CRAL-TRIO domain-containing protein

Overview
NameCRAL-TRIO domain-containing protein
Smed IDSMED30014968
Length (bp)2514
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CRAL-TRIO domain-containing protein (SMED30014968) t-SNE clustered cells

Violin plots show distribution of expression levels for CRAL-TRIO domain-containing protein (SMED30014968) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CRAL-TRIO domain-containing protein (SMED30014968) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CRAL-TRIO domain-containing protein (SMED30014968) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014968

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30014968h1SMcG0022484 SmedASXL_002762SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30014968h1SMcG0022484 dd_Smed_v4_6149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014968h1SMcG0022484 dd_Smed_v4_6149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014968h1SMcG0022484 dd_6149dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: TTPA (alpha tocopherol transfer protein [Source:HGNC Symbol;Acc:HGNC:12404])

HSP 1 Score: 105.145 bits (261), Expect = 2.476e-24
Identity = 67/228 (29.39%), Postives = 112/228 (49.12%), Query Frame = 1
Query: 1477 SMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRS-SPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
             +P    P    FLL FLR   FD  +A R L N+   R+  P  S           SII  +   +  +   +D  G  VL+++   W P+  +  ++ +V  +T +LI+    TQ NGI +IFDLEG  + +      P + K I  +  D+FP++++GI L   P +FH +  +++ F+ +K K+RI  +   +   S +    +I+P EYGG    ++D  + W
Sbjct:   39 GVPLAPLPLTDSFLLRFLRARDFDLDLAWRLLKNYYKWRAECPEISADLHP-----RSIIGLLKAGYHGVLRSRDPTGSKVLIYRIAHWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEG-WQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERI-HMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEW 259          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: TTPAL (alpha tocopherol transfer protein like [Source:HGNC Symbol;Acc:HGNC:16114])

HSP 1 Score: 98.9821 bits (245), Expect = 9.776e-22
Identity = 68/220 (30.91%), Postives = 108/220 (49.09%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            P+L    D  FLL FLR  KFD+  A + L N+ + R   R  P  F   +LK S ++ VL S    +    D  G  V+  +   W P    +   ++ +Y+T + ++  E TQ+NGIV + D +G        +  P + K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K   R  L     + L + +   + I+P EYGG  G+L
Sbjct:   70 PNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCR---RSWPEVFN--NLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGEL 281          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: TTPAL (alpha tocopherol transfer protein like [Source:HGNC Symbol;Acc:HGNC:16114])

HSP 1 Score: 98.9821 bits (245), Expect = 9.776e-22
Identity = 68/220 (30.91%), Postives = 108/220 (49.09%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            P+L    D  FLL FLR  KFD+  A + L N+ + R   R  P  F   +LK S ++ VL S    +    D  G  V+  +   W P    +   ++ +Y+T + ++  E TQ+NGIV + D +G        +  P + K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K   R  L     + L + +   + I+P EYGG  G+L
Sbjct:   70 PNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCR---RSWPEVFN--NLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGEL 281          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: RLBP1 (retinaldehyde binding protein 1 [Source:HGNC Symbol;Acc:HGNC:10024])

HSP 1 Score: 82.8037 bits (203), Expect = 1.929e-16
Identity = 62/256 (24.22%), Postives = 112/256 (43.75%), Query Frame = 1
Query: 1399 EILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLR-----SHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRI-LQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKV 2148
            E  +  ++E +  V A   S     V++       DS F L F+R  KF+   A   L  +   R          ++P L +S+  + +R      +  +   +D  G +V+LF   +W+ +EI+ + ILQ      + +L  E TQING   I + +G   +   +     L K ++ + QD+FP R K I     P  F     +++ F+  K  +R+ +  D     + ++   + I+P+++GG   K   K 
Sbjct:   57 ETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFR---------LQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRK-MVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEID--ENILPSDFGGTLPKYDGKA 300          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: CLVS1 (clavesin 1 [Source:HGNC Symbol;Acc:HGNC:23139])

HSP 1 Score: 82.8037 bits (203), Expect = 2.851e-16
Identity = 65/251 (25.90%), Postives = 116/251 (46.22%), Query Frame = 1
Query: 1381 LSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLK-CPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKF--PSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRI-LQIDSQDKLFSKVSGLKEIMPTEYGG 2121
            LS    E  + E+ E+ + ++  I+  R  +++ P +    TD  F+L FLR  KF  + A R L  +   R       + FK   P +K ++I+      +N    +D  G  +LL    +W     S  +IL+ + ++ ++++     QING + I D      K     + P + K  +   QD+FP R  G+     P   H +  +++ F+ DK +KRI L  ++ + L   +    E +P+E+GG
Sbjct:   30 LSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLEN----RDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLT-PSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEFGG 273          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG12926 (gene:FBgn0033437 transcript:FBtr0088502)

HSP 1 Score: 104.375 bits (259), Expect = 5.000e-24
Identity = 84/319 (26.33%), Postives = 147/319 (46.08%), Query Frame = 1
Query: 1378 TLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSII-EKVLR-----SHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDL-ILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTK 2313
            +LS   ++   +E+ E  ++++  IE+ R W+   PHLK   D++FL+ FLR  K+     + +LDNF  +R +    P  +     KN I+ EK L          +P    + G  + + + G +  ++ S+  ++QV  M  ++ I   ++  I+G V I D++G     L  + D  L K +  +   A+P R KG      P+     + I +  M +K +KR       D L+  V   KE +P EYGG+ G ++D V +W  ++  +    +  +    +E  R G  VS          E++ G  GS+ K
Sbjct:   11 SLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGA---VPELY-----KNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQF-DAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVP--KECLPAEYGGSNGTIQDVVSTWRTKLLAYKPFFEEEASYGTNEKLRRGQPVS---------AESLFGIEGSFRK 309          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG31636 (gene:FBgn0051636 transcript:FBtr0079324)

HSP 1 Score: 102.449 bits (254), Expect = 2.108e-23
Identity = 75/252 (29.76%), Postives = 113/252 (44.84%), Query Frame = 1
Query: 1399 EILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTI-RSSPR--GSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTR-ESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKD 2142
            EI   E+ E   ++   IE+ R WV+  PHL+  TD +FLL FLR  KF    A+ + D F T+ RS P      R    P + + +   VL     IPM  D  G  V + + G +   +   ++I++V  M  ++++   ++  ++G V I D+ G     L A   P L         +A P R KGI     P  F      +  F   K K RI        ++  V   ++ +P EYGG GG L+D
Sbjct:   13 EICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVL---LQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQ-PQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVR--RKYLPQEYGGTGGNLQD 258          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG31636 (gene:FBgn0051636 transcript:FBtr0343865)

HSP 1 Score: 102.449 bits (254), Expect = 2.108e-23
Identity = 75/252 (29.76%), Postives = 113/252 (44.84%), Query Frame = 1
Query: 1399 EILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTI-RSSPR--GSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTR-ESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKD 2142
            EI   E+ E   ++   IE+ R WV+  PHL+  TD +FLL FLR  KF    A+ + D F T+ RS P      R    P + + +   VL     IPM  D  G  V + + G +   +   ++I++V  M  ++++   ++  ++G V I D+ G     L A   P L         +A P R KGI     P  F      +  F   K K RI        ++  V   ++ +P EYGG GG L+D
Sbjct:   13 EICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVL---LQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQ-PQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVR--RKYLPQEYGGTGGNLQD 258          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG33514 (gene:FBgn0053514 transcript:FBtr0091456)

HSP 1 Score: 100.523 bits (249), Expect = 1.063e-22
Identity = 76/312 (24.36%), Postives = 143/312 (45.83%), Query Frame = 1
Query: 1396 SEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQN-----IPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDL-ILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTK 2313
             ++ K ++KED  ++ A +++F+ W+   PHL    D +FL+ FLR  K+    A+ +LD + T+++     P +F+   + N+   K    HQ      +P   +  G  + +++ G    E+ ++   +QV     ++ IL  +   +NG+V I D++G     L   + P + K      ++A P+R+K        T F  +  + +  M  K + R+    ++  L ++   LK  +P EYGG  G  +D V +   +++ + D          DE+ RPG  + F         E + G  GS+ K
Sbjct:   13 QKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKLDKYYTLKTK---YPDYFR---VTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMT-PSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLK-YLPEEYGGENGTTQDIVAAMEKKLDEYADFFQENVNFGTDESLRPGKPIDF---------EGLFGVEGSFRK 307          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG10657 (gene:FBgn0036289 transcript:FBtr0075975)

