Cytochrome P450 2K1-like protein

Overview
NameCytochrome P450 2K1-like protein
Smed IDSMED30014966
Length (bp)1709
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 2K1-like protein (SMED30014966) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30014966) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 2K1-like protein (SMED30014966) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30014966) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014966

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30014966h1SMcG0009036 dd_Smed_v4_8387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014966h1SMcG0009036 dd_Smed_v4_8387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2B6 (cytochrome P450 family 2 subfamily B member 6 [Source:HGNC Symbol;Acc:HGNC:2615])

HSP 1 Score: 243.817 bits (621), Expect = 2.155e-73
Identity = 153/436 (35.09%), Postives = 228/436 (52.29%), Query Frame = 1
Query:  310 FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDS-WDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKS--VKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            F++  + YG ++ +  G R +V+L   + +R+ALV+ +++FSGR             G+IF + + W + R F    +RDFGMG     E  Q E   L+++L K  G  +D   LF   TANII   V  KR    D  F  M ++           Q F L+  +F   ++ F+ F  +    HR   +++   QE+       +E H +T+D      DLI+ +L+     +++EKS     F+   L  N+L LF AG +TT+TTL +  + M K+  + E+VY EI   IG  R P L D+  + YT+AVI EI R S + PM + H  T+     GY IP++T +   +    +DP  +E P+ F+P+HFL  N  G LK    E  IPFSLGKR CLGE +AR E F+FFTTILQ F +  + P++  D
Sbjct:   55 FLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNL---------FYQTFSLISSVFGQLFELFSGFLKYFPGAHR---QVYKNLQEINAYIGHSVEKHRETLD-PSAPKDLIDTYLLH----MEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDAN--GALKKT--EAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSM--ASPVAPED 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2A6 (cytochrome P450 family 2 subfamily A member 6 [Source:HGNC Symbol;Acc:HGNC:2610])

HSP 1 Score: 228.024 bits (580), Expect = 2.025e-67
Identity = 147/470 (31.28%), Postives = 231/470 (49.15%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTD----SLFRLMKDM-QNRIVKQKDLVQFFL-----LMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT-FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            K  LP G    P + ++     L      MY+  MK+++ YGP++ I  G R +V+L   D VR+ALV+ ++ FSGR     + ++    G++F +       R F    LRDFG+G     E  Q E   L+D L   GG ++D         +N+I+  V   R    D    SL R+M  + Q        L + F      L  P   ++        FI               + +E + +T+D +    D I+ FLI+   + ++EK+  T F    L+  +L LF+ G +T +TTL +  + + KH +++ +V++EI   IGK R P   D+  + Y +AVI EI R   V PM++  R  KD     +F+P+ T + P + +   DP  +  P +F+P HFL  N  G+ K +  +  +PFS+GKR C GE LAR E F+FFTT++Q FR++ S+   D D
Sbjct:   30 KGKLPPGPTPLPFIGNY-----LQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIA--------------KKVEHNQRTLDPNSP-RDFIDSFLIR---MQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFL--NEKGQFKKS--DAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDID 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2A13 (cytochrome P450 family 2 subfamily A member 13 [Source:HGNC Symbol;Acc:HGNC:2608])

HSP 1 Score: 225.328 bits (573), Expect = 2.646e-66
Identity = 146/467 (31.26%), Postives = 224/467 (47.97%), Query Frame = 1
Query:  220 LPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTD----SLFRLM-KDMQNRIVKQKDLVQFFL-----LMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT-FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            LP G    P + ++     L      MY+  MK+++ YGP++ I  G R +V+L   D V++ALV+ ++ FSGR     + +L    G+ F +       R F    LR FG+G     E  Q E   L+D L    G ++D         +N+I+  V   R    D    SL R+M    Q        L + F      L  P   ++        FI               + +E + +T+D +    D I+ FLI+   + ++EK+  T F    L+  +L LF AG +T +TTL +  + + KH +++ +V++EI   IGK R P   D+  + YT+AVI EI R   + PM + HR  KD     +F+P+ T + P + +   DP+ +  P +F+P HFL K      ++   +  +PFS+GKR C GE LAR E F+FFTTI+Q FR  F  P S  D
Sbjct:   33 LPPGPTPLPFIGNY-----LQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIA--------------KKVEHNQRTLDPNSP-RDFIDSFLIR---MQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKG----QFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFR--FKSPQSPKD 470          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 221.861 bits (564), Expect = 6.302e-65
Identity = 133/447 (29.75%), Postives = 232/447 (51.90%), Query Frame = 1
Query:  325 KTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRI--VKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRI----FERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDS---DYRSAIRGNDGVLRVCSV 1638
            K YG ++ +  G    V++    L+++AL++   +F  R  T     +   +G+I      W  QR F    LR+FG+G     E  Q E   L + + ++ GQ  D      +  +NII      +R    DS F+ +  + + +  ++     Q       +++ + W  +F   +   H+     ++++ +    +I+ H K  +   E  D I+ +L + ++         +F +  LI ++L+LF AG +TT+TTL W++++MA + +IQE+V  EI   IG+ + P+ + ++S+ YT AVI E+ RM ++ P+ +    T D  + GY +P+ T+I+ N+ A H DP  W TP+ F+P+HFL        ++  RE  +PFS+GKR CLGE LARTE FIFFT+++Q+F   F  P ++     +R  I  +    R+C+V
Sbjct:   73 KKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQ-------LYNVFPWIMKF---LPGPHQTLFSNWKKLKLFVSHMIDKHRKDWN-PAETRDFIDAYLKEMSK--HTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLENG-----QFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKF--TFRPPNNEKLSLKFRMGITISPVSHRLCAV 499          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 222.631 bits (566), Expect = 7.741e-65
Identity = 145/466 (31.12%), Postives = 237/466 (50.86%), Query Frame = 1
Query:  214 RNLPKGLKECPLV--------------KSW-----PIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLD-NHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
            R +P G    PLV              +SW        GI P +  P       LA+ YG I+    G   +V+L++   VR+ALV  ++ FS R      + +    G++F     VW  QR F    LR FG+G          E   +  ++ K G       ++  +  +NII      +R   T+S F+ M    +R ++     Q  L+       W ++  F  F   R +I + I    +++I+DH +++D +    D I+ +L+   +  ++  S  +F +  L     +LF+AG DTT  +L+W +++M+ +  +QE+V++EI   IG  R P+L+DK  + YT+A I E+ R++ V P+AI H T+++ V+ GY IP+ TLI+PN+++ H DP IWE P +F PN FL  +  G+L    +E  IPF +GKR C+GE LA+ E F+ F +++Q F
Sbjct:   57 RGIPPGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQV-LLAHLARVYGSIFSFFIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNI---CPWLYYLPFGPFKELR-QIEKDITSFLKKIIKDHQESLDRE-NPQDFIDMYLLHMEEE-RKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFL--DDQGQLI--KKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSF 511          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33D3 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:G5EE22])

HSP 1 Score: 206.838 bits (525), Expect = 7.033e-60
Identity = 146/481 (30.35%), Postives = 241/481 (50.10%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKA--PMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQ-KYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKK----GGQSVDVKNLFYDCTANIIAKFVMNKRVTSTD-----SLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFD-CEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV--QFSKPLSDSD 1587
            +RNLP G +  PL    P +G L  +K   P Y+ F    K YGPI+      +  VI+ + + +++  V + D++  +  T  +   L  N G++  + H+W   R F    LRD G+G     ++ Q + LM +++L K+    GG+ +D+  L      N+I   + NKR           L  L+  M+N   + + L+Q+ +          W +      T      E++  K +E+       I++H   +DFD  E  D +E +L K+ +  +++   KTF + QL     +L++AG  TT  T+ W + +   + ++Q ++ +E+   IG +RL + +DK  L Y QA + E  R +++ P+ +IH TT+D V+DG+ I + T +I  I    YD K++  P +F P  F+        K+   +E+IPFS+GKRQCLGE LAR E F+FF  I  R+ V   FS  L D D
Sbjct:   22 RRNLPPGPR--PL----PFLGNLLSLKTLKPGYEAFSNWKKEYGPIFTFWMANKPFVIIASYEKMKETFVKDGDTYVDKQLTHTEKERLGENYGVLDTNGHMWKEHRRFTLTQLRDLGLGK----DLMQEKILMEVEELFKELDAHGGEEIDLPKLIDRSVGNVINLTLFNKRFDMDKRDEFAHLKSLIDGMRNVTSQFRYLIQYLV---------PWTSTVLPGPTLS----EKVRAKREELDDFFYSQIDEHRNEIDFDNTENLDFVEAYL-KEQKKREEDGDFKTFCNKQLCAMLFDLWIAGLMTTTMTMTWGLSYYLYNPEVQRKIREELDKVIGNDRLISTADKNDLPYLQAFVTETQRTANIIPLNLIHMTTRDTVIDGFPIQKGTGVIAQISTVMYDEKVFPEPYKFKPERFIENG-----KFKKVDEVIPFSIGKRQCLGEGLARIELFLFFANIFNRYDVMPDFSGSLPDLD 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27499])

HSP 1 Score: 206.453 bits (524), Expect = 1.266e-59
Identity = 135/436 (30.96%), Postives = 219/436 (50.23%), Query Frame = 1
Query:  295 PMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNS-GIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTD--SLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIE-------DHLKTVDFDCEG-DDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSK 1569
            P Y  F  L + YG +Y        +V + + +L+++  + +  +F GR        L     GII      W  QR F   VLRDFG+G     E    E   +LD L +K    VD++++F     ++I   +   R   T+      L + + N        +   + M P      W   F  F  +++ + +     W  ++E       + L T+D++ +   D +E FL K+ +  + EK    F   QL     +L+VAG +TT+ TL W+++++ ++ +++++VY+E+  +IG +R+ T SDK  L+Y  A I+E  R++++ PM +   TTKD  + GY I +NT+IIP I    Y+P+I+  P EF P  FL   S G LK    EEL+PFS+GKRQC GE LA+ E  +FF  +  RF +Q  +
Sbjct:   47 PGYSLFSNLKEQYGHVYTFWMASLPIVHVTDWNLIKQHFIKDGGNFVGRPEFPMSIELRQGPYGIIESHGDRWVQQRRFALHVLRDFGLGKNLMEEKVLGEVTAMLDRL-RKTMDEVDMQSVFDASVGSVINNLLFGYRYDETNIAEFLDLKEKLNNHFQLAAKPIGGLIGMNP------WLGYFPYFSGYKNVMIQ----NWMGLVEMFRKQANEKLATIDYESDDYSDYVEAFL-KERKKHENEKDFGGFEMEQLDSVCFDLWVAGMETTSNTLNWALLYVLRNPEVRQKVYEELDREIGSDRIITTSDKPKLNYINATINESQRLANLLPMNLARSTTKDVEIAGYHIKKNTVIIPQISLVLYNPEIFPEPYEFKPERFLE--SDGSLK--KVEELVPFSIGKRQCPGEGLAKMELLLFFANLFNRFDIQLHQ 466          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27482])

HSP 1 Score: 204.912 bits (520), Expect = 3.708e-59
Identity = 134/451 (29.71%), Postives = 228/451 (50.55%), Query Frame = 1
Query:  295 PMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNS-GIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIE-------DHLKTVDFDC-EGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGV 1620
            P Y  + KL   YGP++        MV + +  L+++  + +  +F GR        +     GII      W  QR F   +LRDFG+G     E    E   ++D + +K  + VD++N+F     ++I   +   R   T+       +++NR+ K   L      M  +     W      F  +++ I       W  ++E       D L ++D+D  E  D +E FL K+ +  + E+    F   QL     +L+VAG +TT+ TL W+++++  + +++++VY+E+  +IG +R+ T +D+  L+Y  A ++E  R++++ PM +   T  D  + GY IP++T+I P I +  YDP+I+  P EF P  FL   S G LK    EEL+PFS+GKRQCLGE LA+ E F++F  +  +F ++F     +S+   +I+   GV
Sbjct:   47 PGYKMYEKLKDKYGPVFTFWLANLPMVTVTDWKLIKQHFIKDGANFVGRPEFPISMEMRQGPYGIIESHGDRWIQQRRFALHILRDFGLGKNLMEEKVLGEVTAMIDSI-RKSMEDVDMQNIFDASVGSVINNMLFGYRYDETN--IEEFLELKNRMNKHFKLAA--EPMGGLIGMNPWLGHLPFFKGYKNVIMH----NWMGLMEMFRKQATDRLASIDYDSDEYSDYVEAFL-KERKKHENEQDFGGFEMEQLDSVCFDLWVAGMETTSNTLNWALLYVLLNPEVRQKVYEELEREIGSDRIITTTDRPKLNYINATVNESQRLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFLE--SDGSLK--KVEELVPFSIGKRQCLGEGLAKMELFLYFANLFNKFDIKF----HESNPNPSIKKEVGV 479          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27482])

HSP 1 Score: 204.912 bits (520), Expect = 3.708e-59
Identity = 134/451 (29.71%), Postives = 228/451 (50.55%), Query Frame = 1
Query:  295 PMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNS-GIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIE-------DHLKTVDFDC-EGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGV 1620
            P Y  + KL   YGP++        MV + +  L+++  + +  +F GR        +     GII      W  QR F   +LRDFG+G     E    E   ++D + +K  + VD++N+F     ++I   +   R   T+       +++NR+ K   L      M  +     W      F  +++ I       W  ++E       D L ++D+D  E  D +E FL K+ +  + E+    F   QL     +L+VAG +TT+ TL W+++++  + +++++VY+E+  +IG +R+ T +D+  L+Y  A ++E  R++++ PM +   T  D  + GY IP++T+I P I +  YDP+I+  P EF P  FL   S G LK    EEL+PFS+GKRQCLGE LA+ E F++F  +  +F ++F     +S+   +I+   GV
Sbjct:   47 PGYKMYEKLKDKYGPVFTFWLANLPMVTVTDWKLIKQHFIKDGANFVGRPEFPISMEMRQGPYGIIESHGDRWIQQRRFALHILRDFGLGKNLMEEKVLGEVTAMIDSI-RKSMEDVDMQNIFDASVGSVINNMLFGYRYDETN--IEEFLELKNRMNKHFKLAA--EPMGGLIGMNPWLGHLPFFKGYKNVIMH----NWMGLMEMFRKQATDRLASIDYDSDEYSDYVEAFL-KERKKHENEQDFGGFEMEQLDSVCFDLWVAGMETTSNTLNWALLYVLLNPEVRQKVYEELEREIGSDRIITTTDRPKLNYINATVNESQRLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFLE--SDGSLK--KVEELVPFSIGKRQCLGEGLAKMELFLYFANLFNKFDIKF----HESNPNPSIKKEVGV 479          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44704])

