Serine/threonine-protein phosphatase with EF-hands

Overview
NameSerine/threonine-protein phosphatase with EF-hands
Smed IDSMED30014950
Length (bp)2228
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase with EF-hands (SMED30014950) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase with EF-hands (SMED30014950) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase with EF-hands (SMED30014950) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase with EF-hands (SMED30014950) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014950

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014950SMESG000076282.1 SmedASXL_011913SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014950SMESG000076282.1 dd_Smed_v4_16123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014950SMESG000076282.1 dd_Smed_v6_16123_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014950SMESG000076282.1 OX_Smed_1.0.14951ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF1 (protein phosphatase with EF-hand domain 1 [Source:HGNC Symbol;Acc:HGNC:9243])

HSP 1 Score: 509.22 bits (1310), Expect = 1.076e-171
Identity = 255/626 (40.73%), Postives = 374/626 (59.74%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELD-------------------------------QAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKE--FQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            +++ + IQ WYRGY+ARL+AR+  +  I+QSIEY+ EQ Q++L  FF  ++      +     L  ++L     ++   +Y + I +   Y+GP +QFPLT T I  L+ AF  +QILH HY+ E+L +T+ +LK  PN +    S  K +TICGDLHG+L DL  IF +N  P   NPYVFNGDF+DRGK+S+EI +IL    ++YP  + LNRGNHED +MNLRYGF KE+  KYK H   I+ +  + + WLP+ TI+ N+I + HGGIS    L  L  ++R+K  S L  P+++  D                               + EW Q++DILWSDP+ + GC  N  RGGGCYFGPD+T + L KY+ ++LIRSHECKP GYE CH  +V+TIFSASNYY+ GSN+GA++KL     P+   +   K   FQ    + + +  +E SA++ LR ++++ +S L   F   D   SG +    W   M  +L L+LPWR+L + L  +  +G + Y S+F+ + R++      +   V + +Y+YR  LE +F  +D+D+SG IS++EF+   K+  SH   ++    +  LA  +D+NKDGSID NEFL+AF +
Sbjct:   17 LRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQP---LRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNI-RIEKPVQEAHSTLV-ETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYV 637          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF1 (protein phosphatase with EF-hand domain 1 [Source:HGNC Symbol;Acc:HGNC:9243])

HSP 1 Score: 409.453 bits (1051), Expect = 9.269e-134
Identity = 224/596 (37.58%), Postives = 336/596 (56.38%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQK-GCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKE--FQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            +++ + IQ WYRGY+ARL+AR+  +  I+QSIEY+ EQ Q++L  FF  ++      +     L  ++L     ++   +Y + I +   Y+GP +QFPLT T I  L+ AF  +QILH HY+ E+L +T+ +LK  PN +    S  K +TICGDLHG+L DL  IF +N  P   NPYVFNGDF+DRGK+S+EI +IL    ++YP  + LNRGNHED +MNLRYGF KE+  KYK H   I+ +  + + WLP+ TI+ N+I + HGGIS    L  L  ++R+K  S L  P+++  D            +D K  K G   N    G        T    E                 +EW   ++V+TIFSASNYY+ GSN+GA++KL     P+   +   K   FQ    + + +  +E SA++ LR ++++ +S L   F   D   SG +    W   M  +L L+LPWR+L + L  +  +G + Y S+F+ + R++      +   V + +Y+YR  LE +F  +D+D+SG IS++EF+   K+  SH   ++    +  LA  +D+NKDGSID NEFL+AF +
Sbjct:   17 LRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHD----------TDSKHNKVGVTFNAH--GRIKTNGSPTEHLTE-----------------HEW---EQVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQP---LRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNI-RIEKPVQEAHSTLV-ETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYV 575          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 304.679 bits (779), Expect = 8.422e-92
Identity = 149/293 (50.85%), Postives = 197/293 (67.24%), Query Frame = 3
Query: 1119 QAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            Q EW QV+DILWSDP  Q+GC+ N  RGGGCYFGPD+T Q L+KY  + LIRSHECKP GYE+CH  +VLTIFSASNYY+ GSN+GA+VKL  +L P I+ + A K     + + + I  +EESALR LR K+  + S L+SEF   D D  GLI    W   + +VL L LPWR LR QL   +    + Y S  + L++    + ++   S+ + +Y+ R  LET+FRI+DSD+SG IS+DEF++  K+  SH   ++T + + DLARSID NKDG ID+NEFLEAFR+ E
Sbjct:  435 QEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANK-VTHTLTMRQRISRVEESALRALREKLFAHSSDLLSEFKKHDADKVGLITLSDWAAAVESVLHLGLPWRMLRPQLVNSSADNMLEYKSWLKNLAKEQLSRENIQS-SLLETLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMNIDITDDCICDLARSIDFNKDGHIDINEFLEAFRLVE 725          