HSP 1 Score: 98.5969 bits (244), Expect = 5.420e-22
Identity = 81/284 (28.52%), Postives = 135/284 (47.54%), Query Frame = 1
Query: 1288 LQQPALYKQTNHTSIGSF---YIISMADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHL-KCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPM-GKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGN 2124
            LQQP L      +S G +   Y+  ++   K          + K E+ ED+N     +  FR W+   PH+ KC TD+ FLL FLRT KF    A   L+ + TIR   +  P++FK   + +  I ++  +   +P+  +DS G  V+      + P + +   + +V  +  + +L  E +Q+ G V I D  G     +  WS   L ++I++  Q++ P+R K       P   + I+++    + DK KKRI+   + D L +K+     I+P EYGG 
Sbjct:    7 LQQPKLSGPAA-SSGGDYDYPYVCGLSPAMKL---------VAKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTIR---QLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDDEDSQVAGYVYINDESGMNMGFVSLWSLTDL-RSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVHKNVDILKTKID--PAILPKEYGGT 274          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 103.605 bits (257), Expect = 6.420e-24
Identity = 70/221 (31.67%), Postives = 112/221 (50.68%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLR-SHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPH--LTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            P+L+   D  FLL FLR  KFD+  A + L N+    +S R  P  F+   LK S ++ VL      +    D  G  +L  + G WKP +    + ++ +Y+T + ++  E TQ+NG+V + D  G     L   S+P   L K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K  +R +   S      +V   + ++P EYGG  G+L
Sbjct:    7 PNLRTRLDDAFLLRFLRARKFDYDRALQLLLNY---HASRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGV---GLSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLASLHRVIP-QSVLPQEYGGVSGRL 218          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 104.375 bits (259), Expect = 1.099e-23
Identity = 73/247 (29.55%), Postives = 123/247 (49.80%), Query Frame = 1
Query: 1408 KNEIKEDKNQVNAHIESFRRWVV-SMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLR-SHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPH--LTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            + E++E        +++ R  ++   P+L+   D  FLL FLR  KFD+  A + L N+    +S R  P  F+   LK S ++ VL      +    D  G  +L  + G WKP +    + ++ +Y+T + ++  E TQ+NG+V + D  G     L   S+P   L K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K  +R +   S      +V   + ++P EYGG  G+L
Sbjct:   43 REELQEKPEWRLRDVQALRDMILKDHPNLRTRLDDAFLLRFLRARKFDYDRALQLLLNY---HASRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGV---GLSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLASLHRVIP-QSVLPQEYGGVSGRL 280          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: ttpa (tocopherol (alpha) transfer protein [Source:ZFIN;Acc:ZDB-GENE-030131-4631])

HSP 1 Score: 94.3597 bits (233), Expect = 1.063e-20
Identity = 62/216 (28.70%), Postives = 106/216 (49.07%), Query Frame = 1
Query: 1513 FLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCC-RKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            FL+ FL+   FD ++A + L N+   R          + PS   S+I  +  ++  +   +D AG  VL+++ G W P+E +   + +V  +T +LI+    TQ NG+ +IFDL+  C    L+   +P L K I  +  D+FP++++GI L   P  F  +  ++  F+ DK K+RI                K ++P  YGG G  + +  + W
Sbjct:   48 FLIRFLQARDFDVALALKLLINYHKWRQECPEITADLR-PS---SVIGLLQNNYHGVLRSRDDAGSRVLIYRIGKWNPKEFTAYEVFRVSLITSELIVQEWETQRNGLKAIFDLQDWCFAHALQI--NPSLAKKISSVLTDSFPLKVRGIHLINEPIFFRPVFAMIRPFLPDKIKQRIHMHGCSYARSLCNYFPKAVLPPVYGGTGPSVDEVCQEW 257          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:566769])

HSP 1 Score: 81.2629 bits (199), Expect = 4.368e-16
Identity = 67/265 (25.28%), Postives = 117/265 (44.15%), Query Frame = 1
Query: 1381 LSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLK-CPTDSKFLLMFLRTAKFDHSVA-----------QRRLDNFCTIRSSPRGSPRFFK--FPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRIL----QIDSQDKLFSKVSGLKEIMPTEYGG 2121
            LS    E  K E+KE+ + ++  I+  R  +++ P +    TD  F+L FLR  KF+H  A           Q+ LD F  ++++  G  +  K  FP + +++               D  G  +L+    +W     +  +IL+ + ++ + ++     Q+NG V I D      K     + P + +  +   QD+FP R  GI     P   H +  ++  F+ DK +KRI      ++S  +L      L EI+P+E GG
Sbjct:    8 LSPETLEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKATDPGIKQALKDGFPGVLSNL---------------DRYGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI-----LPEILPSELGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: rlbp1b (retinaldehyde binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1870])

HSP 1 Score: 76.2554 bits (186), Expect = 1.923e-14
Identity = 58/216 (26.85%), Postives = 97/216 (44.91%), Query Frame = 1
Query: 1516 LLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFK--FPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRI-LQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVES 2154
            L+ F+R  K+D + A   +  +   R   R  P  F+   P    S IE     +  I   +D  G +VLLF   +W  EEI+ + IL+   +  + +L  E TQING   I + +G   +       P   K ++ + QD+FP R K +     P  F     +++  M  K  +R+ +  D  +  F +     EI+P+++ G G K   K+ +
Sbjct:   96 LVRFIRARKYDVNRAYELMKGYVRFR---RDYPELFENLTPEAVRSTIEA---GYPGILSSRDKYGRVVLLFNIENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQASGIK-PTELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDA--EILPSDFDGKGSKYDGKITA 302          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:NCBI gene;Acc:548930])

HSP 1 Score: 108.612 bits (270), Expect = 4.793e-25
Identity = 73/228 (32.02%), Postives = 114/228 (50.00%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSH-QNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWI 2160
            PHLK   D  FLL FLR  KFD+  A + L N+ + R   +  P  F    L+ S ++ VL S    +    D+ G  ++  + G W P +  +   ++ +Y++ + ++  E TQ+NGIV + D  G    T  +   P + K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K  KR  L     + L + +   K I+P EYGG  GKL     S I
Sbjct:   67 PHLKTRVDDSFLLRFLRARKFDYDRALQLLVNYYSCR---KAWPEVFT--DLRPSAVKPVLDSGFLTVLPHTDTEGRRIVCIRPGCWIPRDYPITENIRAIYLSLEKLVESEETQVNGIVILADYNGVGL-THASHFGPFIAKKVIGILQDGFPIRIKAVNVINEPRIFKGIFAILKPFLKEKIVKRFFLHGSDLNSLHANIP--KSILPEEYGGTAGKLDTTAWSQI 286          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: ggh (gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) [Source:NCBI gene;Acc:594986])

HSP 1 Score: 98.9821 bits (245), Expect = 3.935e-22
Identity = 70/245 (28.57%), Postives = 119/245 (48.57%), Query Frame = 1
Query: 1513 FLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQ-----IDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKR 2229
            FLL FLR   F   +A + L N+   R+     P       L+ S I  + R+ +  +   +D +G  VL+++   W P+  +   + +V  +T +LI+    TQ NGI +IFDL+G  R        P + K I  +  D+FP++++G+ L   P  FH +  I++ F+ DK K+R+       I + ++ FS       I+P EYGG G  + +  E W   + +  D       +S+ +NK+
Sbjct:   51 FLLRFLRARDFCIELAFKLLKNYHKWRAE---CPEITA--DLRPSPILDLFRAGYHAVLRSRDDSGSKVLIYRIEYWDPKLFTAYEVFRVSLITSELIVQEAETQRNGIKAIFDLQG-WRLAHAFQITPTMAKRIAAVMADSFPLKVRGVHLINEPLFFHPVFAIIKPFLPDKIKQRVHMHGSNYIPTLNQHFS-----TSILPPEYGGTGPAMSELCEEWTAHIMSSED-----YLLSISQNKQ 279          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: rlbp1 (retinaldehyde binding protein 1 [Source:NCBI gene;Acc:448050])