HSP 1 Score: 201.445 bits (511), Expect = 9.277e-58
Identity = 133/480 (27.71%), Postives = 232/480 (48.33%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIK--APMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNS-GIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDD----LAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVK-----------------WQEVIEDHLKTVDFD---CEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSK 1569
            +RN P G   CPL    P+ G L  I    P Y  F +  K YG +Y    G    +++N  D +++  + ++D+++ +      T       GII  +  +W   R F    +RDFG+G      + Q   LM + D    L  K G   DV  +F    AN++ + +           +R M   +N   + K ++             + F +  +F+     IF ++  +                 + + IE H   +DF+    E  D +E FL K+ +  + E   +T++++QL+   ++L+ AG +TT  T+ W++ ++  H ++Q+++++E+   IG +RL T +DK  L Y  A I+E  R  ++ P+ + H TT+D V+DG+ IP+ T ++  I     + +++  P  F+P+ F+ +N  G+LK    +EL PFS+GKR C GE LAR E F+F    L R+++  SK
Sbjct:   22 RRNFPPG--PCPL----PVFGNLLSIANPPPGYKAFERWTKKYGDVYTFWIGNTPHIMINTWDKIKETFIRDADTYTNKVVLPMVTLSRGGEYGIIDSNGAMWREHRRFALSTMRDFGLGK----NLMQENILMEVQDVFARLDAKLGSETDVPEVFDHAVANVVNQLLFG---------YRFMGPKENEYQELKHIID---------SPAEIFGKLHIFLAMNIPIFAKLLPESLYEGPIKTFRDTTLAFFNKQIEAHRHRIDFEDLNSESTDFVETFL-KEQKRRESEGDSETYSNIQLLNVCIDLWFAGLNTTTNTITWAISYVLHHPEVQDKIHEELDKVIGSDRLITTADKNDLPYFNASINESQRGINILPLNLQHATTRDTVIDGFKIPKGTGVVAQISTVMNNEEVFPDPYTFNPDRFIDEN--GKLK--KVDELAPFSVGKRSCPGEGLARMELFLFIANFLNRYKIHPSK 468          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 206.068 bits (523), Expect = 5.794e-59
Identity = 147/499 (29.46%), Postives = 248/499 (49.70%), Query Frame = 1
Query:  214 RNLPKGLKECPLVKSW--PIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGM---GNCKSV--EIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFI---TFRHRIFE-RIHVK--WQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFT----DMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEI 1659
            R LP G         W  P++G L  + +  +  FM+LAK YG ++  R G +  V++++  ++R+      + F+GR  T  +       GII     +W  QR FL   LR FGM   GN K    +   +E    +  L    GQ VD+  +     +N+I   +M+ R +  D  FR          +   L++  + +F    + D+      F    T +++I + R  ++  +Q+VI+DH ++ D +    DL++ +L +  +   +    + F     + QL++  ++LF AG +T  TTL+W  +FM ++ K   +V DE+   +G+ RLPT+ D + L  T++ I E +R SS+ P+A  H  T+D  ++GY IP  + +IP I + H DP +WE P EF P+ F+      E K    E  IPF +G+R CLG+ LAR E F+FF + +  F +     L +     +++GN G     ++T  SF++
Sbjct:   51 RKLPPG--------PWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDT-PFMQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFR----------RFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPN-NIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDT----EGKVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIA----LPEGQPLPSLKGNVG----ATITPESFKV 515          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 206.068 bits (523), Expect = 5.794e-59
Identity = 147/499 (29.46%), Postives = 248/499 (49.70%), Query Frame = 1
Query:  214 RNLPKGLKECPLVKSW--PIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGM---GNCKSV--EIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFI---TFRHRIFE-RIHVK--WQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFT----DMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEI 1659
            R LP G         W  P++G L  + +  +  FM+LAK YG ++  R G +  V++++  ++R+      + F+GR  T  +       GII     +W  QR FL   LR FGM   GN K    +   +E    +  L    GQ VD+  +     +N+I   +M+ R +  D  FR          +   L++  + +F    + D+      F    T +++I + R  ++  +Q+VI+DH ++ D +    DL++ +L +  +   +    + F     + QL++  ++LF AG +T  TTL+W  +FM ++ K   +V DE+   +G+ RLPT+ D + L  T++ I E +R SS+ P+A  H  T+D  ++GY IP  + +IP I + H DP +WE P EF P+ F+      E K    E  IPF +G+R CLG+ LAR E F+FF + +  F +     L +     +++GN G     ++T  SF++
Sbjct:   51 RKLPPG--------PWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDT-PFMQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFR----------RFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPN-NIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDT----EGKVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIA----LPEGQPLPSLKGNVG----ATITPESFKV 515          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 144.05 bits (362), Expect = 7.399e-37
Identity = 126/467 (26.98%), Postives = 212/467 (45.40%), Query Frame = 1
Query:  235 KECPLVKSW-PIVGILPQIK---------APMYDFFMK-LAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNS--GIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLA----KKGGQSVDVKNLFYDCTA----NIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFP----IFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLS-DKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            K  P   +W PIVG   Q+            + D F +     YG  Y ++ G  ++VI   +D + + + N  +   GR     Y     NS  G++  D  +W  QR F+ + L++FG      ++I  +E   LL DL     K GG+   ++   +D T+    N +   +  +R          + +    + K  D+V      FP    I  ++  +N F       HR    ++    + IE H  T     E  DL++ +L  +++    EK +  F+D  L+   L++F+AG +TT  +L +  M +    +IQE+ + EI + +G ER+P  S D+  L Y +A+  E +RM  +    I HR   D  + GY IP++T++I        +P  +  P  F+P+ +L     G LK    E   PF  G+ +C+G+ L R   F+F TT+LQ F++
Sbjct:   25 KRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIE--MHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVE----SHR---SLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEG-NDEKGM--FSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD---GHLKLP--EAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0080828)

HSP 1 Score: 144.05 bits (362), Expect = 7.399e-37
Identity = 126/467 (26.98%), Postives = 212/467 (45.40%), Query Frame = 1
Query:  235 KECPLVKSW-PIVGILPQIK---------APMYDFFMK-LAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNS--GIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLA----KKGGQSVDVKNLFYDCTA----NIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFP----IFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLS-DKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            K  P   +W PIVG   Q+            + D F +     YG  Y ++ G  ++VI   +D + + + N  +   GR     Y     NS  G++  D  +W  QR F+ + L++FG      ++I  +E   LL DL     K GG+   ++   +D T+    N +   +  +R          + +    + K  D+V      FP    I  ++  +N F       HR    ++    + IE H  T     E  DL++ +L  +++    EK +  F+D  L+   L++F+AG +TT  +L +  M +    +IQE+ + EI + +G ER+P  S D+  L Y +A+  E +RM  +    I HR   D  + GY IP++T++I        +P  +  P  F+P+ +L     G LK    E   PF  G+ +C+G+ L R   F+F TT+LQ F++
Sbjct:   25 KRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIE--MHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVE----SHR---SLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEG-NDEKGM--FSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD---GHLKLP--EAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp304a1 (gene:FBgn0038095 transcript:FBtr0082691)

HSP 1 Score: 140.584 bits (353), Expect = 1.503e-35
Identity = 126/475 (26.53%), Postives = 212/475 (44.63%), Query Frame = 1
Query:  217 NLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYR-----IRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSG-----IIFLDNHVWSIQRPFLSKVLRDFGMGN-CKSVEIAQSECLM-LLD------------DLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQF--FLLMFP----IFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
              P G  + PL  S+  + I+       + +  K A T    Y+     +  G   + ++++ D VR+ L  N+  F GR   Q +     + G     I F D  +W  QR F+ + LRDFG G     +E+   E L  +LD            ++ K GG  V +  LF   +AN     V N+   S + + +L+K  Q  I  Q++   +   L + P    I+  W  +N+      F  + F        + ++ +L + +   EG   +ER  +       +      F   QLI   ++     F      L   + ++  +  +  +V +EI + +G  RLP L D+K+L +T+A I E LR+ ++ P  + H+  +D  + GY IP++T+++P++YA H D +IW  P +F P  FL  +    LK +     +PF  GKR C GE+ AR   F+   T+ Q F
Sbjct:   28 GFPPGPPKIPLFGSYLFMLII------NFKYLHKAALTLSRWYKSDIIGLHVGPFPVAVVHSADGVREIL--NNQVFDGRP--QLFVAAMRDPGQDVRGIFFQDGPLWKEQRRFILRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYPHEHEMVKSGGYRVLLPLLFNPFSANAHFYIVYNE-CLSREEMGKLVKLCQMGIQFQRNADDYGKMLSIIPWIRHIWPEWSGYNKLNESNLFVRQFFA-------DFVDKYLDSYE---EG---VERNFMDVYIAEMRRGPGYGFNRDQLIMGLVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKLCLKLDVS---LPFGAGKRLCAGETFARNMLFLVTATMCQHF 475          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k21 (cytochrome P450, family 2, subfamily k, polypeptide 21 [Source:ZFIN;Acc:ZDB-GENE-091113-17])

HSP 1 Score: 250.366 bits (638), Expect = 8.517e-76
Identity = 165/470 (35.11%), Postives = 244/470 (51.91%), Query Frame = 1
Query:  235 KECPLVKSWPIVGILPQIKAPM-YDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERI---HVKWQEVIEDHLKTVD-FDCEGDDLIERFLIKKNQLLQQEKSVKT---FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGV 1620
            KE P  K  P+VG L  +     +D F KL+KTYG ++++  G  + V+L     V++ALVN ++ F  R     ++ +    GI+F +   W   R F    LRDFGMG   S E    E   L  +  K  G+  D         +NII+  V   R   TD  F  M D  N  V+    +  +L     +D + W      F+  +  I E I    V+  ++I   L+T++  D  G   ++ FLI+K   L  EKS K    F +  L+     LF+AG DTT TTL W +M MAK+  IQ++V +EI D++   R P + D+K L YT AVI EI R++++ P+++ HRTT D   +GYFI + T ++P + +   D   WE PN F P HFL +      ++  R+  +PFS G+R CLGESLAR E F+FFT++LQ +R  F+ P   S+    ++G  G+
Sbjct:   43 KEPPGPKPLPLVGNLLTLDLTRPFDTFFKLSKTYGNVFQVYLGPEKAVVLVGYKTVKEALVNYAEEFGDREIGPGFSIMNDEHGILFSNGENWKEMRRFALSNLRDFGMGKRGSEEKIIEEIHHLKGEFDKFEGKPFDTTQPVNYAVSNIISSIVYGSRFEYTDPQFTEMVDRANENVRVGGSISMWL-----YDIFPWLG---PFLKNKRIIVENIIQSRVQMTKLITALLETLNPNDPRG--FVDSFLIRK---LSDEKSGKKDSYFHEENLMMTVTNLFIAGTDTTGTTLRWGLMLMAKYPHIQDRVQEEI-DRVIGGRQPVVEDRKKLPYTDAVIHEIQRLANIVPLSLPHRTTSDITFNGYFIKKGTTVVPLLTSVLKDESEWEKPNSFYPEHFLDEKG----QFVRRDAFMPFSAGRRVCLGESLARMELFLFFTSLLQSYR--FTTPPGVSEDELDLKGIVGI 492          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k16 (cytochrome P450, family 2, subfamily K, polypeptide16 [Source:ZFIN;Acc:ZDB-GENE-041010-37])

HSP 1 Score: 239.58 bits (610), Expect = 7.220e-72
Identity = 147/433 (33.95%), Postives = 224/433 (51.73%), Query Frame = 1
Query:  316 KLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVK-----QKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIED----HLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            ++AK +GP++++ FG +++V+L     V++ALVN +++F  R     +       GIIF +   W   R F    LRDFGMG  K  E    E   L ++  K  G+  +   L     +++I+  V  +R   TD   R M D  N  V+        L   F  + P+  +W              ++ + +H+  +E+ E     H      D  G   ++ FL++K       +    F +  LI     LFVAG DTT+TTL WS++ MAK+  IQ++V +EI   IG  R P   D+K+L YT AVI E  R++++ PM+I H T+ D   +GYFI + T I P + +  +D   WETP+ F+PNHFL +      ++  R+  +PFS G+R CLGESLAR E F+FFT++LQ FR  F+ P   S+
Sbjct:   66 EMAKQFGPVFKVYFGPKKVVVLAGYKAVKQALVNYAEAFGDREIMPLFHDFTKGHGIIFANGESWREMRRFALTNLRDFGMGKKKIEEKIIEETCHLREEFEKFEGKPFETAQLMNYAASSVISSIVYGRRFEYTDPQLRTMVDRANESVRLSGSASVQLYNMFPFLGPLLKNW-------------RQLMKNLHLDIEEISELVNGLHQTLNHQDLRG--FVDSFLVRKQYAEDSGEKDSHFHEQNLIYTVGNLFVAGTDTTSTTLRWSLLLMAKYPHIQDRVQEEIDQVIGG-RQPVSEDRKNLPYTDAVIHETQRLANIVPMSIPHMTSSDITFNGYFIKKGTCIFPLLTSVLWDEDEWETPHIFNPNHFLDEQG----RFVKRDAFMPFSAGRRICLGESLARMELFLFFTSLLQYFR--FTPPPGVSE 476          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p8 (cytochrome P450, family 2, subfamily P, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-061030-1])

HSP 1 Score: 235.728 bits (600), Expect = 1.680e-70
Identity = 155/489 (31.70%), Postives = 252/489 (51.53%), Query Frame = 1
Query:  208 LKRNLPKGLKECPLVKSWPIVGILPQI-KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIA-QSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFR-LMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFF-----VFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGD-DLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLS---DSDYRSAIRGNDGVLRVCSV 1638
            +K   PK     P   S PI+G L  I  + ++  F K A+ YG I+  R     +V+LN  +LV++  +   D+ + R     +  +  + G+I    + W  QR F    LR+FG+G  KS+E +   EC  L + ++ + G+  D + L  +  +N+I   V   R   +D  F+ L+K++   +  +  +      MFP      W            IT   ++ + +    +E + +H   VD+D     D I+ FL +  +L  ++ +   F    L   SL+LFVAG +TT+TTL W +++M K+ +IQ +V +EI   +G  R P++SD+ ++ YT AVI EI RM ++AP+ +   T++D  +  Y IP+ T++  N+ +  +D   WETP+ F+P HFL      E K+  R+  +PFSLGKR CLGE LAR E F+FF+++LQRF   FS P       DY+          ++C+V
Sbjct:   29 IKNKAPKNFPPGPW--SLPIIGDLHHIDNSKIHLQFTKFAERYGNIFSFRLFGPRIVVLNGYNLVKEVYIKQGDNLADRPVLPLFYEIVGDKGLILSSGYKWKHQRRFALSTLRNFGLGK-KSLEPSINVECGFLNEAISNEQGRPFDPRLLLNNAVSNVICVLVFGNRFDYSDHHFQTLLKNISEAVYLEGSICNQLYNMFP------WLMERLPGPHKTIITLWRKVTDFV----REKVNEH--RVDYDPSNPRDYIDCFLTEMEKL--KDDTAAGFDVENLCICSLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDAVVGGSRQPSVSDRDNMPYTNAVIHEIQRMGNIAPINLARSTSEDTQIGNYSIPKGTMVTSNLTSVLFDESEWETPHSFNPGHFLD----AEGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRF--TFSPPAGVEPSLDYKMGGTHCPKPFKLCAV 494          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2u1 (cytochrome P450, family 2, subfamily U, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-070730-1])

HSP 1 Score: 231.106 bits (588), Expect = 2.388e-68
Identity = 150/484 (30.99%), Postives = 249/484 (51.45%), Query Frame = 1
Query:  217 NLPKGLKECPLVKSWPIVGILPQIKAPMYDF-----------------------FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLD-NHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLML----LDDLAKKGGQS-VDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT----FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSK 1569
            N+P G       K WPIVG       P +                          ++++K YG I+ I  G + MV+L   D VR A++N++++FS R      T +    GI+F     +W   R F    LR FG G   S+E    E L +    L  L +  G S +D+  L  +  +NII+   + +R    D  FR M+D+ +  ++    V   +L+  +F  W ++  F VF   R    + I    + +I  H  T+D +    D I+ +L+   ++L ++K   +    F++  L     +LF+AG DTT  +++WS+++M+ +  +QE+V  EI   +G ER+P+L+DK SL YT+A I E++RM+ V P++I H  ++     G+ IP+ T+IIPN+++ H DP +WE P++F+P+ FL        K   ++  IPF LG+R C+GE LA+ E F+ FT+++Q F  +F +
Sbjct:   42 NIPPG------PKPWPIVGNFGGFLVPPFILKRFVKNSKEFAKVVSNPLSPQAGLIEMSKLYGNIFSIFVGPQLMVVLTGYDAVRDAMLNHTETFSDRPHIPLVTIITKRKGIVFAPYGPLWRTNRRFCHSTLRSFGFGRM-SLEPCIHEGLAIIKTELQSLIETAGPSGIDLTPLISNAVSNIISLMSLGQRFHHEDKEFRNMRDLMSHGLEIS--VNTSILLVNVF-PWLYYLPFGVFKELRRAELD-ITAFLKRIIARHRATLDPE-NPRDFIDMYLV---EMLAKQKEGSSEENLFSEDDLFYIIGDLFIAGTDTTTNSMLWSILYMSLYPDVQEKVQKEIDAVVGSERVPSLTDKSSLPYTEATIMEVIRMTVVVPLSIPHMASETTEFRGFTIPKGTVIIPNLWSVHRDPTVWENPDDFNPSRFLDDQG----KILRKDCFIPFGLGRRVCMGEQLAKMELFLMFTSLMQTFTFRFPE 506          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2y3 (cytochrome P450, family 2, subfamily Y, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-050522-490])

