68 KDFSILEKVGDGQFAKVYKAIEKNIKR--VVALKIS-KSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEY--FLNSLLRKDTYERLTASQVLAFPFILKY 832
            KDF +   +G G+F  VY A  K +K   V ALKI  KS+  +   ++    E+ I   L HPN+L+L+  F D+   YL+LE+   G+M   + K + + +  AATY++Q+  AL YCH   +IHRDIK EN+L++    +K+ADFG S       R T CGTL ++ PEI+N  E    +D W  G+L YEML    PF   N  E    IR    +F  +SDI +E    +  +L+    ERL+  ++   P++LKY
Sbjct:   49 KDFDVGMPLGTGKFGHVYLA--KTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMKRKTMCGTLDYLPPEIVNYKEYDEKIDHWMTGILLYEMLHGCPPFERANKQETYAAIRGNTIKF--RSDIVLEARDLITRILKLRATERLSFPEIQNHPWMLKY 304          
The following BLAST results are available for this feature:
BLAST of Aurora kinase A-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AURKA1.314e-6040.32aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.314e-6040.32aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.314e-6040.32aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.314e-6040.32aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.314e-6040.32aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
air-22.074e-5637.70Aurora/IPL1-related protein kinase 2 [Source:UniP... [more]
air-17.836e-5334.63Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-17.836e-5334.63Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
unc-433.135e-4132.22Calcium/calmodulin-dependent protein kinase type I... [more]
unc-433.135e-4132.22Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurA3.373e-5537.84gene:FBgn0000147 transcript:FBtr0082483[more]
aurB9.681e-5235.07gene:FBgn0024227 transcript:FBtr0080180[more]
SAK2.032e-4335.77gene:FBgn0026371 transcript:FBtr0078387[more]
KP78b6.329e-4135.74gene:FBgn0026063 transcript:FBtr0082408[more]
KP78b6.329e-4135.74gene:FBgn0026063 transcript:FBtr0301427[more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka4.002e-6138.40aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
aurkb2.911e-5937.88aurora kinase B [Source:NCBI gene;Acc:791894][more]
si:ch211-117c9.11.301e-4336.40si:ch211-117c9.1 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
nuak1a8.878e-4136.94NUAK family, SNF1-like kinase, 1a [Source:ZFIN;Acc... [more]
sgk11.104e-3934.84serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb392.052e-5836.94zinc finger and BTB domain containing 39 [Source:X... [more]
aurkb1.138e-5536.23aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb1.188e-5536.09aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb1.597e-5536.23aurora kinase B [Source:NCBI gene;Acc:549613][more]
exosc46.011e-4234.63exosome component 4 [Source:Xenbase;Acc:XB-GENE-96... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aurka4.416e-6140.32aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurka4.416e-6140.32aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurka1.408e-6040.32aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurkc2.224e-6037.96aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Aurkc2.224e-6037.96aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
back to top
BLAST of Aurora kinase A-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9M077|AUR1_ARATH1.713e-6541.98Serine/threonine-protein kinase Aurora-1 OS=Arabid... [more]
sp|Q683C9|AUR2_ARATH1.759e-6541.22Serine/threonine-protein kinase Aurora-2 OS=Arabid... [more]
sp|Q91820|AURAA_XENLA3.722e-6340.31Aurora kinase A-A OS=Xenopus laevis OX=8355 GN=aur... [more]
sp|Q91819|AURAB_XENLA1.085e-6239.92Aurora kinase A-B OS=Xenopus laevis OX=8355 GN=aur... [more]
sp|Q2TA06|AURKA_BOVIN1.516e-6140.00Aurora kinase A OS=Bos taurus OX=9913 GN=AURKA PE=... [more]
back to top
BLAST of Aurora kinase A-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NIA02.109e-6543.30Protein kinase domain-containing protein OS=Pomace... [more]
A0A540L7Z81.067e-6441.57Protein kinase domain-containing protein OS=Malus ... [more]
M1VA812.326e-6442.80Aurora kinase OS=Cyanidioschyzon merolae (strain 1... [more]
I3K0122.418e-6440.68Aurora kinase A OS=Oreochromis niloticus OX=8128 G... [more]
A0A5N5GUP72.551e-6441.20Serine/threonine-protein kinase Aurora-2 OS=Pyrus ... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurkb1.651e-6139.54aurora kinase B [Source:NCBI gene;Acc:103024192][more]
aurka2.017e-6138.61aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
aurkb2.106e-6139.54aurora kinase B [Source:NCBI gene;Acc:103024192][more]
aurka7.300e-6138.61aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
nuak1a1.701e-4036.04NUAK family kinase 1 [Source:NCBI gene;Acc:1030296... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka3.211e-5740.00aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
ENSPMAT00000002824.13.144e-4537.21pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215... [more]
MARK38.483e-3833.58microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000008748.18.507e-3830.04pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
MARK34.577e-3633.71microtubule affinity regulating kinase 3 [Source:H... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK31.991e-4534.80cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK11.176e-4333.20cAMP-dependent protein kinase catalytic subunit; p... [more]