HSP 1 Score: 80.4925 bits (197), Expect = 1.197e-15
Identity = 57/218 (26.15%), Postives = 98/218 (44.95%), Query Frame = 1
Query: 1513 FLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-----HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRI-LQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKV 2148
            F L F+R  KFD S A   L  +   R          ++P L   +  + +RS     +  I   +D  G ++LLF    W  EEI+ + IL+   +  + +L  E TQING   I + +G   +       P   K ++ + QD+FP R K +     P  F     +++ F+  K  +R+ +  D  +  + ++    +I+P ++GGN  K   K+
Sbjct:  101 FFLRFIRARKFDVSRAYELLKGYVNFRQ---------QYPELFEDLTPEAVRSTIEAGYPGILTSRDKNGRVILLFNIESWDYEEITFDEILRAYCIILESLLENEETQINGFCIIENFKGFTMQQASGIK-PSELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLEGFYKEIDA--DILPADFGGNLPKYDGKI 306          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: thg1l (tRNA-histidine guanylyltransferase 1-like [Source:Xenbase;Acc:XB-GENE-966760])

HSP 1 Score: 80.4925 bits (197), Expect = 1.234e-15
Identity = 64/251 (25.50%), Postives = 114/251 (45.42%), Query Frame = 1
Query: 1381 LSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLK-CPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKF--PSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRI-LQIDSQDKLFSKVSGLKEIMPTEYGG 2121
            LS    E  + E+ E+ + ++  I+  R  V++ P +    TD  F+L FLR  KF+H  A R L  +   R       + FK   P +K  + +       N+    D  G  +L+    +W     ++ +IL+ + ++ + ++     Q+NG V I D      K     + P + +  +   QD+FP R  GI     P   H +  ++  F+ +K +KRI L  ++ + L   +    EI+P+E+GG
Sbjct:    8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNFKATDPGIKQGLKDGFPGVLSNL----DHFGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIH--PEILPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: rlbp1 (retinaldehyde binding protein 1 [Source:NCBI gene;Acc:448050])

HSP 1 Score: 80.4925 bits (197), Expect = 1.265e-15
Identity = 57/218 (26.15%), Postives = 98/218 (44.95%), Query Frame = 1
Query: 1513 FLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-----HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRI-LQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKV 2148
            F L F+R  KFD S A   L  +   R          ++P L   +  + +RS     +  I   +D  G ++LLF    W  EEI+ + IL+   +  + +L  E TQING   I + +G   +       P   K ++ + QD+FP R K +     P  F     +++ F+  K  +R+ +  D  +  + ++    +I+P ++GGN  K   K+
Sbjct:  104 FFLRFIRARKFDVSRAYELLKGYVNFRQ---------QYPELFEDLTPEAVRSTIEAGYPGILTSRDKNGRVILLFNIESWDYEEITFDEILRAYCIILESLLENEETQINGFCIIENFKGFTMQQASGIK-PSELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLEGFYKEIDA--DILPADFGGNLPKYDGKI 309          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Ttpa (tocopherol (alpha) transfer protein [Source:MGI Symbol;Acc:MGI:1354168])

HSP 1 Score: 108.612 bits (270), Expect = 1.180e-25
Identity = 71/257 (27.63%), Postives = 123/257 (47.86%), Query Frame = 1
Query: 1411 NEIKEDKNQVNAHIESFRRWV--VSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLK-----NSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            NE+ +    +   +   RR V    +P    P    FLL FLR   FD  +A R + N+   R+         + P L       SI+  +   +  +   +DS G  VL+++   W P+  +  ++ +V  +T +LI+    TQ NG+ +IFDLEG   +   A+   P + K I  +  D+FP++++GI L   P +FH +  +++ F+ +K K RI  +   +   S +    +I+P EYGG    ++D  + W
Sbjct:   15 NELPDHSPLLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRA---------ECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGW--QVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRI-HLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEW 259          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Ttpal (tocopherol (alpha) transfer protein-like [Source:MGI Symbol;Acc:MGI:1923330])

HSP 1 Score: 100.138 bits (248), Expect = 3.519e-22
Identity = 71/227 (31.28%), Postives = 109/227 (48.02%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            P+L    D  FLL FLR  KFD+  A + L N+   R   R  P  F   +L+ S ++ VL S    +    D  G  VL  +   W P    +   ++ VY+T + ++  E TQ+NGIV + D +G        +  P + K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K   R  L     + L + +   + I+P EYGG  G+L     SW
Sbjct:   71 PYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCR---RSWPEVFS--NLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGEL--DTASW 287          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Ttpal (tocopherol (alpha) transfer protein-like [Source:MGI Symbol;Acc:MGI:1923330])

HSP 1 Score: 100.138 bits (248), Expect = 3.519e-22
Identity = 71/227 (31.28%), Postives = 109/227 (48.02%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            P+L    D  FLL FLR  KFD+  A + L N+   R   R  P  F   +L+ S ++ VL S    +    D  G  VL  +   W P    +   ++ VY+T + ++  E TQ+NGIV + D +G        +  P + K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K   R  L     + L + +   + I+P EYGG  G+L     SW
Sbjct:   71 PYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCR---RSWPEVFS--NLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGEL--DTASW 287          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Ttpa (tocopherol (alpha) transfer protein [Source:MGI Symbol;Acc:MGI:1354168])

HSP 1 Score: 93.9745 bits (232), Expect = 1.011e-20
Identity = 61/220 (27.73%), Postives = 106/220 (48.18%), Query Frame = 1
Query: 1411 NEIKEDKNQVNAHIESFRRWV--VSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLK-----NSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRIL 2046
            NE+ +    +   +   RR V    +P    P    FLL FLR   FD  +A R + N+   R+         + P L       SI+  +   +  +   +DS G  VL+++   W P+  +  ++ +V  +T +LI+    TQ NG+ +IFDLEG   +   A+   P + K I  +  D+FP++++GI L   P +FH +  +++ F+ +K K R +
Sbjct:   15 NELPDHSPLLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRA---------ECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGW--QVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRFI 223          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Ttpa (tocopherol (alpha) transfer protein [Source:MGI Symbol;Acc:MGI:1354168])