HSP 1 Score: 229.95 bits (585), Expect = 2.469e-68
Identity = 145/432 (33.56%), Postives = 224/432 (51.85%), Query Frame = 1
Query:  289 KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIF----ERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKP 1572
            K+  +  FMK  KTYG +  +  G + MV+L   + V++ALV+ +D F+ R+       +    G+   +   W   R F    LRDFGMG  +  +  Q E   LL    +   + VD    F    +N+I   V  +R    D  F  +  + +++++         L  P    ++ F +     + RH       E I    +  +++H + +DF  +  D I+ FLI+  Q  +++K    F    L+   L LFVAG +TT+TTL +++M + KH +IQEQ+  EI   IG+ R+PT+ D+KSL +T AVI E+ R   + P+++ H   KD    GY IP++T+IIP +++   D   WETP  F+P HFL  +S G  K N     +PFS GKR C+GESLAR E F+F  ++LQ+F   FS P
Sbjct:   48 KSAPFKSFMKWRKTYGSVMTVHLGPQRMVVLVGYETVKEALVDQADDFAPRAPIPFMNRIVKGYGLAISNGERWRQLRRFTLTTLRDFGMGRKRMEQWIQEESRYLLKSFEETKSKPVDPTFFFSRTVSNVICSLVFGQRFDYEDKNFLQLLQIISKLLR--------FLSSPWGQLYNIFPQVMESFSSRHHAILKDVENIRTFIRNKVKEHEQRLDF-SDPSDFIDCFLIRLTQ--EKDKLDTEFHKDNLMATVLNLFVAGTETTSTTLRYALMLLIKHPQIQEQMQREIDRVIGQNRIPTMEDRKSLPFTDAVIHEVQRYMDIVPLSLPHYAMKDITFRGYKIPKDTVIIPMLHSVLRDEGHWETPWTFNPEHFL--DSNGNFKKNP--AFMPFSAGKRVCVGESLARMEIFLFIVSLLQKF--SFSSP 462          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000021944.1 (cytochrome P450 2K1-like [Source:NCBI gene;Acc:100495200])

HSP 1 Score: 244.588 bits (623), Expect = 1.048e-73
Identity = 150/455 (32.97%), Postives = 233/455 (51.21%), Query Frame = 1
Query:  205 NLKRNLPKGLKECPLVKSWPIVG--ILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFER----IHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
            N KRN        P  K WP+VG      +K P   + ++L+K YGP++ ++ G ++MVIL   + V+ ALV +++ F GR++      L    G+IF +   W   R F    L+DFGMG     E    EC  L+   A   G+  D   +     ANII   ++  R+   D +F  + ++ +  VK        LL  P+   ++ F     F+   H+  E+    ++   +    +H K +D   +    I+ FL ++ +  +  ++   F +  L+R    LF AG +TT+T L W+++ M K+  IQE+V+DEI   IG    PT S +  + +T AVI EILR + + P+ + H TT+D    GYFIP+ T IIP + +   D   ++ P EF+PNHFL      E  +  +E  +PFS G+R C GE LAR E FIFFT++LQ+F
Sbjct:   23 NWKRNTLNNFPPGP--KGWPLVGNGFSIDLKKPQRTY-IELSKKYGPVFSVQMGRKKMVILVGYETVKDALVTHAEEFGGRASIPVNNNLEKGLGMIFSNGENWKAMRRFTITTLKDFGMGKSTIEETIAHECSYLVQYFASFKGKPFDNSTILITSVANIIVAILLGHRMDYEDPVFLRLVNLNSEYVK--------LLGSPMVTIYNMFPA-LGFLPGCHKTIEKNIKELYAFVRRTFVEHQKHLDIH-DQRSFIDAFLARQKEEAKHPETYSYFHNENLVRLVRNLFSAGMETTSTALRWALLLMIKYPDIQEKVHDEISRVIGSAH-PTYSHRTQMPFTNAVIHEILRFADILPLGVPHETTRDVHFKGYFIPKGTYIIPLLSSVLKDKTQFDAPEEFNPNHFLDS----EGNFLKKEAFMPFSAGRRACPGEILARMELFIFFTSLLQKF 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cat1 (calcium transporter 1 [Source:Xenbase;Acc:XB-GENE-6453137])

HSP 1 Score: 243.432 bits (620), Expect = 3.551e-73
Identity = 147/442 (33.26%), Postives = 231/442 (52.26%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQI--KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFER----IHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
            P  K WP+VG +  I  K P   + ++L+K YGP++ ++ G ++MVIL   + V+ ALV +++ F GR++      L    GI F +   W   R F    L+DFGMG     E    EC  L+   A   G+  D   +     ANIIA  +   R+   D +F  + ++ +  VK        LL  P+   ++ F     F+   H+  E+    ++   +    +H K +D   +    I+ FL ++ +  +  ++   F +  L+R    +F AG +TT+T+L W+++ M K+  IQE+V+DEI   IG    PT S +  + +T AVI EILR + + P+++ H TT+D    GYFIP+ T IIP + +   D   ++ P EF+PNHFL      E  +  +E  +PFS G+R C GE LAR E FIFFT++LQ+F
Sbjct:   34 PGPKGWPLVGNVFSIDLKKPQRTY-IELSKKYGPVFSVQMGRKKMVILVGYETVKDALVTHAEEFGGRASIPVNKNLEKGLGITFSNGENWKAMRRFTITTLKDFGMGKSTIEETIAHECSYLVQYFASFKGKPFDNSTILSTSVANIIAPILFGHRMEYEDPVFLRLVNLNSEYVK--------LLGSPMVTIYNMFPA-LGFLPGCHKTIEKNLKELYAFVRRTFVEHQKHLDIH-DQRSFIDVFLARQKEEAKHPETKSYFHNENLVRLVRNVFSAGMETTSTSLRWALLLMIKYPDIQEKVHDEISRVIGSAH-PTYSHRTQMPFTNAVIHEILRFADIVPLSVPHETTRDVHFKGYFIPKGTYIIPLLSSVLKDKTQFDAPEEFNPNHFLDS----EGNFLKKEAFMPFSAGRRACPGEILARMELFIFFTSLLQKF 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 241.506 bits (615), Expect = 1.621e-72
Identity = 156/459 (33.99%), Postives = 231/459 (50.33%), Query Frame = 1
Query:  214 RNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTF-----LCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTD-SLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHR-IFERIHVKW---QEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQ 1560
            +N P G K  PL+ +  I+     +K P   F M+LA+ YGP++ ++ G +++V+L   D V+ ALVN++D FSGR     Y F     + + SG+IF D   W + R F    LRDFGMG     +    E   L++      G+  D   +     ANII   ++N R    D +L +L+K +   +      +      +P    W         +   H+ I+E         +E   +H   +D + +  DLI+ FL+K+ +  ++  S K F D  L      LF AG +TT+TTL W ++ M K+  IQ++V DEI   IG    P L  +K + YT AVI EI R +++AP  + H TT D    GYFIP+ T +IP + +   D   ++ P EF P HFL      E K+   E  +PFS GKR C GE+LA+ E F+FFT +LQ F  Q
Sbjct:   28 QNFPPGPKPLPLIGNLHIM----NMKKPFLTF-MELAEKYGPVFSVQLGTKKVVVLCGTDAVKDALVNHADEFSGRPKIPIYVFSLTHVIPICSGVIFADGENWKVMRRFTLSTLRDFGMGKKTLEDRIGEESGCLVETFKSHEGKPFDNTMILNASVANIIVHILLNHRFEYQDPTLLKLIKSVSENVRIGGRPIVMLYNTYPSIMQW---------VPGSHKSIYENSQNLLNFLKETFTEHRHQLDVN-DQRDLIDTFLVKQQE--EKSSSTKFFHDENLTILLSNLFGAGMETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAE-PRLEHRKQMPYTDAVIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAYFKKPEEFYPEHFLDS----EGKFLKNEAFLPFSAGKRICAGETLAKMELFLFFTKLLQNFTFQ 464          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 240.736 bits (613), Expect = 2.802e-72
Identity = 157/457 (34.35%), Postives = 232/457 (50.77%), Query Frame = 1
Query:  214 RNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVE---IAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTD-SLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHR-IFERIHVK---WQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQ 1560
            +N P G K  PL+ +  ++     +K P Y  FM+LA+ YGP++ +  G  + V+L   D V+ AL+N +D FSGR  T  +      +GI+F D   W + R F    LRDFGMG  K++E   I +S C  L++      G+  D   +     ANII   ++N R    D +L +L+K +   +      +      +P    W         +   H+ I+E         +E   +H   +D + +  DLI+ FL+K+ +  ++  S K F D  L      LF AG +TT+TTL W ++ M K+  IQ++V DEI   IG    P L  +K + YT AVI EI R +++AP  + H TT D    GYFIP+ T +IP + +   D   ++ P EF P HFL      E K+   E  +PFS GKR C GE+LA+ E F+FFT +LQ F  Q
Sbjct:   28 QNFPPGPKPLPLIGNLHMI----NMKKP-YLTFMELAEKYGPVFSVHLGANKAVVLCGTDAVKDALINYADEFSGRPKTPLFEQTFKGNGIVFADGENWKVMRRFTISTLRDFGMGK-KTIEDRIIEESCC--LVETFKSHKGKPFDNTMILNASVANIIVHILLNHRFEYQDPTLLKLIKSVSENVRIGGRPIVMLYNTYPSIMQW---------VPGSHKSIYENSQNLLNFLKETFTEHRHQLDVN-DQRDLIDTFLVKQQE--EKSSSTKFFHDENLTILLSNLFGAGMETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAE-PRLEHRKQMPYTDAVIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAYFKKPEEFYPEHFLDS----EGKFLKNEAFLPFSAGKRICAGETLAKMELFLFFTKLLQNFTFQ 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000028287.1 (cytochrome P450 family 2 subfamily A member 6 gene 1 [Source:NCBI gene;Acc:100145695])

HSP 1 Score: 239.58 bits (610), Expect = 8.471e-72
Identity = 150/454 (33.04%), Postives = 231/454 (50.88%), Query Frame = 1
Query:  205 NLKRNLPKGLKECPLVKSWPIVGILPQIKA-PMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIED----HLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
            N ++NLP G        ++P++G   Q+    +    ++L+KTYGP++ +  G    +IL   D V++AL++NSD FS R        +  N G+I  +   W   R F    LR+FGMG     E  Q E   L +   KK  +  D   L     +NII   +  +R    D  F  +       VK   L  FF ++F      ++F   F +I   H+       K ++ ++D    H  T+D +C   D I+ FLI+  Q  ++      F    L    L+LF+AG +TT++TL ++ + + K+ +IQE VY EI+  IG+ R P++ D+  + YT+AVI E+ R+  + P+ + H  +KD    GY IP+ TLI P + +   DPK ++ P++F P HFL +N      +   +  +PFS GKR C GE LAR E FIF TTILQ+F
Sbjct:   28 NKRKNLPPG------PTAFPLLGNFLQVSTTEIPSSCVELSKTYGPVFTLYLGGHRSIILIGYDAVKEALIDNSDVFSDRGEGGVSEMIFKNYGVILSNGERWKTMRRFTLTTLRNFGMGKRSVEERIQEEARSLEEAFRKKKDEPFDPIYLLGLAVSNIICSIIFGERFDYEDEKFMTLLMYIREFVKL--LNSFFGMLF------NFFPNLFCYIPGPHQNIFTYFNKLKQFVKDEAKSHKDTLDANCP-RDFIDCFLIRMEQ--EKNNPNSEFHYENLFGTILDLFLAGTETTSSTLRYAFLILLKYPEIQENVYKEIVQVIGQHRYPSVEDRSKMPYTEAVIHEVQRIGDILPLGLEHAASKDTTFRGYDIPKGTLIFPLLTSVLKDPKYFKNPDQFDPEHFLDENGC----FKKNDAFMPFSTGKRVCAGEGLARMELFIFLTTILQKF 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b10 (cytochrome P450, family 2, subfamily b, polypeptide 10 [Source:MGI Symbol;Acc:MGI:88598])

HSP 1 Score: 248.054 bits (632), Expect = 4.164e-75
Identity = 154/430 (35.81%), Postives = 226/430 (52.56%), Query Frame = 1
Query:  310 FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSW-----DWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVK--TFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            F++L + YG ++ +  G R +V+L   D +R+ALV  +++FSGR T           G+IF +   W   R F    +RDFGMG     E  Q E   L+++L K  G  +D   LF   TANII   V  +R   TD  F               L++ F   F +  S+     + F+ F  +    HR   +I    QE+       +E H  T+D      D I+ +L++    +++EKS +   F    L+ + L LF AG +T++TTL +  + M K+  + E+V  EI   IG  RLPTL D+  + YT AVI EI R S + P+ + HR TKD +  GY +P+NT + P + +  +DP+ +E P+ F+P+HFL  N  G LK +  E  +PFS GKR CLGES+AR E F+FFT+ILQ F V
Sbjct:   55 FIQLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFL-------------RLLELFYQTFSLISSFSSQMFELFSGFLKYFPGAHR---QISKNLQELLDYIGHSVEKHRATLDPSVP-RDFIDIYLLR----MEKEKSNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDAN--GALKKS--EAFLPFSTGKRICLGESIARNELFLFFTSILQNFSV 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b19 (cytochrome P450, family 2, subfamily b, polypeptide 19 [Source:MGI Symbol;Acc:MGI:107303])

HSP 1 Score: 248.054 bits (632), Expect = 4.456e-75
Identity = 156/449 (34.74%), Postives = 234/449 (52.12%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQI-KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDS-WDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVK--TFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            P  +  P +G L Q+ +  +   F++L + YG ++ +  G R +V+L   D +R+ALVN +++FSGR T      +    G+IF     W   R F    +RDFGMG     E  + E   L+++L K  G  ++    F    ANII   V  +R    D  F  + ++         + Q F LM  +    ++ F+    +    HR   +I    QE+       +E H  T+D      D I+ +L++    +++EKS     F    L+ + L LF AG +TT+TTL +S + M K+  + E+V  EI   IG  RLPTL D+  + YT AVI EI R + +AP+ + H+ TKD +  GY IP+NT + P + +  +DP+ +E P+ F+P HFL  N  G LK N  E  +PFS GKR CLGE +AR E F+FFTTILQ F +
Sbjct:   33 PGPRPLPFLGNLLQMDRRGLLSSFIQLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNL---------IYQTFSLMSSLSSQVFELFSAILKYFPGAHR---QISKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLR----MEKEKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDAN--GALKTN--EAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSL 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b13 (cytochrome P450, family 2, subfamily b, polypeptide 13 [Source:MGI Symbol;Acc:MGI:88599])

HSP 1 Score: 244.202 bits (622), Expect = 1.186e-73
Identity = 151/435 (34.71%), Postives = 226/435 (51.95%), Query Frame = 1
Query:  310 FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT--FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            F+ L + +G ++ +  G R +V+L     +R+ALVNN+++FSGR T      +  + GI F     W   R F    +++FGMG     E  + E   L+++L K  G  +D    F   TANII   V  +R   TD  F  + ++  +I     L++ F        S   F  F   + +   +  +I    QE+       +E H  T+D   E  D I+ +L++    +++EKS     F    L+ + L LF AG +TT+TTL    + M  +  + E+V  EI   IG  RLPTL D+  + YT AVI EI R S + P    HR TKD +  GY +P+NT + P + +  +DP+ +E P+ F+P+HFL  N  G LK +  E  +PFS GKR CLGES+AR E F+FFT+ILQ F V  + P++  D
Sbjct:   55 FIHLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAAQLVMQDYGIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGAPLDPTFFFQCVTANIICSIVFGERFDYTDEQFLRLLNLMYQIY---SLLRSF--------SCQMFELFSGLLKYFPGVHRQIAKNQQEILNFITHRVEKHRATLD-PSEPRDFIDTYLLR----MEKEKSNHNTEFHHQNLMMSVLSLFFAGTETTSTTLCCGFLLMLMYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDIVPTGAPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDAN--GALKKS--EAFLPFSTGKRICLGESIARNELFLFFTSILQNFSV--ASPVASKD 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b9 (cytochrome P450, family 2, subfamily b, polypeptide 9 [Source:MGI Symbol;Acc:MGI:88600])

HSP 1 Score: 243.047 bits (619), Expect = 2.723e-73
Identity = 152/440 (34.55%), Postives = 228/440 (51.82%), Query Frame = 1
Query:  310 FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFD-----SWDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT--FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            F++L + +G ++ +  G R +V+L     +R+ALV+++++FSGR T      +  + GI F     W   R F    +++FGMG     E  + E   L+++L K  G  +D   LF   TANII   V  +R   TD  F                +    LM+ IF      S   F  F  F+ +   +  +I  K QE+       +E H  T+D      D I+ +L++    +++EKS     F    L+ + L LF AG +TT+ TL + ++ M K+  + E+V  EI   IG  RLPTL D+  + YT AVI EI R S + P+ + H+  KD +  GY +P+NT + P + +  +DP+ +E P++F+P HFL  N  G LK    E  +PFS GKR CLGES+AR E FIFFTTILQ F V  + P++  D
Sbjct:   55 FIQLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGVPLDPTFLFQCITANIICSIVFGERFDYTDDQF----------------LHLLNLMYKIFSLLSSFSGQMFELFSGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLD-PSAPRDYIDTYLLR----MEKEKSNHNTEFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALHDPQYFEQPDKFNPEHFLDAN--GALK--KCEAFLPFSTGKRICLGESIARNELFIFFTTILQNFSV--ASPVAPKD 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b10 (cytochrome P450, family 2, subfamily b, polypeptide 10 [Source:MGI Symbol;Acc:MGI:88598])