CDC52.508e-4031.20Polo-like kinase; controls targeting and activatio... [more]
TPK23.437e-4032.28cAMP-dependent protein kinase catalytic subunit; p... [more]
IPL14.362e-3934.62Aurora kinase of chromosomal passenger complex; me... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354378.049e-6639.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347074.820e-4034.59Serine/threonine-protein kinase PLK4 [Source:UniP... [more]
EDO411663.558e-3934.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413999.182e-3933.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479611.558e-3833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aurora kinase A-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka3.429e-6539.92aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurka7.030e-6539.92aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurka8.234e-6539.70aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurkb1.321e-5737.27aurora kinase B [Source:NCBI gene;Acc:100301584][more]
aurkb2.147e-5737.27aurora kinase B [Source:NCBI gene;Acc:100301584][more]
back to top
BLAST of Aurora kinase A-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060356.10.000e+0100.00SMESG000060356.1[more]
SMESG000060356.10.000e+099.70SMESG000060356.1[more]
SMESG000006604.12.001e-6338.75SMESG000006604.1[more]
SMESG000036830.11.481e-5037.00SMESG000036830.1[more]
SMESG000004605.12.514e-4737.69SMESG000004605.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014970 ID=SMED30014970|Name=Aurora kinase A-A|organism=Schmidtea mediterranea sexual|type=transcript|length=1149bp
TTTGGAAATTTGTTTATAATAACTGGAAATAAAGAAATCATATTCAATGT
TGAATAAAATATCAACTAAAGATTTCAGCATCTTGGAAAAAGTTGGCGAT
GGTCAATTTGCCAAAGTTTATAAAGCAATCGAAAAAAATATTAAGAGAGT
TGTAGCTTTAAAAATTTCAAAATCGAAATTTGGAAAAACTAGATCAAAAA
ATACAATCGAAAGCGAAGTCAAAATACATTTTTCTCTTAAGCATCCGAAT
TTATTGCAATTATTTGGAACATTTACAGATGACAATGCAACCTATTTAAT
ACTTGAATTCTGTGGTTGCGGTGAAATGCGTAGAGATATCTTGAAATGTA
AAGGATACCCAAATGAACGTGCAGCGACTTATGTTTATCAAATTTCTAGC
GCCCTCGAGTATTGTCACAATAATTCTATAATTCACCGAGATATTAAATC
GGAAAATATTCTTTTGACATCGGCTGGCGCTGTTAAGATCGCTGATTTCG
GTTGTTCAAAGTTATTGGAGAAACAATTGCGGCATACATTCTGTGGAACT
TTAGCGTTTGTGGCTCCAGAAATATTGAATGGAGCTGAGCAAACAGCAAT
GGTTGATATTTGGAGTTTAGGAGTTCTCTGTTATGAAATGTTGTTCGTTA
GAACTCCATTTCATGCCGAGAATGTTTCCGAAATTCGTGATAACATTCGA
AACGTTAGATATGAATTTCCACCAAAATCGGACATATCAGTGGAATATTT
TTTGAATTCCCTTCTACGCAAAGACACGTATGAGCGTTTAACCGCTTCTC
AGGTTCTTGCTTTTCCATTTATTCTCAAGTATTCAGAAAACACACTGAAG
GAATGTAAAGCTGCTATAGATCAATGGGCGATGATTCAAAAAATAGAAAA
TTCAATTACTAATTCACAGACTAGTTCAGCTTTCTCAAATGTTATATGTC
CAAATTTTGATTTCGCTAATGAAATTCAAAATCTTGATGTTGAATTTGGC
GAAGCCGAAAATAATGATTCGTTAAGCTTCAAGAAAAGTTGATGTCGAAC
GAGGCAATTAAATCATGCATTTCAGATTTGAATTAATAAGTTTTTAGTGT
AATGCTTATTTTTATAATAATAAATCTTTCATTATCCCTTTTAAAAAAA
back to top

protein sequence of SMED30014970-orf-1

>SMED30014970-orf-1 ID=SMED30014970-orf-1|Name=SMED30014970-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=332bp
MLNKISTKDFSILEKVGDGQFAKVYKAIEKNIKRVVALKISKSKFGKTRS
KNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILK
CKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIAD
FGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLF
VRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTA
SQVLAFPFILKYSENTLKECKAAIDQWAMIQKIENSITNSQTSSAFSNVI
CPNFDFANEIQNLDVEFGEAENNDSLSFKKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005819spindle
GO:0000922spindle pole
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005876spindle microtubule
Vocabulary: biological process
TermDefinition
GO:0007098centrosome cycle
GO:0006468protein phosphorylation
GO:0000212meiotic spindle organization
GO:0000226microtubule cytoskeleton organization
GO:0000278mitotic cell cycle
GO:0007049cell cycle
GO:0007052mitotic spindle organization
GO:0007067mitotic nuclear division
GO:0007100mitotic centrosome separation
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0046777protein autophosphorylation
GO:0051297centrosome organization
GO:0051301cell division
GO:0051321meiotic cell cycle
GO:0090307mitotic spindle assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR030616Aur
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0008017microtubule binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0019894kinesin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 10..259
e-value: 7.5E-84
score: 294.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 11..259
e-value: 7.2E-68
score: 228.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 10..259
score: 45.531
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 3..315
e-value: 1.1E-82
score: 280.0
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 2..283
e-value: 2.4E-31
score: 106.5
NoneNo IPR availablePANTHERPTHR24350:SF0AURORA Acoord: 3..292
IPR030616Aurora kinasePANTHERPTHR24350SERINE/THREONINE-PROTEIN KINASE IAL-RELATEDcoord: 3..292
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 16..39
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 128..140
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 4..271