HSP 1 Score: 91.6633 bits (226), Expect = 1.754e-20
Identity = 50/172 (29.07%), Postives = 92/172 (53.49%), Query Frame = 1
Query: 1645 SIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            SI+  +   +  +   +DS G  VL+++   W P+  +  ++ +V  +T +LI+    TQ NG+ +IFDLEG   +   A+   P + K I  +  D+FP++++GI L   P +FH +  +++ F+ +K K RI  +   +   S +    +I+P EYGG    ++D  + W
Sbjct:   22 SILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGW--QVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRI-HLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEW 190          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BWP5|TTPA_MOUSE (Alpha-tocopherol transfer protein OS=Mus musculus OX=10090 GN=Ttpa PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 8.256e-25
Identity = 71/257 (27.63%), Postives = 123/257 (47.86%), Query Frame = 1
Query: 1411 NEIKEDKNQVNAHIESFRRWV--VSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLK-----NSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            NE+ +    +   +   RR V    +P    P    FLL FLR   FD  +A R + N+   R+         + P L       SI+  +   +  +   +DS G  VL+++   W P+  +  ++ +V  +T +LI+    TQ NG+ +IFDLEG   +   A+   P + K I  +  D+FP++++GI L   P +FH +  +++ F+ +K K RI  +   +   S +    +I+P EYGG    ++D  + W
Sbjct:   15 NELPDHSPLLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRA---------ECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGW--QVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRI-HLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEW 259          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|P41034|TTPA_RAT (Alpha-tocopherol transfer protein OS=Rattus norvegicus OX=10116 GN=Ttpa PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.542e-24
Identity = 71/253 (28.06%), Postives = 120/253 (47.43%), Query Frame = 1
Query: 1411 NEIKEDKNQVNAHIESFRRWVV--SMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRS-SPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            NE  +    V   +   RR      +P    P    FLL FLR   FD  +A R + N+   R+  P  S           SI+  +   +  +   +D  G  VL+++   W P+  +  ++ +V  +T +LI+    TQ NG+ +IFDLEG   +   A+   P + K I  +  D+FP++++GI L   P +FH +  +++ F+ +K K RI  +   +   S +    +I+P EYGGN   ++D  + W
Sbjct:   15 NEQPDHSPLVQPGLAELRRRAQEEGVPETPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLHP-----RSILGLLKAGYHGVLRSRDPTGSRVLIYRISYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGW--QISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKGRI-HLHGNNYKSSLLQHFPDILPLEYGGNESSMEDICQEW 259          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|P49638|TTPA_HUMAN (Alpha-tocopherol transfer protein OS=Homo sapiens OX=9606 GN=TTPA PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.189e-23
Identity = 67/228 (29.39%), Postives = 112/228 (49.12%), Query Frame = 1
Query: 1477 SMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRS-SPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
             +P    P    FLL FLR   FD  +A R L N+   R+  P  S           SII  +   +  +   +D  G  VL+++   W P+  +  ++ +V  +T +LI+    TQ NGI +IFDLEG  + +      P + K I  +  D+FP++++GI L   P +FH +  +++ F+ +K K+RI  +   +   S +    +I+P EYGG    ++D  + W
Sbjct:   39 GVPLAPLPLTDSFLLRFLRARDFDLDLAWRLLKNYYKWRAECPEISADLHP-----RSIIGLLKAGYHGVLRSRDPTGSKVLIYRIAHWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEG-WQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERI-HMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEW 259          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D3D0|TTPAL_MOUSE (Alpha-tocopherol transfer protein-like OS=Mus musculus OX=10090 GN=Ttpal PE=1 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 2.461e-21
Identity = 71/227 (31.28%), Postives = 109/227 (48.02%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESW 2157
            P+L    D  FLL FLR  KFD+  A + L N+   R   R  P  F   +L+ S ++ VL S    +    D  G  VL  +   W P    +   ++ VY+T + ++  E TQ+NGIV + D +G        +  P + K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K   R  L     + L + +   + I+P EYGG  G+L     SW
Sbjct:   71 PYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCR---RSWPEVFS--NLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGEL--DTASW 287          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BTX7|TTPAL_HUMAN (Alpha-tocopherol transfer protein-like OS=Homo sapiens OX=9606 GN=TTPAL PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 4.695e-21
Identity = 68/220 (30.91%), Postives = 108/220 (49.09%), Query Frame = 1
Query: 1483 PHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRS-HQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            P+L    D  FLL FLR  KFD+  A + L N+ + R   R  P  F   +LK S ++ VL S    +    D  G  V+  +   W P    +   ++ +Y+T + ++  E TQ+NGIV + D +G        +  P + K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K   R  L     + L + +   + I+P EYGG  G+L
Sbjct:   70 PNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCR---RSWPEVFN--NLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGEL 281          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A267DVC9 (CRAL-TRIO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023111g2 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 7.408e-63
Identity = 120/331 (36.25%), Postives = 187/331 (56.50%), Query Frame = 1
Query: 1360 DVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVS-----GLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDP------WSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYE 2319
            +VY YE +  +D +  + E+ E+ +QV AHI S RRWV S PHL CPTD  FLL FLRTAKFD S AQ+ +DNFCT+R SPRGSP +F+   L + IIE+ L+   NI +G +  GE ++     ++ P+ I+  ++ +  YM  D ++  E  QING   I +L+   +K  +AW +P     +MR WQDAFPIR K ++ +  P  F ++ +I+  FM +K +KR+ +  +    FSK+      G + ++P E GG    +    E  + E    +   +        + I+VDE+KR   T  +L+ Y++    ++ G  G++TK +
Sbjct:    8 NVYNYEGVDPKDKKKAQKELHENPDQVRAHIASLRRWVTSAPHLTCPTDDAFLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEEALKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNWQDAFPIRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTD---FSKLKKAIGPGAERLLPPEMGGQNRPM----EELLAERYKMFKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSM-GIAGTFTKLD 330          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A267GCN2 (CRAL-TRIO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023111g3 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 1.081e-62
Identity = 120/331 (36.25%), Postives = 187/331 (56.50%), Query Frame = 1
Query: 1360 DVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVS-----GLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDP------WSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYE 2319
            +VY YE +  +D +  + E+ E+ +QV AHI S RRWV S PHL CPTD  FLL FLRTAKFD S AQ+ +DNFCT+R SPRGSP +F+   L + IIE+ L+   NI +G +  GE ++     ++ P+ I+  ++ +  YM  D ++  E  QING   I +L+   +K  +AW +P     +MR WQDAFPIR K ++ +  P  F ++ +I+  FM +K +KR+ +  +    FSK+      G + ++P E GG    +    E  + E    +   +        + I+VDE+KR   T  +L+ Y++    ++ G  G++TK +
Sbjct:    8 NVYNYEGVDPKDKKKAQKELHENPDQVRAHIASLRRWVTSAPHLTCPTDDAFLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEETLKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNWQDAFPIRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTD---FSKLKKAIGPGAERLLPPEMGGQNRPM----EELLAERYKMFKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSM-GIAGTFTKLD 330          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A4E0RHZ7 (Alpha-tocopherol transfer protein OS=Fasciola hepatica OX=6192 GN=D915_000833 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 2.465e-62
Identity = 115/313 (36.74%), Postives = 181/313 (57.83%), Query Frame = 1
Query: 1375 ETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSP-RGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQ-DKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSY 2307
            +TL     +  + E+ ED+  + AHIESF+RWV S+PH+  P D K LL FLR AK+ H  AQ RLDNFCT+R+S   G P +F FP + + I+   L++   + +G+     ++LL + G W P+ + +  I  + YM  +  +    TQI G    FD+ G   + L    D    K  M+++Q+  P+R+K +I Y  P +  ++ K+M+ ++ DK ++R+L++ +  DK + KV GLK++MP EYGG  GKL D +E+       FY K  PW  + VDE+KRP    +++R Y++   + I GT G+Y
Sbjct:    7 DTLPQNLRQKARKELHEDERHLKAHIESFQRWVDSLPHITYPKDPKLLLPFLRHAKYRHDKAQARLDNFCTLRASDLNGVPHWFHFPPVNDPIVNTYLKAGLVVELGRTKDDVLILLIRIGSWDPDILPMNLIRPLGYMNLERYVLDPVTQIAGYGLFFDMTGLSSRQLMHRKDKSEIKLEMKVFQEGLPLRVKHLIYYNEPAIVDVMFKLMDTWISDKIRQRMLRVKTNIDKAYDKVPGLKDLMPAEYGGKNGKLSDLIENHARRFREFYSKPPPWIGVRVDESKRPDSAKNYMREYKDVNID-IFGTKGTY 318          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A267E9H4 (CRAL-TRIO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023111g1 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 2.652e-62
Identity = 117/328 (35.67%), Postives = 184/328 (56.10%), Query Frame = 1
Query: 1360 DVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKV--SGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDP------WSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYE 2319
            +VY YE +  +D +  + E+ E+ +QV AHI S RRWV S PHL CPTD  FLL FLRTAKFD S AQ+ +DNFCT+R SPRGSP +F+   L + IIE+ L+   NI +G +  GE ++     ++ P+ I+  ++ +  YM  D ++  E  QING   I +L+   +K  +AW +P     +MR WQDAFP+R K ++ +  P  F ++ +I+  FM +K +KR+ +  +      K    G + ++P E GG    +    E  + E    +   +        + I+VDE+KR   T  +L+ Y++    ++ G  G++TK +
Sbjct:    8 NVYNYEGVDPKDKKKAQKELHENPDQVRAHIASLRRWVTSAPHLTCPTDDAFLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEEALKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNWQDAFPMRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTDFNKLKKAIGPGAERLLPPEMGGQNRPM----EELLAERYKMFKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSM-GIAGTFTKLD 330          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A3Q0KS00 (Retinaldehyde binding protein-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 3.181e-62
Identity = 113/299 (37.79%), Postives = 174/299 (58.19%), Query Frame = 1
Query: 1399 EILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRS-SPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQI-DSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIG 2289
            E+ K  + E+   + AH+ +F+RW+ S PHL  P D  FLL FLR A +DHSVAQ+R+DNFC+IR  S  G   ++K+P L + I++  L +   +P+G   +G  + + +   W+P+ +S   +  +  M F+  +  E  QI G+    DL G   K +  W+DP   K+ M++ Q+A P R K +I YK    F I  K+ EF++ DK K+RI++I D  +K F K+ GLK+IMP EYGG  G +KD +       +TFY +    S I VDE+KRP    +++R Y++ +  T+G
Sbjct:   15 ELAKKNLSENPAHIQAHLTAFKRWLSSCPHLTIPQDDAFLLGFLRYAHYDHSVAQKRIDNFCSIRCLSKHGITEWYKYPKLTDPIVDVYLDAGILVPLGIVDSGVHIFILRLKAWQPDLLSQTQMRALNNMNFERFILDERCQIGGVGIFIDLSGTTTKQISEWTDPRTAKSSMKLLQEATPGRTKHLIFYKESKAFDIGFKVFEFWLSDKMKQRIIRIKDDTEKAFKKIPGLKQIMPEEYGGCNGPIKDLITLDKRNFKTFYSQTCCLSVIKVDESKRPLSAQNYMREYKDMESTTMG 313          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpa (tocopherol (alpha) transfer protein [Source:ZFIN;Acc:ZDB-GENE-030131-4631])