HSP 1 Score: 241.506 bits (615), Expect = 1.652e-72
Identity = 154/439 (35.08%), Postives = 227/439 (51.71%), Query Frame = 1
Query:  310 FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSW-----DWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVK--TFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPF---------SLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            F++L + YG ++ +  G R +V+L   D +R+ALV  +++FSGR T           G+IF +   W   R F    +RDFGMG     E  Q E   L+++L K  G  +D   LF   TANII   V  +R   TD  F               L++ F   F +  S+     + F+ F  +    HR   +I    QE+       +E H  T+D      D I+ +L++    +++EKS +   F    L+ + L LF AG +T++TTL +  + M K+  + E+V  EI   IG  RLPTL D+  + YT AVI EI R S + P+ + HR TKD +  GY +P+NT + P + +  +DP+ +E P+ F+P+HFL  N  G LK +  E  +PF         S+GKR CLGES+AR E F+FFT+ILQ F V
Sbjct:   55 FIQLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFL-------------RLLELFYQTFSLISSFSSQMFELFSGFLKYFPGAHR---QISKNLQELLDYIGHSVEKHRATLDPSVP-RDFIDIYLLR----MEKEKSNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDAN--GALKKS--EAFLPFSTGQIFDQKSVGKRICLGESIARNELFLFFTSILQNFSV 468          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P00178|CP2B4_RABIT (Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=9986 GN=CYP2B4 PE=1 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.506e-77
Identity = 163/464 (35.13%), Postives = 239/464 (51.51%), Query Frame = 1
Query:  214 RNLPKGLKECPLVKS-WPIVGILPQI-KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFR--HRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT--FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            R  PK     P   S  P++G L Q+ +  +   F++L + YG ++ +  G R +V+L   D +R+ALV+ +++FSGR        +    G+IF +   W   R F    +RDFGMG     E  Q E   L+++L K  G  +D   LF+  T+NII   V  KR    D +F  + D+  +                +F+ +  F + F   T R  +R  + I+    + +E H  T+D      D I+ +L++    ++++KS  +  F    LI   L LF AG +TT+TTL +  + M K+  + E+V  EI   IG  R P L D+  + YT AVI EI R+  + P  + H  TKD    GY IP+NT + P + +  +DP+ +ETPN F+P HFL  N  G LK N  E  +PFSLGKR CLGE +ARTE F+FFTTILQ F +    P  D D
Sbjct:   21 RGHPKAHGRLPPGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSF-----SSQVFELFPGFLKHFPG-THRQIYRNLQEINTFIGQSVEKHRATLD-PSNPRDFIDVYLLR----MEKDKSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDAN--GALKRN--EGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDID 469          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P24460|CP2BB_CANLF (Cytochrome P450 2B11 OS=Canis lupus familiaris OX=9615 GN=CYP2B11 PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.991e-77
Identity = 162/472 (34.32%), Postives = 239/472 (50.64%), Query Frame = 1
Query:  208 LKRNLPKGLKECPL-VKSWPIVGILPQI-KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLF-RLMKDMQNRIVKQKDLVQFFLLMFPIFDSWD--WFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            + R  PK     P   +  PI+G   Q+ +  +   F++L + YG ++ +  G R  V+L   D +R+ALV+N+++FSGR        +    G++F +   W   R F    +RDFGMG     E  Q E   L+++L K  G   D    F+  TANII   V  KR    D  F RLM                F + F +  S+    F  F  F+ +      +++   QE+       +E H +T+D      D I+ +LI+ ++  ++ +    F    LI  +L LF AG +TT+TTL +  + M K+  I E++Y EI   IG  RLP+L D+  + YT AVI EI R   + P+ + H  TKD    GY IP+ T + P +++   DP  +E P+ F+P+HFL  N  G LK N  E  IPFS+GKR CLGE +AR E F+FFTTILQ F V  + P++  D
Sbjct:   19 MARGHPKAYGHLPPGPRPLPILGNFLQMDRKGLLKSFLRLQEKYGDVFTVYLGPRRTVMLCGIDAIREALVDNAEAFSGRGKIAVVEPVFQGYGVVFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKTEGVLQDPTFFFHSMTANIICSIVFGKRFGYKDPEFLRLM--------------NLFYVSFALISSFSSQMFELFHSFLKYFPGTHRQVYNNLQEIKAFIARMVEKHRETLD-PSAPRDFIDAYLIRMDK--EKAEPSSEFHHRNLIDTALSLFFAGTETTSTTLRYGFLLMLKYPHIAERIYKEIDQVIGPHRLPSLDDRAKMPYTDAVIHEIQRFGDLLPIGVPHMVTKDICFRGYIIPKGTEVFPILHSALNDPHYFEKPDVFNPDHFLDAN--GALKKN--EAFIPFSIGKRICLGEGIARMELFLFFTTILQNFSV--ASPMAPED 467          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|O55071|CP2BJ_MOUSE (Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=Cyp2b19 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.117e-74
Identity = 156/449 (34.74%), Postives = 234/449 (52.12%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQI-KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDS-WDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVK--TFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            P  +  P +G L Q+ +  +   F++L + YG ++ +  G R +V+L   D +R+ALVN +++FSGR T      +    G+IF     W   R F    +RDFGMG     E  + E   L+++L K  G  ++    F    ANII   V  +R    D  F  + ++         + Q F LM  +    ++ F+    +    HR   +I    QE+       +E H  T+D      D I+ +L++    +++EKS     F    L+ + L LF AG +TT+TTL +S + M K+  + E+V  EI   IG  RLPTL D+  + YT AVI EI R + +AP+ + H+ TKD +  GY IP+NT + P + +  +DP+ +E P+ F+P HFL  N  G LK N  E  +PFS GKR CLGE +AR E F+FFTTILQ F +
Sbjct:   33 PGPRPLPFLGNLLQMDRRGLLSSFIQLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNL---------IYQTFSLMSSLSSQVFELFSAILKYFPGAHR---QISKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLR----MEKEKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDAN--GALKTN--EAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSL 460          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P12789|CP2B5_RABIT (Cytochrome P450 2B5 OS=Oryctolagus cuniculus OX=9986 GN=CYP2B5 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 3.673e-74
Identity = 152/430 (35.35%), Postives = 224/430 (52.09%), Query Frame = 1
Query:  310 FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFR--HRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT--FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            F++L + YG ++ +  G R +V+L   D +R+ALV+ +++FSGR        +    G+ F +   W   R F    +RDFGMG     E  Q E   L+++L K  G  +D   LF+  T+NII   V  KR    D +F  + D+  +                +F+ +  F + F   T R  +R  + I+    + +E H  T+D      D I+ +L++    ++++KS  +  F    LI   L LF AG +TT+TTL +  + M K+  + E+V  EI   IG  R P L D+  + YT AVI EI R+  + P    H  TKD    GY IP+NT + P + +  +DP+ +ETPN F+P HFL  ++ G LK N  E  +PFSLGKR CLGE +ARTE F+FFTTILQ F +    P  D D
Sbjct:   55 FLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVFFANGEHWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSVTSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSF-----SSQVFELFPGFLKHFPG-THRQIYRNLQEINTFIGQTVEKHRATLD-PSNPRDFIDVYLLR----MEKDKSDPSSEFHHRNLILTVLTLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLVPFGAPHMVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFL--DADGALKRN--EGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDID 469          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P00176|CP2B1_RAT (Cytochrome P450 2B1 OS=Rattus norvegicus OX=10116 GN=Cyp2b1 PE=1 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.714e-73
Identity = 150/432 (34.72%), Postives = 224/432 (51.85%), Query Frame = 1
Query:  289 KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVK--TFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            +  + + FM+L + YG ++ +  G R +V+L   D +++ALV  ++ FSGR T      +    G+IF +   W   R F    +RDFGMG     E  Q E   L+++L K  G  +D   LF   TANII   V  +R   TD  F  + ++  R                    +++F+ F  +    HR   +I    QE+       +E H  T+D      D I+ +L++    +++EKS     F    L+ + L LF AG +T++TTL +  + M K+  + E+V  EI   IG  RLPTL D+  + YT AVI EI R S + P+ + HR TKD +  GY +P+NT + P + +  +DP+ ++ P+ F+P HFL  N  G LK +  E  +PFS GKR CLGE +AR E F+FFTTILQ F V
Sbjct:   48 RGGLLNSFMQLREKYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGRGTIAVIEPIFKEYGVIFANGERWKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFDYTDRQFLRLLELFYRTFSLLSSFSS--------QVFEFFSGFLKYFPGAHR---QISKNLQEILDYIGHIVEKHRATLD-PSAPRDFIDTYLLR----MEKEKSNHHTEFHHENLMISLLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRSKMPYTDAVIHEIQRFSDLVPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFDHPDSFNPEHFLDAN--GALKKS--EAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSV 459          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A4P8NYX5 (P450 2B-like protein OS=Dugesia japonica OX=6161 GN=p4502B PE=2 SV=1)

HSP 1 Score: 521.161 bits (1341), Expect = 9.530e-178
Identity = 255/482 (52.90%), Postives = 354/482 (73.44%), Query Frame = 1
Query:  211 KRN-LPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSF 1653
            KRN +PKGLKE P+    PI+GI+ +IK PM+++ +KL+K +GPI+RI+ GMR+++IL+N D+++KALV++  +FSGR   +  + +  +SGIIF D   WS QR F+ KVLRDFG+G  KSV++ Q+EC  LL++L    G+ +D   +    TANII+KF+MNKR    +     ++ M +  +K+KD++Q   +MFP  D+   F    +  T + + F  I   ++E I++HLKT+DF+ EG+DL++RFLIK+NQL QQ   V +F D QLIR+SLELF AG++TT+TTL WS +FM+KH  IQ++V++EII+ IGKERLPT++DKKS++YTQAV+DEI RMSSVAP+A+IHRT  DA +DGYFIP+NTLI PN+YACH+D  IWE P  F P HFL+++  G LKY  R+ELI FS+GKRQCLGESLAR EFFIFFT+ILQRFRV+  K L++ +Y  A+ G DG++R   V D+ F
Sbjct:   22 KRNSIPKGLKETPIEYGLPILGIIHKIKEPMHNYLLKLSKKHGPIFRIKLGMRDVLILSNYDIIKKALVDDGQNFSGRWRMKLISLITHDSGIIFKDGQDWSTQRSFVLKVLRDFGLGKSKSVDLVQNECSFLLEELESLEGKIIDFSKIIPIYTANIISKFIMNKRFERENPKIARIEKMLSEEIKKKDIIQLLHIMFPKCDTSGLFCELIINFTSKWKEFLEIQNYFKEEIDEHLKTIDFNSEGEDLMDRFLIKQNQLKQQNIDVGSFNDWQLIRSSLELFYAGYETTSTTLCWSFLFMSKHQDIQQKVHNEIIEIIGKERLPTMNDKKSMNYTQAVMDEIFRMSSVAPLALIHRTLNDANIDGYFIPKNTLIFPNLYACHFDRDIWEKPMIFYPEHFLTEDDNGNLKYTPRDELILFSIGKRQCLGESLARMEFFIFFTSILQRFRVKLVKELNEKEYEEALLGKDGIIRGSIVNDFIF 503          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A2U8U473 (Cytochrome P450 2K1-like protein OS=Dugesia japonica OX=6161 GN=P450 PE=2 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 1.238e-173
Identity = 241/485 (49.69%), Postives = 348/485 (71.75%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIRD 1665
            +R++P GLKE P+   WPI+GI+P+IK PM ++ ++L++ +GPI+RIR GMR++VIL N   +RKALV+++  FSGR   +  + +  +SGI+F D  VWS QR F+ KVLRDFGMG   S +I Q ECL LL++L    G+ +D   +    TANII+KF+MNKR   +D   + ++    +  KQ D+VQ   LMFPIFD     ++F ++IT + ++F ++   + + IE+H   +D++ EGDDLI+RFL+++N+L Q    V++FTD QLI  + E+F AG++TT+TTL WSM+FM+++  IQ++VY+EI++ IG+ER+PT++DKKSL+YTQAV+DEILR+SSVAP+ I HRT  D  VD YFIP+N+L+  N YACH DP IW  P EF P HFL K    ELKY+ REELIPF +GKRQC+GESLAR E+FIFF +ILQR++V FS+ +SDS +   +RGN+G++R   + ++ F+  +
Sbjct:   23 RRSIPNGLKETPIEYGWPILGIIPKIKGPMQNYLLELSRKHGPIFRIRLGMRDVVILGNYQTIRKALVDDAQIFSGRWKMKLVSVVTHDSGIVFKDGPVWSTQRSFILKVLRDFGMGKSISQDIVQGECLFLLNELDSLQGEIIDFSKIIPIYTANIISKFIMNKRFDRSDPRIKFIEYAIFQTSKQSDIVQRLHLMFPIFDKSTIISKFNLWITSKLQLFSKVERVFHDEIEEHKTNLDYNSEGDDLIDRFLLEQNRLSQSTGIVESFTDKQLIFMTFEMFGAGYETTSTTLGWSMLFMSRYKDIQKKVYEEILNVIGEERMPTMNDKKSLNYTQAVMDEILRLSSVAPLGIFHRTFNDTSVDNYFIPKNSLVFANYYACHTDPDIWLKPVEFYPEHFLIKCENDELKYSPREELIPFGIGKRQCIGESLARMEYFIFFVSILQRYQVDFSENISDSLFEETLRGNEGIIRYSKIKNFIFKTHN 507          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267GXQ8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009966g1 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 6.908e-78
Identity = 175/490 (35.71%), Postives = 261/490 (53.27%), Query Frame = 1
Query:  220 LPKGLKECPLVKSWPIVGILPQIK-APMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQN-RIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDH------LKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLR-VCSVTDYSFEIR 1662
            LP G    PL    PI+G LP +    + +   K+   YG IY  R G R M+++++ +L+++ L  + D FSGR             GI+F++  VWS QR    +VLRDFG    +SVE    E  +L++ L ++  + V V + F   T ++IA  V  +R  + D   R  K ++N + +    L+     +FP      + ++    +    +I + +    Q  IE+       L + D D EG  L + ++I++    + +   +TF   QL+R S+ELFVAG DTTA TL W M+ MA   + Q+ V +EI    G ER P LSDK  L YTQAVIDE +R +S+AP AI HR  KD    GY IP +  I+P +Y  H + K W+ P+ F P HFL+++S    +Y   + L PF +GKR C GESLA+ E F+ FT I+QR+RV+FS+     DY + +   D +LR VC +   + E R
Sbjct:   55 LPPG----PL--GLPILGRLPWLDLKHLEESQEKMRHQYGGIYSYRMGSRLMIVVSSYELLKEML--SEDVFSGRQLPPAAQRTAQGCGILFVEGRVWSEQRRVSLRVLRDFGFARTESVEFINEEIRILMEKLEQQPTE-VKVIDHFNALTNSVIAMLVFGRRYANEDK--RYEKFLENSKFLFDVGLLSALPFLFP------YLSKLLSLLPMTRKIVKTVQ-DIQTFIEEEITKREALISTDADAEGTCLCDAYIIERRNA-EAKGDFETFKKFQLVRVSMELFVAGTDTTAKTLEWLMIHMAAFPEAQDNVQEEIHRVAGTERQPQLSDKAQLHYTQAVIDESMRFASLAPNAISHRAIKDTYFRGYLIPADAAIVPFLYGLHRNSKYWKRPHTFYPGHFLTEDS----RYAPSKMLEPFCVGKRACPGESLAKLEIFLTFTAIMQRYRVRFSR-----DYETKV---DDILRGVCGLARDAGENR 513          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267FQE9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009966g3 PE=4 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 7.067e-77
Identity = 174/490 (35.51%), Postives = 260/490 (53.06%), Query Frame = 1
Query:  220 LPKGLKECPLVKSWPIVGILPQIK-APMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQN-RIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDH------LKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLR-VCSVTDYSFEIR 1662
            LP G    PL    PI+G LP +    + +   K+   YG IY  R G R M+++++ +L+++ L  + D FSGR           + GI+F++  VWS QR    +VLRDFG    +SVE    E  +L++ L ++  + V V + F   T ++IA  V  +R  + D   R  K ++N + +    L+     +FP      + ++    +    +I + +    Q  IE+       L + D D EG  L + ++I++    + +   +TF   QL+R S+ELFVAG DTTA TL W M+ MA   + Q+ V  EI    G ER P LSDK  L YTQAVIDE +R +S+AP AI HR  KD    GY IP +  I+P +Y  H + K W+ P+ F P HFL+++     +Y   + L PF +GKR C GESLA+ E F+ FT I+QR+RV+FS+     DY + +   D +LR VC +   + E R
Sbjct:   55 LPPG----PL--GLPILGRLPWLDLKHLEESQEKMRHQYGGIYSYRMGSRLMIVVSSYELLKEML--SEDVFSGRQLPPAAQRTAQDCGILFVEGRVWSEQRRVSLRVLRDFGFARTESVEFINEEICILMEKLEQQPTE-VKVIDHFNALTNSVIAMLVFGRRYANEDK--RYEKFLENSKFLFDVGLLSELPFLFP------YLSKLLSLLPMTRKIVKTVQ-DIQTFIEEEITKREALISSDADAEGTCLCDAYIIERRNA-EAKGDFETFKKFQLVRVSMELFVAGTDTTAKTLEWLMIHMAAFPEAQDNVQAEIHQVAGTERQPQLSDKAQLHYTQAVIDESMRFASLAPNAISHRAIKDTYFRGYLIPADAAIVPFLYGLHRNSKYWKRPHTFYPGHFLTEDG----RYAPSKMLEPFCVGKRACPGESLAKLEIFLTFTAIMQRYRVRFSR-----DYETKV---DDILRGVCGLARDAGENR 513          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A3Q2QK06 (Uncharacterized protein OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.897e-76
Identity = 157/453 (34.66%), Postives = 235/453 (51.88%), Query Frame = 1
Query:  235 KECPLVKSWPIVGILPQIKAPMYD-FFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFD-CEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            +E P  +  P+ G L Q+     D    +L+KTYGP++++ FG +++V+L     V++ALVN+++ F  R  T  +       GI+F +   W   R F    L+DFGMG   + EI   EC  L+ +     G++          TAN+IA  V  KR    D  F+ M +  N+I+              I++ + W   F        +  E      +++IE+  K++D D C     I+ FLI+K  L         F D  L+ +   LF AG DTT  TL W +++MAK+  IQEQV +E+   +G  ++  + D+K+L Y  AVI E  R++++AP+AI H T+KD    GYFI   T + P + +  YD   WE P  F+P+HFL      E K++ RE  +PFS G+R C GESLAR E FIFFT++LQRFR   S   S+ +
Sbjct:   36 REPPGPRRLPLFGNLFQVDLKRLDRSLFELSKTYGPVFQVHFGFKKVVVLAGYRAVKEALVNHAEEFGNREITPVFHDFAKGHGILFSNGDSWREMRRFALTTLKDFGMGKKMTEEIIDEECQHLVKEFELFEGKAFSNTQAINYATANVIAATVFGKRFDYKDLNFQAMVERDNKIIHLTGTASLL-----IYNFFPWLGPFLKNWKNLMKYVEDGKADTRKIIEELKKSLDPDTCRC--FIDAFLIRKKHLEDSGVENPYFHDDNLLYSVTNLFAAGNDTTGNTLKWCLLYMAKYPHIQEQVQEELSTVVGNRQI-RVEDRKNLPYADAVIHESQRLANIAPIAIPHATSKDVTFQGYFIQGGTTVFPLLTSVLYDGTEWENPYSFNPSHFLDS----EGKFSRREAFLPFSAGRRVCPGESLARMELFIFFTSLLQRFRFTPSPGTSEDE 476          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2n13 (cytochrome P450 2J6-like [Source:NCBI gene;Acc:103035066])

HSP 1 Score: 249.98 bits (637), Expect = 6.738e-76
Identity = 152/453 (33.55%), Postives = 246/453 (54.30%), Query Frame = 1
Query:  217 NLPKGLKECPLVKSWPIVGILPQIKAPM-YDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDN-HVWSIQRPFLSKVLRDFGMGNCKSVEIA-QSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRI----FERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFR 1554
            N P G    PL  + P +G +  I +P  + +  KL K Y  I+ +R G ++M++L    +V++ALVN +D+F  R  +     +   +G +F  N ++W  QR F    LR+FG+G  K++E+A   E   LLD++ +  GQ+ D   LF +  +NII + V  +R    D  F+ M    +  +  +  +   L        ++ F      +  RH +    +E I    ++ ++ H   +D      D ++ FLI+K            F+D  L+R +L+LF+AG +TT T+L W+++++AK+ +IQ++V +EI   IG+ R P ++DK ++ YT+AVI EILR   + P++      KD  + GY IP+ T I+P +++  +D   WETPN F+P HFL K    E K+  R+  + FS GKR CLGE LAR E F+FFT + Q+FR
Sbjct:   36 NFPSG----PL--ALPFLGNILDIASPQPHIYLTKLGKAYNNIFSMRIGQQKMILLTGYKMVKEALVNQTDNFVDRPYSPLAERIYSGNGGLFTSNGNLWKKQRRFALSTLRNFGLGK-KTMELAICEESHFLLDEMDRHKGQAFDPSGLFNNAVSNIICQLVFGQRYDYADYDFQQMLKYTSEAIHLEGSIWGRL--------YESFPNIMKHLPGRHNVIFSNYEHISEFIKKNLDKHKANLD-PSNPRDYMDSFLIEKEN---SHDPADGFSDKNLVRCTLDLFLAGTETTTTSLGWALIYLAKNPEIQDKVQEEIDRVIGQSRQPGMADKPNMPYTEAVIHEILRRGDIVPLSGPRVAAKDTTLGGYAIPKGTTIMPILHSVLFDEDEWETPNSFNPQHFLDK----EGKFVRRDAFLAFSAGKRVCLGEQLARMELFLFFTCLFQKFR 465          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000019491.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:5874953:5884237:1 gene:ENSAMXG00000018921.2 transcript:ENSAMXT00000019491.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.58 bits (610), Expect = 3.107e-72
Identity = 149/449 (33.18%), Postives = 233/449 (51.89%), Query Frame = 1
Query:  319 LAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDD---LIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYR------SAIRGNDGVLRVCSV 1638
            LAKTYG ++++ FG +++V+L     V++ALVN+++ F  R   + +  L    GI+F +   W   R F    LRDFGMG   S E    E   ++++  K  G++ D      +  +NII+  V   R   +D  F+ M +  N  V+        L     ++ + W   F        R  ER   K ++ I   + ++      DD    I+ FL++K    +  +    F D  L+   L LFVAG DTT TTL W ++ MAK+  IQ++V++E ID++   R   + D+KSL YT AVI EI R +++ PM++ H T+ D   +G+FI + T + P + +   D   WE+P  F+P+HFL K      ++  ++  +PFS G+R CLGESLAR E F+FFT++LQ FR  F+ P   S  +      S I  N    ++C+V
Sbjct:   40 LAKTYGSVFKVYFGPKKVVVLAGYKTVKQALVNHAEEFGEREIGKLFKNLSEEHGILFSNGENWREMRRFALTNLRDFGMGKRGSEEKIVEEIQYIVEEFGKFEGKAFDTTQPVNNAVSNIISSIVYGSRFEYSDPQFKEMVNRANENVRIGGSAPIRL-----YNVFPWIGPFLK----SKRKLERNTEKNRKEINGIISSLQETLHPDDRRGFIDSFLVRKQSDEKSGQKNSRFNDKNLLSTVLNLFVAGTDTTGTTLRWGLLLMAKNPHIQDRVHEE-IDRVIGGRQVVVEDRKSLPYTDAVIHEIQRCANIVPMSLPHVTSCDVHFNGFFIKKGTTVYPLLTSVLRDESEWESPQTFNPDHFLDKQG----RFAKKDAFMPFSAGRRVCLGESLARMELFLFFTSLLQHFR--FTPPPGVSKDQLDLTPVSGITLNPSPHKLCAV 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000052034.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:5870600:5884237:1 gene:ENSAMXG00000018921.2 transcript:ENSAMXT00000052034.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.58 bits (610), Expect = 4.164e-72
Identity = 149/449 (33.18%), Postives = 233/449 (51.89%), Query Frame = 1
Query:  319 LAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDD---LIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYR------SAIRGNDGVLRVCSV 1638
            LAKTYG ++++ FG +++V+L     V++ALVN+++ F  R   + +  L    GI+F +   W   R F    LRDFGMG   S E    E   ++++  K  G++ D      +  +NII+  V   R   +D  F+ M +  N  V+        L     ++ + W   F        R  ER   K ++ I   + ++      DD    I+ FL++K    +  +    F D  L+   L LFVAG DTT TTL W ++ MAK+  IQ++V++E ID++   R   + D+KSL YT AVI EI R +++ PM++ H T+ D   +G+FI + T + P + +   D   WE+P  F+P+HFL K      ++  ++  +PFS G+R CLGESLAR E F+FFT++LQ FR  F+ P   S  +      S I  N    ++C+V
Sbjct:   42 LAKTYGSVFKVYFGPKKVVVLAGYKTVKQALVNHAEEFGEREIGKLFKNLSEEHGILFSNGENWREMRRFALTNLRDFGMGKRGSEEKIVEEIQYIVEEFGKFEGKAFDTTQPVNNAVSNIISSIVYGSRFEYSDPQFKEMVNRANENVRIGGSAPIRL-----YNVFPWIGPFLK----SKRKLERNTEKNRKEINGIISSLQETLHPDDRRGFIDSFLVRKQSDEKSGQKNSRFNDKNLLSTVLNLFVAGTDTTGTTLRWGLLLMAKNPHIQDRVHEE-IDRVIGGRQVVVEDRKSLPYTDAVIHEIQRCANIVPMSLPHVTSCDVHFNGFFIKKGTTVYPLLTSVLRDESEWESPQTFNPDHFLDKQG----RFAKKDAFMPFSAGRRVCLGESLARMELFLFFTSLLQHFR--FTPPPGVSKDQLDLTPVSGITLNPSPHKLCAV 474          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp1d1 (cytochrome P450 1A1-like [Source:NCBI gene;Acc:103022525])

HSP 1 Score: 236.498 bits (602), Expect = 1.548e-70
Identity = 137/471 (29.09%), Postives = 243/471 (51.59%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNH--VWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLM--------------LLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVK---QKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRI--FERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQ 1560
            ++ LP  L   P  ++WP+VG L Q+   ++     L   YG ++R++ G  E+V+L+    +R+ALV   ++F+GR     +T +   + + F + +   W++ +      LR F     ++   + S CL+              L +   K G + +D   L     AN+       KR +  D  F  + ++ N ++K     +L  FF    P+F       R+    + R  +    R++   ++ I++HL + D +C  D  I   LI+  +  Q+++     TD Q+I   +++F AGFDT  T L WS++++ K   I+ ++  EI D++G  RLPT  DK  + YT+A + E+ R +S  P  + H TT++  ++GYFIP++T +  N Y  ++DP+IW  P+ F P  FLS +S  ++  +  E+++ F +GKR+C+G+  AR E F+F TT+LQR  ++
Sbjct:   35 RKTLPSNLPPGP--RAWPVVGNLFQMGEQLHLSLTHLGAVYGDVFRVKMGSLEVVVLSGLSTIRQALVRQGEAFAGRPELFTFTAVSDGNSMTFSEKYGEAWTLHKKICKNALRTFSQAKARN---SSSSCLLEERITEEVLEMVEVLREQGEKVGDEGLDPTALLAISVANVACALCFGKRYSHNDEQFLTIVNINNEVLKIFASGNLADFF----PVF-------RYLPSPSLRKVVQYIHRMNCFMEDHIKEHLLSFDKNCIRD--ITDALIELCEDRQEDRDKAMLTDSQIIHTVIDIFGAGFDTIITGLQWSLLYLIKFPHIRTRICQEIDDQVGLNRLPTFEDKAKMPYTEAFLYEVFRHASYMPFTLPHCTTENITLNGYFIPKDTCVFINQYQVNHDPEIWSDPDSFQPERFLSPSS--QINKDVVEKVLIFGMGKRRCVGDRFARLEMFMFLTTVLQRLHIE 485          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000019474.2 (cytochrome P450 2K1-like [Source:NCBI gene;Acc:103034280])

HSP 1 Score: 235.343 bits (599), Expect = 2.974e-70
Identity = 143/428 (33.41%), Postives = 232/428 (54.21%), Query Frame = 1
Query:  301 YDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLL-MFPIFDSWDWFNRFFVFITFRHRIF---ERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKP 1572
            ++   +LAKTYG ++++ FG +++V+L     V++ALVN+++ F  R  +  +       GI+F +   W   R F    LRDFGMG   S E    E   L +     GG++ D      +  +NII+  V   R   +D  F+ M +  N  V+        +  MFP      W  RF   +    ++F   E+  V+ +E+++   +T++ + E    ++ FL++K Q+ +  +    F +  LI     LFVAG DT+ TTL W ++ MAK+  IQ++V++E ID++   R   + D+KSL YT AVI EI R +++ PM++ H T+ D   +G+FI + T + P + +   D   WE+P  F+P+HFL K      ++  ++  +PFS G+R CLGESLAR E F+FFT++LQ FR  F+ P
Sbjct:   63 HESLCELAKTYGSVFKVYFGPKKVVVLAGYKTVKQALVNHAEEFGEREVSPMFKKYNEEHGILFSNGENWREMRRFALSNLRDFGMGKRGSEEKIIEEIQYLKEVFESFGGKAFDTTQPVNNAVSNIISSIVYGSRFEYSDPQFKEMVNRANENVRIGGSASVLVYNMFP------WTGRFLRSV---QKLFVNNEKNRVQIRELVKGLQETLNTE-ERRGFVDSFLLRK-QIDESNEKASYFNEKNLIVTVGNLFVAGTDTSGTTLRWGLLLMAKNPHIQDRVHEE-IDRVIGGRQVVVEDRKSLPYTDAVIHEIQRCANIVPMSLPHVTSCDVHFNGFFIKKGTTVYPLLTSVLRDESEWESPRTFNPDHFLDKQG----QFLKKDAFMPFSAGRRVCLGESLARMELFLFFTSLLQHFR--FTPP 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001876.1 (pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 gene:ENSPMAG00000001674.1 transcript:ENSPMAT00000001876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 7.624e-60
Identity = 146/486 (30.04%), Postives = 230/486 (47.33%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFM-KLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMN-SGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDM--QNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFER---IHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFS-LGKRQCLGESLARTEFFIFFTTILQRFRVQF--SKPLSDSDYRSAIRGNDGVLRVCSV 1638
            +R  P G +  PLV      G L Q+        + KL++TYGPIY +  G   +V+L  ++++++ALV  ++ F  R     +     N  G++      W  +R F   +LR+FGMG     E    E   L+  +  K  +  D  +      AN+I       R    +  F  + D+  +N  +   D  Q F   FP+            F     RI +    ++   Q  IE+H        E  D ++ F+ K+  +         F+D+ LI  +  LFVAG +TT+ TL W ++ M  + K+QEQV +EI   +G  R P  +D+  + YT A + EI R +++ PMA  H TT D  + GYF+P+ T +I  I++   +  +WE P +F+P HFL  +      +  R + + FS +G R CLG++LAR E F+FFT +LQRF  Q     P+ D   +S I  N     VC++
Sbjct:   37 QRGFPPGPRGLPLV------GNLFQLDLKALPASLDKLSETYGPIYSVSLGQTRVVVLVGNEIIKEALVTQAEMFIDRPEIPVFKKSLGNYEGLLLSHGWQWRARRRFTLMMLRNFGMGTKSIEEKIAEEAEFLVRAIENKQEKPFDAHSEINKSAANVICSITFGDRYDWNNKTFVKLMDIITENVELSGNDWSQIFN-SFPVLK---------YFPGPHQRINKNKVVLNAFIQARIEEH-DMARIQGEPRDYLDAFIDKR--IEDSMNPDTAFSDIALINTTANLFVAGSETTSATLKWGILLMLTYPKVQEQVQEEIDRVVGSNRRPACADRACMPYTNATVHEIQRYANILPMAFPHATTCDTKLRGYFLPKGTQVIALIHSALREKSLWEAPEQFNPGHFLDIDGN----FYNRNDFMAFSAVGPRICLGKNLARMEVFLFFTALLQRFSFQGQPGHPMPDLTPKSGIVWNPFRYEVCAI 499          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 2.704e-59
Identity = 136/440 (30.91%), Postives = 217/440 (49.32%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQIKAPMYDFFM-KLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLD-NHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFR-LMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFR 1554
            P  K  P +G +   K P  D  + ++ K YG +  +  G   MV ++    V++ LV+    F+ R  T     +    GIIF      W   R F    LR+FG+G     +  Q+E   L++   +KG  + D          NII   V  KR   +D  F+  +  ++N +  Q  L+     +FP    +    +       + + F R  +  +    D +K +   C    LI+ +L   +QL +++    +F++  LI  +L+LF+AG +TT+TTL W +++M  H +IQ Q ++EI   +G +RLP + D+ SL Y  AVI EI R S++ P    H TT D     Y IP+ T+I+ N+ +   D   W+TP EFSP +FL ++     K+   +  +PFS G R CLGE+LA+ E F+FF ++LQ F 
Sbjct:   55 PGPKVIPFLGNVSLFKKP--DVALDEVTKQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVGFLIEAFKQKG-SAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLVENNLQLQSGLLGTLCNIFPFLMDFPGPQQIIFKSMAKSKQFIRDIISERHATRDPIKPM---C----LIDAYL---SQLEKEDNPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLPCMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLDEDG----KFVKPDAFLPFSAGPRVCLGENLAKMELFLFFASLLQHFE 477          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.06 bits (510), Expect = 3.782e-58
Identity = 132/447 (29.53%), Postives = 217/447 (48.55%), Query Frame = 1
Query:  316 KLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLD-NHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVK-QKDLVQFFLLMFPIFD--SWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFR-------------VQFSKPLSDSDYRSAIR 1605
            +LAK YG +  I  G   +V+++  + V++ LVN    F+ R  T  +T L  N GI        W  QR F    LR+FG G     +    E   L++   K+   + D      +   NII   +   R    +  F+ +  +   +V+ Q + +     +FP        W   F         I  ++     +++ +H  T D      DLI+ +L + ++  +++    +FT   LI+  +ELF+ G +TT+ TL W ++FM  +  IQ + + EI   +G ER P ++D++SL Y  AVI EI R  +V P+ ++H T+KD   + Y  P+ T ++ N+ +  +D   W+TPN+F+P+HFL K+     +    +  +PFS G R CLGESLA+ E F+FFT++LQ F               +FS  LS   Y+  +R
Sbjct:   65 ELAKKYGEVCTIMLGSTPVVLVSGYEAVKEVLVNRGHEFADRPITPIFTKLTQNIGIALAPYGDPWKQQRRFALSTLRNFGFGKATIADKISIEAKYLIETF-KQETSAFDPHLNLNNALGNIICCLLNRNRYDYDNEQFQKLTHLLEYLVQLQAEPLVILCNVFPFLLKLPGPWQKVF--------HIHSKLQCLLNDIVSEHRATKD-QHNPRDLIDSYLAQIDK--EKDNPNSSFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDKDG----QCIQSDAFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFEFYWPNSVSPPTLAAKFSTTLSPLPYKLGLR 495          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp17a1 (cytochrome P450, family 17, subfamily A, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040213-2])