HSP 1 Score: 110.538 bits (275), Expect = 2.580e-25
Identity = 71/218 (32.57%), Postives = 109/218 (50.00%), Query Frame = 1
Query: 1513 FLLMFLRTAKFDHSVAQRRLDNFCTIRS-SPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGL-KEIMPTEYGGNGGKLKDKVESW 2157
            FLL FLR   FD  +A + L N+   R   P  S          +S+I  +  ++  +   +D AG  +L+++   W P+E S   + +V  +T +LI+    TQING+ +IFDL+G C     A+  +P L K I  +  D+FP++++GI L   P  F  + K++  F+ DK K+R+  I       S      K I P EYGG G  L +  E W
Sbjct:   48 FLLKFLRARDFDLDLALKLLINYHKWRQECPEISANL-----QPSSVIGLLKNNYHGVLKSRDDAGSRILIYRISQWNPKEFSAYEVFRVSLITSELIVQERDTQINGLKAIFDLQGWC--FAHAFQINPFLAKKISSVLTDSFPLKVRGIHLINEPIFFRPVFKMIRPFLPDKIKQRV-HIHGSSYTASLYEHFPKAIFPPEYGGTGPGLAEACEEW 257          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:103043466])

HSP 1 Score: 106.301 bits (264), Expect = 2.149e-24
Identity = 74/247 (29.96%), Postives = 122/247 (49.39%), Query Frame = 1
Query: 1408 KNEIKEDKNQVNAHIESFRRWVV-SMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLR-SHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPH--LTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            + E++E        +++ R  ++   P+L+   D  FLL FLR  KFD+  A + L N+     S R  P  F+   LK S ++ VL      +    D  G  +L  + G WKP +    + ++ +Y+T + ++  E TQ+NGIV + D  G     L   S+P   L K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K  +R +   S      +V   + ++P EYGG  G+L
Sbjct:   46 REELQEKPEWRLRDVQALRDMILKEQPNLRTRLDDAFLLRFLRARKFDYDRAMQLLLNY---HGSRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGV---GLSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLSSLHRVIP-RSVLPEEYGGVAGRL 283          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:103043466])

HSP 1 Score: 105.916 bits (263), Expect = 2.635e-24
Identity = 74/247 (29.96%), Postives = 122/247 (49.39%), Query Frame = 1
Query: 1408 KNEIKEDKNQVNAHIESFRRWVV-SMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLR-SHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPH--LTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            + E++E        +++ R  ++   P+L+   D  FLL FLR  KFD+  A + L N+     S R  P  F+   LK S ++ VL      +    D  G  +L  + G WKP +    + ++ +Y+T + ++  E TQ+NGIV + D  G     L   S+P   L K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K  +R +   S      +V   + ++P EYGG  G+L
Sbjct:   47 REELQEKPEWRLRDVQALRDMILKEQPNLRTRLDDAFLLRFLRARKFDYDRAMQLLLNY---HGSRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGV---GLSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLSSLHRVIP-RSVLPEEYGGVAGRL 284          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:103047212])

HSP 1 Score: 80.1073 bits (196), Expect = 9.287e-16
Identity = 66/265 (24.91%), Postives = 117/265 (44.15%), Query Frame = 1
Query: 1381 LSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLK-CPTDSKFLLMFLRTAKFDHSVA-----------QRRLDNFCTIRSSPRGSPRFFK--FPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRIL----QIDSQDKLFSKVSGLKEIMPTEYGG 2121
            LS    E  K E+KE+ + ++  I+  R  +++ P +    TD  F+L FLR  KF+H  A           Q+ LD F  ++++  G  +  K  FP + +++               D  G  +L+    +W     +  +IL+ + ++ + ++     Q+NG V I D      K     + P + +  +   QD+FP R  GI     P   H +  ++  F+ DK +KRI      ++S  +L      + EI+P+E GG
Sbjct:    8 LSPETLEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKATDPGIKQALKDGFPGVLSNL---------------DRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI-----VPEILPSELGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:103047212])

HSP 1 Score: 80.1073 bits (196), Expect = 1.245e-15
Identity = 65/254 (25.59%), Postives = 113/254 (44.49%), Query Frame = 1
Query: 1381 LSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLK-CPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKF--PSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRIL----QIDSQDKLFSKVSGLKEIMPTEYGG 2121
            LS    E  K E+KE+ + ++  I+  R  +++ P +    TD  F+L FLR  KF+H  A R L  +   R       +  K   P +K ++ +       N+    D  G  +L+    +W     +  +IL+ + ++ + ++     Q+NG V I D      K     + P + +  +   QD+FP R  GI     P   H +  ++  F+ DK +KRI      ++S  +L      + EI+P+E GG
Sbjct:   25 LSPETLEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKATDPGIKQALKDGFPGVLSNL----DRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI-----VPEILPSELGG 268          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 96.6709 bits (239), Expect = 1.505e-22
Identity = 64/223 (28.70%), Postives = 113/223 (50.67%), Query Frame = 1
Query: 1378 TLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSH--QNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR 2040
            +LS    E  + E+ E+       ++  R  +   P +   TD  FLL FLR  KFDH    + ++++     +    P  F+  + + S ++ +L S   + +P  +DS G  V++   G W P    + + ++ +YMT +L++  E TQ+NGI  + D +G     +  ++ P L K I  + QDAFPIR+KG      P++F  +  +M+ F+ +K +KR
Sbjct:   33 SLSPELVERARVELGENPETRAQEVQKLREALARRPDIPARTDDAFLLRFLRARKFDHEKTFKLVESYYKCHET---WPDIFQ--NFRPSAVKALLGSGFIRVLP-ERDSKGRRVIIQSPGKWNPSTTPMMDNIRAMYMTMELLIQSEETQVNGITILADHKGVRLAHVTNFT-PSLMKKITTVMQDAFPIRIKGHNTVNEPSIFKAMFALMKPFLKEKMRKR 248          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003570.1 (pep scaffold:Pmarinus_7.0:GL486699:2092:8510:1 gene:ENSPMAG00000003262.1 transcript:ENSPMAT00000003570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 2.125e-16
Identity = 46/156 (29.49%), Postives = 79/156 (50.64%), Query Frame = 1
Query: 1399 EILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFK--FPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEG 1860
            E+ + E++E        I++ R  +   P +  PTD  FLL FLR  KFD+  A   +DN+   R   R  P  F   +PS    ++E  + +    P   D+ G  +++ + G W P      ++L+V+YMT ++++ +E TQ+ G+V + D  G
Sbjct:   38 EVARQELQEKPEWRLRDIQALRDMLKEHPEIPAPTDDGFLLRFLRARKFDYDKALLLIDNYYKCR---RVWPDVFVNFYPSSVRHVLEAGVVTALPQP---DAQGRRIIVLRPGLWNPAVAPATDMLRVLYMTLEMLVRQEETQVCGLVVLADYAG 187          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007468.1 (pep scaffold:Pmarinus_7.0:GL477833:5549:9144:1 gene:ENSPMAG00000006747.1 transcript:ENSPMAT00000007468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.855e-15
Identity = 38/116 (32.76%), Postives = 64/116 (55.17%), Query Frame = 1
Query: 1693 KDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR 2040
            +DS G  V++   G W P    + +  + +YMT +L++  E TQ+NGI  + D +G     +  ++ P L K I  + QDAFPIR+KG      P++F  +  +++ F  +K +KR
Sbjct:   34 RDSKGRRVIIQSPGKWNPSTTPIIDNFKAMYMTLELLIQSEETQVNGITILVDHKGMGLAHVTNFT-PSLMKKITTVIQDAFPIRIKGHHTINEPSIFKAMFALIKPFFKEKMQKR 148          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:566769])

HSP 1 Score: 46.595 bits (109), Expect = 5.629e-6
Identity = 35/152 (23.03%), Postives = 64/152 (42.11%), Query Frame = 1
Query: 1399 EILKNEIKEDKNQVNAHIESFRRWVVSMPHLK-CPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFD 1851
            E  + E+ E  + +   I+  R  +V+ P +    TD  F+L FLR  KF H  A + L  +   R   +    F  F +    I + +      +    D  G  +L+    +W     +  +IL+ + ++ + ++     Q+NG V I D
Sbjct:   15 EKARVELCERPDAIQQDIQEVRDMIVTRPDIGFLRTDDAFVLRFLRARKFHHFEAFKLLAQYFEYRQ--QHLDMFKNFKATDQGIRQALRNGFPGVLSHSDHYGRKILVIFASNWDQIRYTFVDILRAILLSLETMIEEPELQVNGFVLIID 164          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:101167039])

HSP 1 Score: 105.145 bits (261), Expect = 5.017e-24
Identity = 72/246 (29.27%), Postives = 120/246 (48.78%), Query Frame = 1
Query: 1408 KNEIKEDKNQVNAHIESFRRWVV-SMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLR-SHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKR-ILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKL 2136
            + E++E        +++ R  ++   P+L    D  FLL FLR  KFD+  A + L N+   R   R  P  F+   LK S ++ VL      +    D +G  +L  + G WKP +    + ++ +Y+T + ++  E TQ+NGI+ + D  G    +  +   P L K ++ I QD FPIR+K + +   P +F  I  I++ F+ +K  +R IL       L   +     ++P EYGG  G+L
Sbjct:   45 REELQEKPEWRLRDVQALRDMILKEQPNLHTRLDDAFLLRFLRARKFDYDRALQLLLNYHAGR---RAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPSGRYILCLRPGKWKPNDYPFVDNVRAIYLTLEKLIQPEETQVNGIIILVDYTGVG-MSQASNPGPFLAKKVVSILQDGFPIRIKAVNIINEPLIFKGIFAIIKPFLKEKMAERYILHGSDLRSLHRNLPA--SVLPEEYGGTAGRL 282          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: TTPA (alpha tocopherol transfer protein [Source:NCBI gene;Acc:101155881])

HSP 1 Score: 87.4261 bits (215), Expect = 1.674e-18
Identity = 69/265 (26.04%), Postives = 122/265 (46.04%), Query Frame = 1
Query: 1411 NEIKEDKNQVNAHIESFRRWV--VSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-------DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETF 2178
            +E+ ++  Q+ A +   R+            P    FLL FLR   FD  ++ + L N+   R   R SP      S  +S++  +  S+  +   +D AG  VL+++ G W  ++ S   + +V  MT ++I     TQ  G+ +IFDL+G        WS       +P L K I  +  D+FP++++GI L   P  F  +  ++  F+ +K K+RI    +      +      ++P EYGG+G  + +  + W  ++  F
Sbjct:   16 SELPDESEQLRAFVSRLRQAADEAGGGPAGPPLSDGFLLKFLRARDFDVELSLKLLLNYLRWR---RDSPEISSCLS-PSSVLGLLHMSYHAVLPQRDHAGSRVLIYRIGQWNTKDWSPYQVFRVSLMTSEIISMETETQRRGLKAIFDLQG--------WSLGHALQINPSLAKKISCVLSDSFPLKVRGIHLVNEPRFFRPVFAMIRPFLPEKIKQRIHMHGADFHSDLRHFFHPHVLPPEYGGHGPGIDEACQDWTNQLLHF 268          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: TTPA (alpha tocopherol transfer protein [Source:NCBI gene;Acc:101155881])

HSP 1 Score: 87.4261 bits (215), Expect = 2.058e-18
Identity = 69/265 (26.04%), Postives = 122/265 (46.04%), Query Frame = 1
Query: 1411 NEIKEDKNQVNAHIESFRRWV--VSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-------DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETF 2178
            +E+ ++  Q+ A +   R+            P    FLL FLR   FD  ++ + L N+   R   R SP      S  +S++  +  S+  +   +D AG  VL+++ G W  ++ S   + +V  MT ++I     TQ  G+ +IFDL+G        WS       +P L K I  +  D+FP++++GI L   P  F  +  ++  F+ +K K+RI    +      +      ++P EYGG+G  + +  + W  ++  F
Sbjct:   19 SELPDESEQLRAFVSRLRQAADEAGGGPAGPPLSDGFLLKFLRARDFDVELSLKLLLNYLRWR---RDSPEISSCLS-PSSVLGLLHMSYHAVLPQRDHAGSRVLIYRIGQWNTKDWSPYQVFRVSLMTSEIISMETETQRRGLKAIFDLQG--------WSLGHALQINPSLAKKISCVLSDSFPLKVRGIHLVNEPRFFRPVFAMIRPFLPEKIKQRIHMHGADFHSDLRHFFHPHVLPPEYGGHGPGIDEACQDWTNQLLHF 271          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: TTPA (alpha tocopherol transfer protein [Source:NCBI gene;Acc:101155881])

HSP 1 Score: 87.4261 bits (215), Expect = 3.709e-18
Identity = 69/265 (26.04%), Postives = 122/265 (46.04%), Query Frame = 1
Query: 1411 NEIKEDKNQVNAHIESFRRWV--VSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWS-------DPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETF 2178
            +E+ ++  Q+ A +   R+            P    FLL FLR   FD  ++ + L N+   R   R SP      S  +S++  +  S+  +   +D AG  VL+++ G W  ++ S   + +V  MT ++I     TQ  G+ +IFDL+G        WS       +P L K I  +  D+FP++++GI L   P  F  +  ++  F+ +K K+RI    +      +      ++P EYGG+G  + +  + W  ++  F
Sbjct:   16 SELPDESEQLRAFVSRLRQAADEAGGGPAGPPLSDGFLLKFLRARDFDVELSLKLLLNYLRWR---RDSPEISSCLS-PSSVLGLLHMSYHAVLPQRDHAGSRVLIYRIGQWNTKDWSPYQVFRVSLMTSEIISMETETQRRGLKAIFDLQG--------WSLGHALQINPSLAKKISCVLSDSFPLKVRGIHLVNEPRFFRPVFAMIRPFLPEKIKQRIHMHGADFHSDLRHFFHPHVLPPEYGGHGPGIDEACQDWTNQLLHF 268          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: CLVS1 (clavesin-1 [Source:NCBI gene;Acc:101158238])

HSP 1 Score: 84.3445 bits (207), Expect = 3.315e-17
Identity = 66/252 (26.19%), Postives = 114/252 (45.24%), Query Frame = 1
Query: 1372 YETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLK-CPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRI-LQIDSQDKLFSKVSGLKEIMPTEYGG 2121
            + +LS    E  + E+ E+ + ++  I+  R  +V+ P +    TD  F+L FLR  KFD     R L  +   R       + FK   L   I   ++     +    D  G  +L+    +W     S  +IL+ + ++ ++++     QING + I D      K     + P++ K  +   QD+FP R  GI     P   H +  I++ F+ DK +KRI L  ++ + L   +  L E +P+E+GG
Sbjct:    5 HSSLSSEMMEKARLELNENPDTLHQDIQQVRDMIVTRPDIGFLRTDDDFILRFLRARKFDQLETFRLLAQYFQFRQQNLDMFQSFKVDDL--GIKRALMDGFPGVLESPDQHGRKILILFASNWDQSRNSFIDILRAILLSLEVLIENPELQINGFILIIDWSNFSFKQASKLT-PNILKLAIEGLQDSFPARFGGIHFVNQPWYIHAMYTIIKPFLKDKTRKRIFLHGNNLNSLHQLI--LPECLPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009877.1 (SMESG000009877.1)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 325/325 (100.00%), Postives = 325/325 (100.00%), Query Frame = 1
Query: 1354 MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDLY 2328
            MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDLY
Sbjct:    1 MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDLY 325          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009878.1 (SMESG000009878.1)

HSP 1 Score: 454.521 bits (1168), Expect = 3.360e-154
Identity = 209/325 (64.31%), Postives = 262/325 (80.62%), Query Frame = 1
Query: 1354 MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDLY 2328
            MAD Y Y+ LS RD EIL  EI E+  QVNAHIESFRRWV+SMPHLKCPTDS+FLL FLR AK+DHS AQ+RLDNFCTIR+SP+G+P +F F  + +++IEKV R+HQN+P+GK S  E+V+L+KT DW  +E+SVE +LQV+YM+FD+IL++ESTQINGI+S FDLE C RKTLE WSDP L K I RIWQDAFPIRMKGIILYK P LFH+ILKI+EFF+ +KH+KR  QID+ +K+F+ + GL++IMP EYGG GG L DKVE+WI EV+ F+   D W    VDE KR  DT +FL+NYE+Y GETI GTPGS+ K+++++
Sbjct:    1 MADCYDYKNLSSRDQEILSKEIHENPLQVNAHIESFRRWVLSMPHLKCPTDSRFLLKFLRIAKYDHSKAQKRLDNFCTIRASPQGAPLYFNFSGINSTLIEKVFRAHQNVPIGKTSGNELVILYKTQDWSNDEMSVEVLLQVIYMSFDIILSKESTQINGIISFFDLERCNRKTLEIWSDPKLLKTITRIWQDAFPIRMKGIILYKEPFLFHVILKILEFFISEKHRKRFFQIDNTEKIFNCIPGLEDIMPIEYGGKGGNLSDKVENWIKEVKDFHSNRDSWWNFEVDEKKRQPDTKNFLKNYEDYVGETICGTPGSFIKHKNVF 325          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009988.1 (SMESG000009988.1)