HSP 1 Score: 199.904 bits (507), Expect = 1.406e-57
Identity = 127/443 (28.67%), Postives = 218/443 (49.21%), Query Frame = 1
Query:  298 MYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNH--VWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFN--RFFVFITFR---HRIFERIHVKWQEVIEDHLKTVDFDC-EGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAI 1602
            ++    +LA+TYG +Y +R G  ++V+LNN + +++ L+  S  F+GR  T     +      I L ++  VW  QR      L    +G  ++ EI Q E   L++DL +  G+  D+         N+I       +    D+ F  +    + +V+        L   P   + D F   R F    +R     + +R  V W++++    K       +  D + +F        + E      T+ ++  + ++ F+AG +TTAT + W++ ++  H ++Q+Q+Y+E+  K+     P+L+D+  L Y  A I EILR+  VAP+AI HR  +D+ V G+FI + + +I N++A H D   W+ P+ F P  FL ++     + N    L+PF  GKR CLGESLA+ E F+F   +L+R R+Q +    D   + AI
Sbjct:   64 LHIHLTQLARTYGAVYCLRVGGEDIVVLNNVESIKEMLIKKSADFAGRPQTYAGGKITGGGKDIALGDYSAVWRRQRRAALSALH--CVGTARTEEIVQGEAQRLVEDLTQYIGRPTDIHTDISMRVCNVICSVAFGTKYDKHDTEFLDIHCCLDSLVR--------LWGSPAIRALDCFPVLRLFPNPAWRDLMAAVRKRDEVVWRQILLHKAKPSSSPSSDMTDFLLKFTRHSRNEEESEARGGILTEERVHLSIMDTFIAGVETTATLIEWALAYLVLHPEVQDQIYEEMEQKLQPGLGPSLADRDKLLYLDATIKEILRLCPVAPLAIPHRALRDSSVGGFFICKGSTVIANLWAAHRDHAHWDNPSVFQPGRFLGESLE---RRNPASLLLPFGAGKRVCLGESLAKAEIFLFLGHVLRRLRLQPAGSPPDLSGQLAI 493          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp1d1 (cytochrome P450, family 1, subfamily D, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-041114-179])

HSP 1 Score: 190.274 bits (482), Expect = 6.816e-54
Identity = 131/491 (26.68%), Postives = 226/491 (46.03%), Query Frame = 1
Query:  229 GLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNH--VWSIQRPFLSKVLRDFGMG-------NCKSVEIAQSECLMLLDDLAKKGGQS----VDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLM---KDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVK--WQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVK--TFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQ--RFRVQFSKPLSDSDYRSAIRGNDGVLRVCS 1635
            G +  P    WPIVG + Q+    +    ++   YG ++R+  G   +V+L+  + +++ALV N D+F+GR      + +     + F   +   W   +      LR+F           C   E    E   LL  LA KGG +     D         AN++   V  KR    D  F  +    +  +++    +LV FF  +  + ++     R    ++ R   F   H+K  +    + H++ +      D LI           +QE +++    +D +++  +L++F AGFDT  T L W ++++  H  +Q ++  EI + IG++R P   D+ +L   +A + E+ R S+  P  I H TT+D V++G FIP +T +  N++  ++DP +W  P  F P+ FLS +   E+     E++  F LGKR+CLG+ +AR E F+   T+LQ   FRV    P      + A+        VC+
Sbjct:   54 GARPLPGPVRWPIVGNILQLWPDPHLKLTRMCDRYGDVFRVHLGSVPVVVLSGLETIKRALVKNGDAFAGRPPFYSLSLVGNGDTLTFTRAYDGCWKAHKRLARSALRNFCAAPARREGYACLLEECVCEEAERLL--LACKGGGAQPGGFDPVPSITCAVANVMCALVFGKRYPHGDPTFLQIVGFNEEASQLSGAGNLVDFFPFLRHVPNAQ---LRALKVLSARLLAFMEGHIKEHYSSYQKGHVRDIT-----DALIA-------MCAEQEHALREVGLSDERVVATALDIFGAGFDTIITGLTWCLLYLCIHPDVQHKLQREIDETIGRDRTPRFEDRANLRRVEAFLTEMFRHSAFVPFTIPHSTTQDVVLNGMFIPRDTCVFVNLHQVNHDPTVWSDPERFDPDRFLSHDGK-EVNKEMVEKVQIFGLGKRRCLGDMVARQELFVVLVTLLQGLSFRVPPGTPTPSVAPQHALVMKPPRFHVCA 526          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 65.855 bits (159), Expect = 6.465e-12
Identity = 111/469 (23.67%), Postives = 200/469 (42.64%), Query Frame = 1
Query:  217 NLPKGLKECPL-VKSWPIVGILPQIKAPMYDFFMKLA-KTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSF--SGRSTTQKYTFLCMNSG--IIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMN---KRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVF---ITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHI-KIQEQVYDE---IIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMA-IIHRTTKDAVVDGY--FIPENTLIIPNIYACHYDPKIW-ETPNEFSPNHFLSKNSTGELKYNA---REELIPFSLGKRQCLGESLARTEFFIFFTTILQRFR 1554
            N PK +   P  V   P+  I P  +  +YD +++ + + YG + +  FG R  ++++  + + + +  + D+F  SG      Y+ L   +G  +I     VW   R  ++  L+ F   +    + A+  C ++ + L + G  S+ +  L      + I++  +      +T   + F      ++ I  +K +   F L FP  D     +R   F   ++FR  + +R+    Q+ + ++ K         DLI       N+++  +         QL  N + + VAG +        S+  +AK+  + QE++  E   I D  G   LP L+         A + E++RM    P++ II+R T      G    IP+   +  N +   +DPK W  T ++F P  + S   T    +     R  +  F  G+R CLGE LA TE  I    +L++FR
Sbjct:   28 NFPKNIPTIPFYVVFLPV--IFPIDQTELYDLYIRESMEKYGAV-KFFFGSRWNILVSRSEYLAQ-IFKDEDTFAKSGNQKKIPYSALAAYTGDNVISAYGAVWRNYRNAVTNGLQHFD--DAPIFKNAKILCTLIKNRLLE-GQTSIPMGPLSQRMALDNISQVALGFDFGALTHEKNAFH-----EHLIRIKKQIFHPFFLTFPFLDVLPIPSRKKAFKDVVSFRELLVKRV----QDELVNNYKFEQTTFAASDLIR---AHNNEIIDYK---------QLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLADLPLLN---------AFLFEVVRM--YPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFR 457          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 60.4622 bits (145), Expect = 3.679e-10
Identity = 45/195 (23.08%), Postives = 83/195 (42.56%), Query Frame = 1
Query: 1009 KTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKS----------LSYTQAVIDEILRMSSVAPMAIIHRTTKD--AVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRV 1557
            + FT+ ++         A  D +++   W    +A           +++ KI +E+L   ++  S          + YT  VI E LR     P+ ++    K    V   Y  P+  ++IP +Y   +DP+++E P+EF P  ++  +   E    A++  + F  G   CLG+    T   I F  +L +F +
Sbjct:  319 REFTNKEISEAVFTFLFASQDASSSLACWLFQIVADR--------PDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRP--PVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASE----AKKNWLVFGCGPHVCLGQ----TYVMITFAALLGKFAL 495          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: ERG11 (Lanosterol 14-alpha-demethylase; catalyzes C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in ergosterol biosynthesis pathway; transcriptionally down-regulated when ergosterol is in excess; member of cytochrome P450 family; associated and coordinately regulated with the P450 reductase Ncp1p; human CYP51A1 functionally complements the lethality of the erg11 null mutation [Source:SGD;Acc:S000001049])

HSP 1 Score: 54.6842 bits (130), Expect = 2.594e-8
Identity = 55/256 (21.48%), Postives = 106/256 (41.41%), Query Frame = 1
Query:  934 DCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDE---IIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPN------HFLSKNST-------------GELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQF--SKPLSDSDYRSAIRGNDGVLRV 1629
            D +  DLI+  +  KN   +    VK  TD ++    + + + G  T+A T  W ++ +A+   +Q+++Y+E   ++D  GK+ L T    + +      I E LRM    P+  + R     V+    +P  + +IP  Y     P      +E+ PN      H  +K+S              G +        +PF  G+ +C+GE  A  +  +  +  ++  +  +   K +   D+ S +    G  ++
Sbjct:  277 DIQDRDLIDSLM--KNSTYKD--GVK-MTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDG-GKKEL-TYDLLQEMPLLNQTIKETLRMHH--PLHSLFRK----VMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTLPTGPAKI 519          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 206.838 bits (525), Expect = 1.349e-60
Identity = 130/426 (30.52%), Postives = 220/426 (51.64%), Query Frame = 1
Query:  316 KLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMN-SGIIFLD-NHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIV---KQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRH--RIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKP 1572
            +LAK+YG ++R++ G   +V++N+ +  R+ALV  ++ F+GR      + +  N + I F D   +W  QR      LR FG G     E    E   L+  L+   G++ + K+       NII  FV   R    D  F  + D   + V   +   LV +F           W  R       R      +   V  Q+  ++HL T +     D  +   L+  N+  Q+E +    T+  +I    ++F AG +TTAT+++WS++++ ++ K+QEQ++ +I + +G++R P LSD+++L   +A I E+LR SS+ P+   H TT D  + GY +P++T+++ N++  H+DP+ W  P+EF P  FL  +  G+    A    +PFS G+R CL ESL + + F+F + +L +FR  FS P
Sbjct:   14 ELAKSYGEVFRLKVGSHRIVVVNSIEAAREALVRRANDFAGRPMLYTASLISRNGTDIAFGDFGPLWKQQRKIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNPKDDVNLAVLNIICSFVFGSRYDMDDPEFHTVVDYTEQFVQGFRAASLVDYF----------PWL-RHLPNKGLRQIKEACQNRDVVLQKKYQEHLVTYEHGVIRD--LTDALLSANKASQEESAYLPMTEDHIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGRDRAPELSDRENLPLIEATIAEVLRSSSLVPLLFPHSTTTDTHLRGYEVPKDTIVLFNVWNMHHDPQRWSNPDEFDPTRFL--DDKGKFICPATLSYLPFSAGRRVCLAESLGKMQLFLFISRLLHKFR--FSVP 422          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK94])

HSP 1 Score: 191.43 bits (485), Expect = 2.086e-54
Identity = 133/445 (29.89%), Postives = 226/445 (50.79%), Query Frame = 1
Query:  268 VGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRST--TQKYTFLCMNSGIIFLD-NHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFN---RFFVFIT-FRHRIFERIHVKWQEVIEDHLKTVDFDCEG-DDLIERFLIKKNQLLQQEKSVKT-FTDMQLIRNSLE-LFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKP 1572
            +G L  +   M+  F +L KTYG +YR+  G +  ++L+ D  +++ALV    +F+GR     Q  + L    G+  +D    W + R      ++ +G    +  ++ + E L L + L    G+  D+         N+I   +   R    D  F  + ++ +++ +          +FP   S   F+   R  + I   R+ I ER   K+QE    H+KT  FD E   D  +  L  K    Q++KS K    +  +I   L  LF+AG +TT+TTL W+++++  +  +QE+++ EI D IG++  P LS +K L   +A   E LR++++AP+AI H+  + + + G+ IPE T +  N+++ H+DP +W+ P  F+ + FL  +  G+ K       +PF  G R CLGE LAR+E F+F + +LQRF  +F  P
Sbjct:   37 IGNLNLLSKQMHLSFTELEKTYGKVYRLYLGHKLAIVLSGD-AIKEALVRQPRNFAGRPVLNPQLKSALNRGPGLTVMDYGETWKLFRKLGHSTIKVYGENRLQ--DVIKDEVLELCNRLESSAGKPFDITQQSGIAVTNVICTKLFGTRYQIDDPEFLRVYEIHDKLSRIGFGGNLVTNIFPSLASILPFSEKQRDLIQIGQERYEILER---KYQE----HVKT--FDPENIRDYTDALLKAKQDAEQEDKSSKEHLQESTIIMAGLATLFIAGSETTSTTLGWAVIYLLHNPDVQERLHKEIDDVIGRDAFPQLSKRKELPVLEAFTAETLRLANLAPLAIPHKARERSTLQGFEIPEGTTVFANLWSLHHDPTVWKDPFTFNLDRFL--DEEGKFKAPVGGTFLPFGAGPRVCLGEVLARSELFLFLSRMLQRF--EFVNP 465          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO29403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3R2])

HSP 1 Score: 191.045 bits (484), Expect = 4.169e-54
Identity = 135/454 (29.74%), Postives = 214/454 (47.14%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQI--KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLD-NHVWSIQRPFLSKVLRDFGMGNC-KSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVK----QKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSL-ELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLS 1578
            P    WPI+G L  +  K  +Y  F  L+  YG ++R+  G + +V+LN    +  +L      F+GR T        M+     LD   +W   +      +R  G     +++ +   E    LD L    GQ VD+   F   T N+I   +   R    D  F  + ++ N+I +     + L   F  +  I             +  R+ I  R   K++E  +     V  D   D LI+  L +KN            T+  +I   L   F+AG +TTA+TL WS++++     +QE++++E+ D IGK +LP LS KK L   +A   E LR+S + P+ + H+TT+D  + G+ IP+ T ++PN+++ H+D   W+ P +F  N FL     G  +  A +  +PFS G R CLGE LAR+E F+F   +LQ+F   F  PL 
Sbjct:   28 PGPAPWPIIGNLDLLIRKEALYKTFTNLSHKYGGVFRLYLGSKPVVVLNGK-AIYDSLARQPSVFAGRPTLPPSLDFGMDPDYGVLDYGPLWKFYKKLGHSAVRVHGTDRLNEAIRVEVDEVCRRLDSL---DGQPVDISKEFGIATTNVICARLFGSRYDVHDPEFLRIYEIHNKISRVVMSSRSLSDVFPFLVNILPESKERRELRELLQERYTIIWR---KYKEHEQTFTPGVIRDYT-DLLIDAKLSEKNS--------HKLTENGIISTGLASQFLAGSETTASTLSWSVVYLLNDSDVQERIHNELDDVIGKGQLPQLSHKKKLPVLEAFTAETLRLSCIGPLGMPHKTTRDTFLRGHAIPKGTTVVPNLWSLHHDSTEWKDPFKFDINRFLED---GVFRAPANDAYLPFSAGPRVCLGEELARSELFLFLARLLQKF--DFVTPLG 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO30239 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1C7])

HSP 1 Score: 186.037 bits (471), Expect = 1.446e-52
Identity = 134/451 (29.71%), Postives = 230/451 (51.00%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQIKAPMYDF-FMKLAKTYGPIYRIR-FGMREMVILNNDDLVRKALVNNS-DSFSGRSTTQKYTFLCMNSGI--IFLDNH----VWSIQRPFLSKVLRDF--GMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFP--IFDSWDWFNRFFVFITFRHRIFERIHVKWQEVI-EDHLKTVDFDCEGDDLIERFLIKKNQLLQQEK-SVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
            P     P++G L  IK+    F    LAKT+G I  I  FGM+ +V++ +  L R+ L+    + F+GR   +++TF  M+ G   I L+++    VW  +R  +   LR +   +G+  + E+A+ E     D L    G  VD K+ F+    NII  F+  K     D  F    ++  + V    +    L  FP  I         F      R ++   I    +E   E+H++         DL + FL  K  + +++K +    TD ++    +++++AG +TT T+L W + ++  + ++Q +V   I D IG +R P +SD++ L Y +A++ E+LR+S   P+ + H++  D  +DGY IP+ T ++ N++A H+DP+ W  P++F P+ F+  N  G+ +       +PF  G+R CLGESLA+ E F+  T +LQ+F
Sbjct:    3 PGPTPLPLIGNLLSIKSSNIHFELANLAKTHGDIMMIELFGMK-IVVVTSGPLAREVLMGKHINDFAGRP--KRFTFEYMSKGYKDIALNDYSPGLVW--KRKIVHSGLRKYFPSLGDTIAKELAKLE-----DKLNSDVGVPVDSKDEFFLLVLNIICSFLSGKAFDKEDPEFSETLELVTKTVDTLSMSASILDAFPFLIHFPLQASKNFKRIAELRDKLMGNILTFHKETFNENHIR---------DLTDAFLKAKLDIEREDKKAAGEVTDEEVALMMMDVYLAGLETTVTSLRWIIAYLMNNQEVQSRVQSRIDDVIG-DRRPLMSDRQGLPYMEALVAEVLRLSPPIPLGLPHKSILDTTIDGYTIPKGTTVLFNLWAIHHDPREWPEPDKFDPDRFI--NEDGKFEVPGDRNFLPFMAGRRVCLGESLAKMELFLIMTRLLQQF 431          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO30875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ0])

HSP 1 Score: 184.496 bits (467), Expect = 5.460e-52
Identity = 134/451 (29.71%), Postives = 229/451 (50.78%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQIKAPMYDF-FMKLAKTYGPIYRIR-FGMREMVILNNDDLVRKALVNNS-DSFSGRSTTQKYTFLCMNSGI--IFLDNH----VWSIQRPFLSKVLRDF--GMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFP--IFDSWDWFNRFFVFITFRHRIFERIHVKWQEVI-EDHLKTVDFDCEGDDLIERFLIKKNQLLQQEK-SVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
            P     P++G L  IK+    F    LAKT+G I  I  FGM+ +V++ +  L R+ L+    + F+GR   +++TF  M+ G   I L+++    VW  +R  +   LR +   +G+  + E+A+ E     D L    G  VD K+ F+    NII  F+  K     D  F    +     V    +    L  FP  I         F      R ++   I    +E   E+H++         DL + FL  K  + +++K + +  TD ++    +++++AG +TT T+L W + ++  + ++Q +V   I D IG +R P +SD++ L Y +A++ E+LR+S   P+ + H++  D  +DGY IP+ T ++ N++A H+DP+ W  P++F P+ F+  N  G+ +       +PF  G+R CLGESLA+ E F+  T +LQ+F
Sbjct:    3 PGPTPLPLIGNLLSIKSSNIHFELANLAKTHGDIMMIELFGMK-IVVVTSGPLAREVLMGKHINDFAGRP--KRFTFEYMSKGYKDIALNDYSPGLVW--KRKIVHSGLRKYFPSLGDTIAKELAKLE-----DKLNSDVGVPVDSKDEFFLLVLNIICSFLTGKAFDKEDPEFSETLEFVTMTVDTISMSASILDAFPFLIHFPLQASKNFKRIAELRDKLMGNILTFHKETFNENHIR---------DLTDAFLKAKLDIEREDKKAAEEVTDEEVALMMMDVYLAGLETTVTSLRWIIAYLMNNQEVQSRVQSRIDDVIG-DRRPLMSDRQGLPYMEALVAEVLRLSPPIPLGLPHKSILDTTIDGYTIPKGTTVLFNLWAIHHDPREWPEPDKFDPDRFI--NEDGKFEVPGDRNFLPFMAGRRVCLGESLAKMELFLIMTRLLQQF 431          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000019638.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101157991])

HSP 1 Score: 253.832 bits (647), Expect = 2.813e-77
Identity = 160/445 (35.96%), Postives = 233/445 (52.36%), Query Frame = 1
Query:  235 KECPLVKSWPIVGILPQI--KAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFE--RIHVKWQEVIEDHLK-TVDFD-CEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRF 1551
            +E P  +  PI+G L QI  K P Y    + +KTYGP++ + FG  ++V+L     V+ ALVN+ + F  R+       L    G+++ +  +W   R F    LRDFGMG     +    EC  LL+   K  G + D         +NII   V   R    D  F  M D  NR ++        L   P   +++     F ++  R  + E    + K  + I  HLK T++   C G   ++ FL+K   L +   +   F D  L+   + LF AG +TT+TTL W ++ MAK+ KIQ+QV DE+   IG +R+  +SD+K+L +T AVI EI R++S+ P A+ H+T+KD    GYFI + T + P + +  +D   WE P+ F P HFL K+     K+  RE  IPFS G+R CLGESLAR E F+FFTT+LQ F
Sbjct:   39 QEPPGPRPLPIIGNLMQIDLKRP-YKTLEEFSKTYGPVFTVFFGGEKVVVLAGYKTVKNALVNHDEEFGERAIPPIIQELNKGLGVLWSNGDIWRDIRRFALTNLRDFGMGKKACEDKITEECQYLLEVFKKFKGNAFDTTKPLNYAVSNIICSMVYGSRFEYDDPKFTSMVDRTNRNIQ--------LSGSPTLQAYNMVPWLFKWVASRREVHECAAANRKQNQSIFSHLKETLNPQMCRG--FVDAFLVKGQTLEKSGVTNSAFNDENLLMTVIHLFAAGTETTSTTLRWGLLLMAKYPKIQDQVQDELRRVIG-DRMVQVSDRKNLPFTDAVIHEIQRLASIVPTALPHKTSKDVTFQGYFIKKGTTVFPLLTSVLHDANEWEKPHTFYPAHFLDKDG----KFVKREAFIPFSAGRRICLGESLARMELFMFFTTLLQNF 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 247.669 bits (631), Expect = 1.015e-74
Identity = 154/454 (33.92%), Postives = 237/454 (52.20%), Query Frame = 1
Query:  301 YDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEV-------IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDS---DYRSAIRGNDGVLRVC 1632
            ++ F KLA  YG +Y +RFG R  V+LN    +++ALV   DS   R        +    G+IF +   W+ QR F    LR FG G      +  +E     ++L +  G+ +D   +  +  +NII   V   R    D  F+ +  + +R ++ +  +   L        ++ F      +   H+  + I   W+EV       +++H K+ D   +  D I+ +L +  +   QE S  TF +  LI   L+LFVAG +TT+TTL W+ ++MAK+ +IQE+V  EI   IGK R P + D+  L YT AVI E+ R+ ++ P+++ H T KD  + G+ IP+  LIIPN+ +  +D K WETP+ F+P HFL+K+     K+  R   IPFS GKR CLGE+LAR E F+FFT+ +Q F   FS P       DYR+ +       ++C
Sbjct:   86 HESFSKLAAEYGDLYSLRFGQRWTVVLNGHKALKEALVTKGDSVVDRPHLPLQDEIAKGLGVIFSNGANWTEQRRFALSTLRYFGFGKKSLEPVILNEFAHCAEELKRFKGEPLDPHLIINNTVSNIICHLVFGHRFNYGDKKFKKLMLLFDRALQIEASIWAQL--------YNSFTLIMRCLPGPHKTLQHI---WREVQDFIGEELKEHKKSWD-PSDARDYIDFYLTEIQKTKGQEGS--TFDEENLIMCVLDLFVAGSETTSTTLRWAFLYMAKYPEIQEKVQAEIHKVIGKSRPPCMEDRAELPYTDAVIHEVQRIGNIVPLSLPHATNKDVQLGGFTIPKGVLIIPNLTSVLFDEKEWETPHAFNPGHFLNKDG----KFVKRGAFIPFSAGKRLCLGENLARMELFLFFTSFMQHF--SFSMPAGVEPVLDYRAGLTLAPKPYKIC 519          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018818.2 (cytochrome P450 2J2 [Source:NCBI gene;Acc:101157767])

HSP 1 Score: 246.128 bits (627), Expect = 1.966e-74
Identity = 148/468 (31.62%), Postives = 238/468 (50.85%), Query Frame = 1
Query:  244 PLVKSWPIVGILPQIKAPMYDF-FMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFR-LMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFV-----FITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLR 1626
            P  +S P +G L +I+  +    F + A  YG ++ +     + V+LN   L+++AL+   D F  R     ++ L  N GI+  +   W  QR F    LR+FG+G     +  Q EC  +    A+  G+  D + L     +NII   V  +R   +D  ++ +++D+   +  Q         +FP      W  + F        T   +I + + +K    IE+H + +D  C   D I+ FLI   ++ + +     F    L   +L+LF AG +TT TTL W ++FM  +  IQE+V+ EI   IG  R P+++DK+++ YT AVI EI RM  + P+ +    ++D ++D Y IP+ T+I+P ++   +D  +WETP+ F+P HFL+++ T    +  RE   PF  GKR CLGE LAR E F+FFT+ LQRF   FS   +    +  + G  G +R
Sbjct:   42 PGPRSLPFIGDLHRIRPTILHLQFKEFAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDRPQIPLFSDLIENKGIVMTNGIQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYITQAFAEHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDKEYQQILQDLTEVVKLQGSFSALAYNVFP------WLMKRFPGPLQKLFTLVDKIMDFVKIK----IEEHKENLDPACP-KDYIDSFLI---EMEKNQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEEVHAEIDAVIGSSRQPSMADKENMPYTDAVIHEIQRMGDIVPIGVARMASRDTMLDNYTIPKGTMIMPALHTVLHDESVWETPHSFNPQHFLNQDGT----FKKREAFFPFGAGKRVCLGEQLARMELFLFFTSFLQRF--SFS---TAGGEKPPLEGRMGTIR 486          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000010152.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101174506])

HSP 1 Score: 238.039 bits (606), Expect = 2.281e-71
Identity = 151/428 (35.28%), Postives = 236/428 (55.14%), Query Frame = 1
Query:  316 KLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEV--IEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKT--FTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSD 1587
            +L+K+YGP++ + FG++++V+L     V++ALVNN++ F  R  T  +  +    GI+F +   W   R F    LRDFGMG   + E    EC  L+  L K  G  VD+       T+NII+  V   R    D  FR +    N  ++            P+   ++ F R+F +I  R  I   + +  ++V  +  HLK           ++ FLIKK +  +++  VK   FT+  L+ +   LF AG DTTATTL W ++ MAK+  IQ++V++E+   +G  ++  + D+K+L Y  AVI EI R++++ PM+I H+T +D    GY I + T +IP + +   D   WE+P+ F+P+HFLSK    E K+  R+  +PFS G+R CLGESLA+ E F+FFT++LQRF   F+ P   S+
Sbjct:   66 ELSKSYGPVFTVYFGIQKVVVLAGYKTVKEALVNNAEEFGDRDITPMFQDMNKGHGILFANGESWKELRRFALTTLRDFGMGKRIAEEKILEECDYLIQGLEKHQGNPVDLTCPLNYATSNIISSIVYGSRFDYDDPRFRNLVSRANETIRING--------HPLTHLYNMFPRWFRWIKNRKIILNNVEMTVKDVKDLVKHLKETLNPSVCRGFVDCFLIKKQK--EEDSCVKESHFTEQNLVFSVSNLFAAGTDTTATTLRWGLLLMAKYPHIQDKVHEELAKVLGGRQV-RVDDRKNLPYADAVIHEIQRVANIIPMSIPHKTNRDVTFHGYLIQKGTTVIPLLASVLNDENEWESPHTFNPHHFLSK----EGKFVKRDAFMPFSAGRRACLGESLAKMELFLFFTSLLQRF--HFTPPPGVSE 476          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2p3 (cytochrome P450 2P3 [Source:NCBI gene;Acc:100302452])

HSP 1 Score: 231.106 bits (588), Expect = 1.112e-68
Identity = 152/487 (31.21%), Postives = 242/487 (49.69%), Query Frame = 1
Query:  208 LKRNLPKGLKECPLVKSWPIVGILPQIKAP-MYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFR-LMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFV-----FITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDS---DYRSAIRGNDGVLRVCSV 1638
            L    PK     P   S P +G L +I    ++    + A+ YG ++ +       VILN    V++ALV   D F  R +   +     N GI+  + + W  QR F    LR+FG+G     +  Q EC  L +   +   +  + + L  +  +NII   V  +R   +D  ++ +++D+   ++ Q            +F+S+ W  +         +T   ++ +   VK    I +H + +D      D I+ FLI   ++ Q E    +F    L   +L+LF+AG +TT TTL W +++M  +  IQE+V  EI   IG  R P+++DK+++ YT AVI EI RM ++ P+ ++   +KD  +D Y IP+ T+IIP + +  +D  +WETP+ F+P HFL K+     K+  RE   PF  GKR CLGE LAR E F+FFT++LQRF   FS P  +    + R          R+C+V
Sbjct:   32 LANRRPKNFPPGP--HSLPFIGDLHRINPSRLHLQLTEFAEKYGNVFSLHLFGERAVILNGHKHVKEALVQRGDDFVDRPSIPLFEQFYSNKGIVVSNGYPWKQQRRFALHTLRNFGLGKKTMEKYMQEECRYLTEAFGEYKVKPFNAQALINNAVSNIICCLVFGERYEYSDKQYQQILQDINEIMILQGGFAA------QLFNSFPWLMKKLPGPHQKILTLLAKLIDFAKVK----ISEHKENLD-PSSPKDYIDSFLI---EMAQNENQESSFDISNLCMCTLDLFIAGTETTTTTLHWGLLYMIYYADIQEKVQAEIDAVIGSSRQPSMADKENMPYTDAVIHEIQRMGNILPLGVLRMASKDTTLDKYTIPKGTMIIPTLNSVLHDESMWETPHSFNPKHFLDKDG----KFRKREAFNPFGAGKRVCLGEQLARMELFLFFTSLLQRF--SFSAPAGEQPSLENRMGATRCPKPYRLCAV 496          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072748.1 (SMESG000072748.1)

HSP 1 Score: 1004.59 bits (2596), Expect = 0.000e+0
Identity = 485/487 (99.59%), Postives = 485/487 (99.59%), Query Frame = 1
Query:  205 NLKRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIRD 1665
            N KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKY AREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIRD
Sbjct:   20 NFKRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYKAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIRD 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078091.1 (SMESG000078091.1)

HSP 1 Score: 510.375 bits (1313), Expect = 4.040e-177
Identity = 238/484 (49.17%), Postives = 349/484 (72.11%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIR 1662
            K  +PKGLKE P+    PI+G + +I+ PM+ + +KL +  GPI+RI+ GMR++V+LNN ++++KAL++++++FSGR + +    +  +SGIIF D  +W+ QR F+ KVLRDFG+G  KS+EI Q+EC   LD+L    GQ VD   L    T NII++F+MNKR T  D   +L+++  N   K KD++Q  LLMFP FD+     +    +T + + F +I   + E IE+H   +D   EG+DL++RFLIK+++L Q   +V++F D QLIR S+ELF+AG++TT+TTL W  +FM+K+  IQE+V+ EI + IGKERLPT++DKK+L+YTQAV+DE+LR+SSVAPM +IHRT  DA ++G++IP+++LI PN+YACH DP+IWE+P  F P HFLS +S G  KY  REELIPFS+GKRQCLGESLAR+E+FIFF +++QRF++ F++ +S+  Y   I GN+GV+R   + ++ F+ R
Sbjct:   23 KPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSQRFIKEITHDSGIIFKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNIQLIEETINNSTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSKWKSFVKIQNYFGEEIEEHRTNLDLTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVAPMGLIHRTFDDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGVIRTSDIKNFLFKRR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078098.1 (SMESG000078098.1)