HSP 1 Score: 346.665 bits (888), Expect = 1.841e-112
Identity = 152/323 (47.06%), Postives = 223/323 (69.04%), Query Frame = 1
Query: 1354 MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQ-DKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYE 2319
            MAD Y Y+ L+ RD ++   E+ ED  QVNAHIESFRRWV SMPHL CPTDS+FLLMFLR AKFDH+ AQ+RLDNFCT+RSS RG P +F+FP + +++ EK  ++ Q IP+G+   GE +    +  W P+EI ++ ++QV++M+ ++ L  +  QI G+ +  D+ GC +  +EA SDP + K + R+WQD +PIR KG ++Y+ P  + +   IMEFF+ +KH+KR+ +I     K F K+ GL+ ++P EYGG G K+ + ++ W  EV  FY KG PW+ ISVDE+KRP +T+ +   Y +Y GE++ GT G++TK++
Sbjct:    1 MADTYTYDGLTDRDKQVALTELNEDPKQVNAHIESFRRWVKSMPHLNCPTDSRFLLMFLRVAKFDHAKAQKRLDNFCTVRSSARGHPEYFQFPDINDAVFEKFFQTKQMIPLGRTVDGETLFFGVSNLWNPKEIPIKKLMQVMFMSLEVQLQNQYLQIYGMKAFMDMHGCGKSFMEAVSDPKVMKAMTRVWQDCYPIRFKGQVIYREPGWYSVFYNIMEFFLNEKHRKRVFRIKEDIQKGFEKIPGLEALLPEEYGGKGPKMDEAIDKWAKEVRDFYTKGSPWANISVDESKRPVETLKYFEQYADYTGESL-GTKGTFTKFD 322          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009876.1 (SMESG000009876.1)

HSP 1 Score: 311.612 bits (797), Expect = 3.973e-99
Identity = 142/326 (43.56%), Postives = 218/326 (66.87%), Query Frame = 1
Query: 1354 MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQ-DKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDLY 2328
            M + Y+Y  +S +  +   ++I E+ +QVNAHIESFRRW+ SMPHL+CPTD+KFL+ FLR +KFDH  A++R+DN+CT+R+SPRGSP FF   S+ + II   L +  ++P+G+   GE + L +T  W PE+I    ++ +++M  D+I   E TQI+G+  I DL+   RK +E+W DP   K I R+ Q+++P+R+KG I Y  P +F I+ +++ FFM +K K R ++I +  +K   K  GL +I+P EYGG GG + +  E W    + FY  G+P S  SVDE+KRP ++ S+L  Y +Y+G+T+ GT G+YTK+E+++
Sbjct:    1 MTERYEYSGISEKTKQFAIDDIGENPSQVNAHIESFRRWLKSMPHLQCPTDAKFLMKFLRVSKFDHKRAEKRIDNYCTVRASPRGSPSFFNTFSINDPIINTYLETGMHLPLGRTENGETIFLVRTKVWDPEQIPFPKLIILMFMAMDIICNDEETQIHGMKMIIDLKDASRKAMESWGDPKYMKQINRVMQESYPLRIKGTIFYNEPVIFDIVFQVLSFFMNEKMKSRTIRIKNDINKAIEKNPGLDKILPMEYGGQGGTITECSEKWKIRFKEFYKNGNPVSGFSVDESKRPQESASYLAEYPDYEGQTL-GTQGTYTKFENVF 325          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009874.1 (SMESG000009874.1)

HSP 1 Score: 310.457 bits (794), Expect = 1.312e-98
Identity = 150/325 (46.15%), Postives = 215/325 (66.15%), Query Frame = 1
Query: 1354 MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQ-DKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDL 2325
            M D Y+Y  +S R  +   +++ E+ +QVNAHIESFRRWV SMPHL CPTDS+FLL FLR +KFDH   Q+RLDNFCT+RSSPRGSP FF + ++ + I++  L S   +P+G++ AGEM+LL K   W  E+I V   L + +M  D++L+ E TQI+G+  + DL+   RK++EA ++P + K      QD++PIRMK  I    P +F ++ +I  FFM DK + R  +I +  +K F KV G+K ++PTEY G GG L+   E W    +T+Y  GDP   ISV+E KRP +T S+L  Y++Y G T+ GT G++TK+E++
Sbjct:    1 MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTL-GTHGTFTKFENV 324          
The following BLAST results are available for this feature:
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTPA2.476e-2429.39alpha tocopherol transfer protein [Source:HGNC Sym... [more]
TTPAL9.776e-2230.91alpha tocopherol transfer protein like [Source:HGN... [more]
TTPAL9.776e-2230.91alpha tocopherol transfer protein like [Source:HGN... [more]
RLBP11.929e-1624.22retinaldehyde binding protein 1 [Source:HGNC Symbo... [more]
CLVS12.851e-1625.90clavesin 1 [Source:HGNC Symbol;Acc:HGNC:23139][more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG129265.000e-2426.33gene:FBgn0033437 transcript:FBtr0088502[more]
CG316362.108e-2329.76gene:FBgn0051636 transcript:FBtr0079324[more]
CG316362.108e-2329.76gene:FBgn0051636 transcript:FBtr0343865[more]
CG335141.063e-2224.36gene:FBgn0053514 transcript:FBtr0091456[more]
CG106575.420e-2228.52gene:FBgn0036289 transcript:FBtr0075975[more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal6.420e-2431.67tocopherol (alpha) transfer protein-like [Source:Z... [more]
ttpal1.099e-2329.55tocopherol (alpha) transfer protein-like [Source:Z... [more]
ttpa1.063e-2028.70tocopherol (alpha) transfer protein [Source:ZFIN;A... [more]
clvs24.368e-1625.28clavesin 2 [Source:NCBI gene;Acc:566769][more]
rlbp1b1.923e-1426.85retinaldehyde binding protein 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal4.793e-2532.02tocopherol (alpha) transfer protein-like [Source:N... [more]
ggh3.935e-2228.57gamma-glutamyl hydrolase (conjugase, folylpolygamm... [more]
rlbp11.197e-1526.15retinaldehyde binding protein 1 [Source:NCBI gene;... [more]
thg1l1.234e-1525.50tRNA-histidine guanylyltransferase 1-like [Source:... [more]
rlbp11.265e-1526.15retinaldehyde binding protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttpa1.180e-2527.63tocopherol (alpha) transfer protein [Source:MGI Sy... [more]
Ttpal3.519e-2231.28tocopherol (alpha) transfer protein-like [Source:M... [more]
Ttpal3.519e-2231.28tocopherol (alpha) transfer protein-like [Source:M... [more]
Ttpa1.011e-2027.73tocopherol (alpha) transfer protein [Source:MGI Sy... [more]
Ttpa1.754e-2029.07tocopherol (alpha) transfer protein [Source:MGI Sy... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BWP5|TTPA_MOUSE8.256e-2527.63Alpha-tocopherol transfer protein OS=Mus musculus ... [more]
sp|P41034|TTPA_RAT7.542e-2428.06Alpha-tocopherol transfer protein OS=Rattus norveg... [more]
sp|P49638|TTPA_HUMAN1.189e-2329.39Alpha-tocopherol transfer protein OS=Homo sapiens ... [more]
sp|Q9D3D0|TTPAL_MOUSE2.461e-2131.28Alpha-tocopherol transfer protein-like OS=Mus musc... [more]
sp|Q9BTX7|TTPAL_HUMAN4.695e-2130.91Alpha-tocopherol transfer protein-like OS=Homo sap... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DVC97.408e-6336.25CRAL-TRIO domain-containing protein OS=Macrostomum... [more]
A0A267GCN21.081e-6236.25CRAL-TRIO domain-containing protein OS=Macrostomum... [more]
A0A4E0RHZ72.465e-6236.74Alpha-tocopherol transfer protein OS=Fasciola hepa... [more]
A0A267E9H42.652e-6235.67CRAL-TRIO domain-containing protein OS=Macrostomum... [more]
A0A3Q0KS003.181e-6237.79Retinaldehyde binding protein-related OS=Schistoso... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpa2.580e-2532.57tocopherol (alpha) transfer protein [Source:ZFIN;A... [more]
ttpal2.149e-2429.96alpha tocopherol transfer protein like [Source:NCB... [more]
ttpal2.635e-2429.96alpha tocopherol transfer protein like [Source:NCB... [more]
clvs29.287e-1624.91clavesin 2 [Source:NCBI gene;Acc:103047212][more]
clvs21.245e-1525.59clavesin 2 [Source:NCBI gene;Acc:103047212][more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ttpal1.505e-2228.70tocopherol (alpha) transfer protein-like [Source:Z... [more]
ENSPMAT00000003570.12.125e-1629.49pep scaffold:Pmarinus_7.0:GL486699:2092:8510:1 gen... [more]
ENSPMAT00000007468.11.855e-1532.76pep scaffold:Pmarinus_7.0:GL477833:5549:9144:1 gen... [more]
clvs25.629e-623.03clavesin 2 [Source:NCBI gene;Acc:566769][more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal5.017e-2429.27alpha tocopherol transfer protein like [Source:NCB... [more]
TTPA1.674e-1826.04alpha tocopherol transfer protein [Source:NCBI gen... [more]
TTPA2.058e-1826.04alpha tocopherol transfer protein [Source:NCBI gen... [more]
TTPA3.709e-1826.04alpha tocopherol transfer protein [Source:NCBI gen... [more]
CLVS13.315e-1726.19clavesin-1 [Source:NCBI gene;Acc:101158238][more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009877.10.000e+0100.00SMESG000009877.1[more]
SMESG000009878.13.360e-15464.31SMESG000009878.1[more]
SMESG000009988.11.841e-11247.06SMESG000009988.1[more]
SMESG000009876.13.973e-9943.56SMESG000009876.1[more]
SMESG000009874.11.312e-9846.15SMESG000009874.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014968 ID=SMED30014968|Name=CRAL-TRIO domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2514bp
TAACCTAATTTTCCCAAAAAATTATATCAATTACATAATATGTACAATTT
ACATTCAACTATTTATATACATTCAAAATACCTGTAAACCGAGCATTGTG
AATATTAATGAAGATTTAATTGGCAGTCTAACCAGATATCCCCAAAGAAG
TAAGAAATGTGAACCTAGGACCTTTTTAGTTCCATTTGGAATATCGATGC
ATTCTTTTCATTTTTATACGACATCATGACTTTCTTTCGCTGTTGAAAAT
TTAAATAATTTTATATTAGTTGATTTTTTTAAAATTATGTTGTTCAGTAG
AGCCGTTGCTTTAGTAGCATTAGGAAATCGTCGGAGGAAAAATTAAATGA
AACTATTAAGGAATGTTGAATAAATGATTGAAATAAAATGAAAGACATTT
ATAATAAAGCATAGTTATAAATGTGGACGGAAGCCAAAATGATAAATCGT
AGGCATCGAATACTTGAAATTCTTTAAGATTAAAAGAACCTACCCCATCG
TCTAATTCTGGATGTCCCTGAAGACTTTCAGCTTCCGAATCGTATTTAAA
AAGCCTCTATTTTCCAAGATTTCTGGGTTTTGTGATATCTTTGTAGGACA
TGGGACAAGGGAAATGCTAATTGTTACGTAACATAAAAATTCATAGAAAC
ATTAAAACAATAGTACTATTAAAATTAATTAACATATCATGTGTTGTTTG
AATTGGATGTTCAAGAAAGATTGACATTTGTTGAGAAGTGCCGATGATTC
ATTTAAACAAATGCCATTCAGCTCATTTGCGAAACCTCAACAATTATTGA
TAAGGTTTATTTCAGGGTGCCTCGAGTACAGATAAACAAATATTTATTCA
ATCACTTAATTGTTTGAATTGAATTTGAATGTTTTCCATTTGAATGGCAG
GCTCCGTTTTAACTTATCCGATATGTAATATTCATGATTATGTCGTTGCG
GACCGACGTGTGATTAACGCATGGTTTCGCTCTACCCTATTTCTATATTA
AATTCCTTTAGTTATTCCCAGGCGGCTTATGACCAACATCCCGTTGAATA
CGAAATCTACCAAGTCAGCTGTGTCTTCCCATTCTTTTTCCCACAGACTT
TGTTTTGTCTTTTTATAAATATTTAATGGATTATTAAAACAAAACCTCCA
TTTAATTACGGAACGTAGAGTAAAATTTACATTAAATAATTCTACAATTC
CTCCAACCAGGTCCATTCGCAAAAAAATTATTAAAGAAAAAAAATTTTGT
CTTGAGTATAATTTTGACCAATGAGAGCTCTGATAACCTTCAGCAACCAG
CACTATATAAACAGACAAATCATACTTCAATAGGTTCATTTTACATCATC
TCTATGGCTGACGTTTACAAATATGAAACACTTTCGGTAAGAGACTCCGA
AATTCTAAAGAACGAAATAAAAGAAGATAAAAATCAAGTGAATGCGCACA
TTGAAAGTTTCCGAAGATGGGTGGTTTCCATGCCTCACCTAAAATGCCCG
ACAGATTCAAAATTCCTTCTCATGTTTTTGAGAACCGCAAAATTCGATCA
TTCTGTGGCTCAAAGAAGATTGGACAATTTTTGCACTATTAGATCTTCAC
CAAGGGGTTCTCCACGCTTCTTTAAATTTCCAAGCCTAAAAAATTCGATA
ATTGAAAAAGTTTTAAGATCTCATCAAAACATTCCTATGGGAAAAGACTC
AGCAGGAGAAATGGTGCTACTTTTCAAAACAGGTGACTGGAAGCCGGAGG
AAATATCTGTGGAAAATATTCTTCAAGTTGTTTATATGACATTTGATTTG
ATATTGACTAGAGAAAGCACTCAAATCAACGGAATCGTAAGTATTTTCGA
CTTAGAAGGATGCTGCAGGAAAACATTGGAGGCCTGGTCTGACCCCCATT
TAACTAAAAATATAATGCGGATTTGGCAAGACGCGTTCCCAATTAGAATG
AAAGGTATAATCTTATACAAACCTCCGACATTGTTTCACATAATTCTGAA
AATAATGGAATTCTTTATGATCGATAAACATAAAAAAAGAATTCTTCAGA
TCGATAGCCAAGACAAGTTGTTTAGTAAAGTTTCTGGCTTGAAAGAAATT
ATGCCCACGGAGTACGGAGGAAACGGAGGGAAGTTAAAGGATAAAGTTGA
GTCATGGATTGGAGAAGTCGAAACCTTCTATGACAAAGGAGACCCATGGA
GCTTCATTTCCGTGGATGAAAACAAACGACCCGGTGATACGGTTTCATTC
TTGAGAAATTACGAAGAATACAAAGGCGAAACGATCGGAGGTACGCCAGG
ATCATACACCAAATATGAGGATCTATATTAACATTTAATTTAAACAGCTT
TTTACTTTTCCATTTAATTTCATTGCTATTCCGTTTTTTTTTTAATTTTC
AATATTTGCTTTATTTTTCATTTAACTGAATTGGCCGCCTTCTTTTTGAA
GTGGTCTGGATTTATATTTCCCATTCCATTTCTTCATCCACATTCATTAT
TTTGAATATAAATA
back to top

protein sequence of SMED30014968-orf-1

>SMED30014968-orf-1 ID=SMED30014968-orf-1|Name=SMED30014968-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPT
DSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSII
EKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLI
LTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMK
GIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQDKLFSKVSGLKEIM
PTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFL
RNYEEYKGETIGGTPGSYTKYEDLY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000420parapharyngeal region
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR036273CRAL/TRIO_N_dom_sf
IPR001071CRAL-bd_toc_tran
IPR001251CRAL-TRIO_dom
IPR011074CRAL/TRIO_N_dom
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0005215transporter activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00180CRETINALDHBPcoord: 182..203
score: 31.82
coord: 54..76
score: 42.39
coord: 248..257
score: 52.5
NoneNo IPR availableGENE3DG3DSA:1.10.8.20coord: 4..82
e-value: 5.6E-8
score: 34.8
NoneNo IPR availablePANTHERPTHR10174RETINALDEHYDE BINDING PROTEIN-RELATEDcoord: 12..276
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 99..259
e-value: 2.9E-6
score: 36.8
IPR001251CRAL-TRIO lipid binding domainPFAMPF00650CRAL_TRIOcoord: 103..257
e-value: 1.8E-21
score: 76.5
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 112..262
score: 13.681
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 110..257
e-value: 2.16656E-19
score: 81.6626
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 90..266
e-value: 2.0E-37
score: 130.1
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 103..277
IPR036273CRAL/TRIO, N-terminal domain superfamilySUPERFAMILYSSF46938CRAL/TRIO N-terminal domaincoord: 16..81