HSP 1 Score: 506.138 bits (1302), Expect = 2.241e-175
Identity = 237/484 (48.97%), Postives = 346/484 (71.49%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIR 1662
            K  +PKGLKE P+    PI+G + +I+ P+  +F KL++  GPI+RI+ GMR++V+LNN ++++K L++++++FSGR   + +T    +SGI+F D H+W+IQR FL KVLRDFG+G  KS+EI Q+ECL  LD+L    GQ V+   L    T NII++F+MNKR T  D   + +      + K KD++Q  L+MFP FD+   F++    +  + + F  I   + E IE+H   +D   EG+DL++RFLIK+ QL Q   +V++F D QLIRNS+E+F+AG++TT+TTL W  +FM+K+  IQE+V+ EI + IGKERLPT++DKK+L+YTQAV+DE+LR+SSV PMA+IHRT  DA ++G++IP+++LI PN+YACH DP+IWE+P  F P HFLS +S    KY  REELIPFS+GKRQCLGESLAR+E+FIFF +++QRF++ F++ +S+  Y   I GN+G +R   +T + F+ R
Sbjct:   23 KTQIPKGLKEIPVESGLPIIGAIHKIEMPISRYFQKLSRKLGPIFRIKLGMRKIVVLNNYEMIKKTLIDDANNFSGRWLPKVFTDAAHDSGIMFKDGHIWAIQRSFLLKVLRDFGLGKAKSLEIIQNECLNFLDELDTLSGQIVEFSELIPIYTTNIISRFIMNKRFTRDDPKVQFIGKTITNLTKSKDILQLILIMFPCFDTSSLFSKLVFLLNTKWKRFVTIENYFWEEIEEHRTNLDLTSEGEDLMDRFLIKQRQLKQSTGNVESFVDWQLIRNSVEIFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVVPMALIHRTFYDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNEISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEEKYLQTIIGNEGHIRTSDITKFKFKKR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078092.1 (SMESG000078092.1)

HSP 1 Score: 496.123 bits (1276), Expect = 1.830e-171
Identity = 234/484 (48.35%), Postives = 340/484 (70.25%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIR 1662
            K  +PKGLKE P+    PI+G + +I+ PM+ + +KL +  GPI+RI+ GMR++V+LNN ++++KAL++++++FSGR + +    +  +SGII+ D  +W+ QR F+ KVLRDFG+G  KS+EI Q+EC   LD+L    GQ VD   L    T NII++F+MNKR T  D     M+    +  K KD+ Q  LLMFP FD+     +    +T   + F R    + + I++H   +DF  EG+DL++RFLIK+ QL Q   +V++F D QLIR S+ELF+AGF+TT+TTL W  +FM+K+  IQE+V+ EI + IGKERLPT++DKK+L+YTQAV+DE+LR+SSV PMA+IHRT  DA ++G++IP+++LI PN+YACH DP+IWE P    P HFLS +S G  KY  REELIPFS+GKRQC+GESLAR+E+FIFF +++QRF++ F + +S+  Y   I GN+G++R   + ++ F+ R
Sbjct:   23 KPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIFQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRTQDFFADEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGFETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVVPMALIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWEFPKTLYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFGEEISEDRYSQTIIGNEGLIRTSDIKNFLFKRR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078100.1 (SMESG000078100.1)

HSP 1 Score: 491.5 bits (1264), Expect = 1.141e-169
Identity = 236/485 (48.66%), Postives = 346/485 (71.34%), Query Frame = 1
Query:  211 KRNLPKGLKECPLVKSWPIVGILPQIKAPMYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRSTTQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSECLMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKDMQNRIVKQKDLVQFFLLMFPIFDSWDWFNRF-FVFITFRHRIFERIHVKWQEVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSLELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDKKSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIYACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGESLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDYSFEIR 1662
            K  +PKGLKE P+    PI+G + +I+ PM+ + +KL +  GPI+RI+ GMR++V+LNN ++++KAL++++++FSGR + +  T +  +SGI+F D    + QR F+ KVLRDFG+G  KS+EI Q+ECL LLD+L     Q VD    F   T NII++F+MNKR T  D   + +    + + K KD+    LLMFP  D      R  F+F++   R F +I   + E I++H   +DF  EG+DL++RFLIK+++L Q   +V++F D QLIRNSLEL +AG++TT+TTL W  +FM+K+  IQE+V++EI + IGKERLPT++DKK+L+YTQAV+DE+LR+SSVAPM ++HRT  DA ++G++IP+++LI PN+YACH DP+IWE+P  F P HFLS +S G  KY  REELIPFS+GKRQC+GESLAR+E+FIFF +++QRF++ F++ +S+  Y   I GN+G +R   +T + F+ R
Sbjct:   23 KPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKIITEVSHDSGIMFKDGQGLATQRSFILKVLRDFGLGKSKSLEIIQNECLNLLDELDTLSDQIVDFSEFFPIYTTNIISRFIMNKRFTRDDPNIQFIWKTMDNLAKNKDIFHLILLMFPCLDQSFIVARLLFLFVSDWKR-FVKIQDYFAEEIKEHRNALDFTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRNSLELIIAGYETTSTTLNWCCLFMSKYPDIQEKVHEEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVAPMGLMHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFAEEISEEKYLQTIIGNEGHIRTSDITKFKFKNR 506          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2B62.155e-7335.09cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
CYP2A62.025e-6731.28cytochrome P450 family 2 subfamily A member 6 [Sou... [more]
CYP2A132.646e-6631.26cytochrome P450 family 2 subfamily A member 13 [So... [more]
CYP2J26.302e-6529.75cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2U17.741e-6531.12cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33D37.033e-6030.35CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33E21.266e-5930.96CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33E13.708e-5929.71CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33E13.708e-5929.71CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C19.277e-5827.71CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a15.794e-5929.46gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a15.794e-5929.46gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp303a17.399e-3726.98gene:FBgn0001992 transcript:FBtr0343812[more]
Cyp303a17.399e-3726.98gene:FBgn0001992 transcript:FBtr0080828[more]
Cyp304a11.503e-3526.53gene:FBgn0038095 transcript:FBtr0082691[more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2k218.517e-7635.11cytochrome P450, family 2, subfamily k, polypeptid... [more]
cyp2k167.220e-7233.95cytochrome P450, family 2, subfamily K, polypeptid... [more]
cyp2p81.680e-7031.70cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2u12.388e-6830.99cytochrome P450, family 2, subfamily U, polypeptid... [more]
cyp2y32.469e-6833.56cytochrome P450, family 2, subfamily Y, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021944.11.048e-7332.97cytochrome P450 2K1-like [Source:NCBI gene;Acc:100... [more]
cat13.551e-7333.26calcium transporter 1 [Source:Xenbase;Acc:XB-GENE-... [more]
cyp2f11.621e-7233.99cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
cyp2f12.802e-7234.35cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
ENSXETT00000028287.18.471e-7233.04cytochrome P450 family 2 subfamily A member 6 gene... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2b104.164e-7535.81cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b194.456e-7534.74cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b131.186e-7334.71cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b92.723e-7334.55cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b101.652e-7235.08cytochrome P450, family 2, subfamily b, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00178|CP2B4_RABIT1.506e-7735.13Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=99... [more]
sp|P24460|CP2BB_CANLF1.991e-7734.32Cytochrome P450 2B11 OS=Canis lupus familiaris OX=... [more]
sp|O55071|CP2BJ_MOUSE3.117e-7434.74Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=C... [more]
sp|P12789|CP2B5_RABIT3.673e-7435.35Cytochrome P450 2B5 OS=Oryctolagus cuniculus OX=99... [more]
sp|P00176|CP2B1_RAT9.714e-7334.72Cytochrome P450 2B1 OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4P8NYX59.530e-17852.90P450 2B-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A2U8U4731.238e-17349.69Cytochrome P450 2K1-like protein OS=Dugesia japoni... [more]
A0A267GXQ86.908e-7835.71Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FQE97.067e-7735.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3Q2QK061.897e-7634.66Uncharacterized protein OS=Fundulus heteroclitus O... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2n136.738e-7633.55cytochrome P450 2J6-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000019491.23.107e-7233.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052034.14.164e-7233.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
cyp1d11.548e-7029.09cytochrome P450 1A1-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000019474.22.974e-7033.41cytochrome P450 2K1-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001876.17.624e-6030.04pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 ... [more]
ENSPMAT00000011205.12.704e-5930.91pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
ENSPMAT00000011254.13.782e-5829.53pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
cyp17a11.406e-5728.67cytochrome P450, family 17, subfamily A, polypepti... [more]
cyp1d16.816e-5426.68cytochrome P450, family 1, subfamily D, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
DIT26.465e-1223.67N-formyltyrosine oxidase; sporulation-specific mic... [more]
ERG53.679e-1023.08C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
ERG112.594e-821.48Lanosterol 14-alpha-demethylase; catalyzes C-14 de... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481911.349e-6030.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482072.086e-5429.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294034.169e-5429.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302391.446e-5229.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308755.460e-5229.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000019638.22.813e-7735.96cytochrome P450 2K1 [Source:NCBI gene;Acc:10115799... [more]
ENSORLT00000020799.21.015e-7433.92cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
ENSORLT00000018818.21.966e-7431.62cytochrome P450 2J2 [Source:NCBI gene;Acc:10115776... [more]
ENSORLT00000010152.22.281e-7135.28cytochrome P450 2K1 [Source:NCBI gene;Acc:10117450... [more]
cyp2p31.112e-6831.21cytochrome P450 2P3 [Source:NCBI gene;Acc:10030245... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072748.10.000e+099.59SMESG000072748.1[more]
SMESG000078091.14.040e-17749.17SMESG000078091.1[more]
SMESG000078098.12.241e-17548.97SMESG000078098.1[more]
SMESG000078092.11.830e-17148.35SMESG000078092.1[more]
SMESG000078100.11.141e-16948.66SMESG000078100.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014966 ID=SMED30014966|Name=Cytochrome P450 2K1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1709bp
CAGGATCCCAGTTTCACCGCATCGAATGCAAATCACTGATGCCATCATAG
GTCACTGGACAAAGGTCAAATAGACAGAATTATTTACATTTCATAATGAT
TATTTGCTAGTTCATATAAAGGCCACCAAGCATTTTGATACTTCCAAATG
TTAATTTTAATAATTCTTTTCGTACTGTGTTTTCTAATATGTTTCCGGTT
ACTTAATTTGAAAAGGAACTTACCAAAAGGATTAAAAGAATGTCCTTTAG
TAAAATCATGGCCAATTGTAGGAATATTGCCACAAATAAAGGCTCCAATG
TATGACTTCTTTATGAAGTTGGCCAAGACTTACGGACCGATCTATCGAAT
AAGATTCGGAATGAGAGAGATGGTGATTTTGAATAATGACGATTTGGTAC
GGAAGGCATTGGTCAACAATTCCGATTCCTTTTCTGGCAGATCTACAACA
CAGAAATATACTTTTCTCTGTATGAATTCAGGAATAATCTTTTTAGATAA
TCATGTCTGGAGCATTCAGCGACCTTTTCTTTCCAAAGTTCTTCGTGATT
TTGGAATGGGAAATTGCAAATCTGTCGAAATCGCTCAGTCGGAATGTCTG
ATGCTTTTGGATGATTTGGCTAAGAAAGGTGGCCAATCCGTTGATGTTAA
AAATTTATTTTATGACTGTACAGCCAACATAATTGCTAAATTTGTAATGA
ACAAGCGCGTTACATCGACGGATTCGCTGTTCAGACTTATGAAGGACATG
CAAAACAGAATTGTAAAACAAAAAGATTTAGTTCAATTTTTCTTGTTAAT
GTTTCCAATATTTGATAGCTGGGACTGGTTCAATAGATTCTTTGTTTTTA
TTACGTTTCGCCATAGAATCTTTGAAAGGATTCATGTCAAATGGCAAGAA
GTGATAGAAGACCATTTGAAAACTGTTGACTTTGACTGTGAAGGCGATGA
TCTAATAGAACGATTTTTAATTAAGAAAAATCAACTTCTTCAACAAGAAA
AATCTGTTAAAACCTTCACAGACATGCAACTCATTCGGAACTCTCTGGAA
CTGTTTGTGGCCGGATTCGACACAACAGCCACCACACTTGTATGGAGCAT
GATGTTTATGGCAAAACATATAAAGATCCAAGAACAAGTATACGATGAAA
TAATAGATAAAATAGGAAAAGAAAGGTTACCAACATTGAGTGATAAGAAA
TCTTTGAGCTACACCCAAGCTGTAATTGATGAAATTTTGCGAATGAGTTC
AGTGGCACCGATGGCCATTATTCACAGAACAACGAAAGATGCCGTAGTTG
ACGGATATTTTATTCCAGAAAACACGCTGATAATTCCTAACATTTATGCA
TGCCATTATGATCCTAAAATCTGGGAAACCCCAAACGAATTTTCTCCTAA
TCATTTCCTCTCAAAAAATTCCACTGGGGAGTTAAAATATAACGCAAGGG
AAGAATTAATTCCGTTTAGTTTAGGAAAACGGCAATGTCTTGGAGAATCA
TTAGCTAGAACGGAGTTCTTTATATTCTTCACAACTATTCTACAAAGATT
TCGAGTTCAATTTTCCAAGCCTCTTTCTGATTCTGATTATCGTTCTGCCA
TTCGAGGTAATGACGGAGTTCTTCGAGTCTGCTCGGTGACTGACTATTCC
TTTGAAATAAGAGACTGAAAGACTTTCAATAACTCATATATTATTATTAT
TATTATTAT
back to top

protein sequence of SMED30014966-orf-1

>SMED30014966-orf-1 ID=SMED30014966-orf-1|Name=SMED30014966-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MLILIILFVLCFLICFRLLNLKRNLPKGLKECPLVKSWPIVGILPQIKAP
MYDFFMKLAKTYGPIYRIRFGMREMVILNNDDLVRKALVNNSDSFSGRST
TQKYTFLCMNSGIIFLDNHVWSIQRPFLSKVLRDFGMGNCKSVEIAQSEC
LMLLDDLAKKGGQSVDVKNLFYDCTANIIAKFVMNKRVTSTDSLFRLMKD
MQNRIVKQKDLVQFFLLMFPIFDSWDWFNRFFVFITFRHRIFERIHVKWQ
EVIEDHLKTVDFDCEGDDLIERFLIKKNQLLQQEKSVKTFTDMQLIRNSL
ELFVAGFDTTATTLVWSMMFMAKHIKIQEQVYDEIIDKIGKERLPTLSDK
KSLSYTQAVIDEILRMSSVAPMAIIHRTTKDAVVDGYFIPENTLIIPNIY
ACHYDPKIWETPNEFSPNHFLSKNSTGELKYNAREELIPFSLGKRQCLGE
SLARTEFFIFFTTILQRFRVQFSKPLSDSDYRSAIRGNDGVLRVCSVTDY
SFEIRD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR001128Cyt_P450
IPR002401Cyt_P450_E_grp-I
IPR017972Cyt_P450_CS
Vocabulary: molecular function
TermDefinition
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0005506iron ion binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016712oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 357..375
score: 37.49
coord: 314..340
score: 29.2
coord: 83..104
score: 27.46
coord: 59..78
score: 34.92
coord: 174..192
score: 24.79
coord: 437..447
score: 56.27
coord: 447..470
score: 48.45
coord: 294..311
score: 35.95
coord: 398..422
score: 37.4
IPR001128Cytochrome P450PRINTSPR00385P450coord: 447..458
score: 49.72
coord: 438..447
score: 58.4
coord: 358..369
score: 42.1
coord: 305..322
score: 39.5
IPR001128Cytochrome P450PFAMPF00067p450coord: 35..473
e-value: 6.2E-102
score: 341.7
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 22..497
e-value: 5.2E-119
score: 400.2
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 30..477
NoneNo IPR availablePANTHERPTHR24300FAMILY NOT NAMEDcoord: 6..479
NoneNo IPR availableTMHMMTMhelixcoord: 2..21
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 440..449