HSP 2 Score: 299.671 bits (766), Expect = 6.042e-90
Identity = 144/299 (48.16%), Postives = 194/299 (64.88%), Query Frame = 3
Query:  216 KSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALN-----KSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNC 1097
            K+   IQ+WYR Y ARLE RR+C+W I+QSIEY+G+QDQ+KLH+FF  LM+     + +     T+        + + +K+ S+YE+ I +   Y+GP + FPL     T+L+ AF  +Q LH  Y+  LL +T+  L   PNI+       + IT+CGDLHGQL DLI+IF +N  P P   YVFNGDF+DRGK SVEI +ILF+F+++YP    LNRGNHED ++NLRYGF KEV  KYK H   I+    D+F WLPLAT+I  K+ I HGG+S+   LE L  I+RSK +S + C
Sbjct:   21 KAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFAQDSEMKKCSDYES-IEVPDSYTGPRLSFPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRC 318          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 300.056 bits (767), Expect = 1.241e-91
Identity = 144/300 (48.00%), Postives = 194/300 (64.67%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALN-----KSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNC 1097
             K+   IQ+WYR Y ARLE RR+C+W I+QSIEY+G+QDQ+KLH+FF  LM+     + +     T+        + + +K+ S+YE+ I +   Y+GP + FPL     T+L+ AF  +Q LH  Y+  LL +T+  L   PNI+       + IT+CGDLHGQL DLI+IF +N  P P   YVFNGDF+DRGK SVEI +ILF+F+++YP    LNRGNHED ++NLRYGF KEV  KYK H   I+    D+F WLPLAT+I  K+ I HGG+S+   LE L  I+RSK +S + C
Sbjct:   20 FKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFAQDSEMKKCSDYES-IEVPDSYTGPRLSFPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRC 318          

HSP 2 Score: 193.741 bits (491), Expect = 1.446e-52
Identity = 89/158 (56.33%), Postives = 110/158 (69.62%), Query Frame = 3
Query: 1119 QAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQ 1592
            Q EW QV+DILWSDP  Q+GC+ N  RGGGCYFGPD+T Q L+KY  + LIRSHECKP GYE+CH  +VLTIFSASNYY+ GSN+GA+VKL  +L P I+ + A K     + + + I  +EESALR LR K+  + S L+SEF   D D  GL   Q
Sbjct:  435 QEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANK-VTHTLTMRQRISRVEESALRALREKLFAHSSDLLSEFKKHDADKVGLASSQ 591          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 246.128 bits (627), Expect = 1.195e-72
Identity = 133/326 (40.80%), Postives = 190/326 (58.28%), Query Frame = 3
Query:  465 IPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            + +E +YSGP ++   +T++ +  L+  + +++ LH    +++LVQ + +L     + ET L   + IT+CGD HGQ  DL+ IFE N  P  +NPY+FNGDF+DRG  SVE+ + LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    +  LF+++F WLPLA  I+ K+ I HGG+   + + L+ ++ I+R++       P DS         + D+LWSDP+PQ G R    RG  C FGPD+T  FLE+     +IRSHE K  GYE  H    +T+FSA NY D   NK +++ L  S L P+   F A
Sbjct:  169 MTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQ---MYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQ------PPDSG-------PMCDLLWSDPQPQNG-RSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTA 477          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 530.791 bits (1366), Expect = 1.333e-180
Identity = 269/652 (41.26%), Postives = 396/652 (60.74%), Query Frame = 3
Query:  120 MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQN-------------LSSDSLFTKAL---NKSTSIKRSSE--YENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP---------SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVK-LTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            MGC  S  ++N               S  + +KS I IQKWYR  +ARLEARR+ +W I+ ++EY+GEQDQLKL++FF D++  M ++N             +S+ S + K     ++  ++K+  E     ++ ++ +Y GP +  PL    +  +I AF   ++LH  Y+  +L + R I K  P++S    SI   +TICGDLHG+  DL  I  +N YP   NPY+FNGDF+DRG  S+E+  +LF+ +I+ P  ++LNRGNHED IMNLRYGFIKE+ TKYK  +  I  L  D+F WLP+ATII   IF+ HGGIS++ ++  L  I R ++ S L  P          +S ++  EW Q+LDI+WSDPK  KGC  N+FRGGG YFG DIT  FLEK+ FRLL+RSHECK  GYE+ H +  LT+FSASNYY+TGSN+GA+VK + KS +P  + + A K  +K  L  E +  +EESA++EL+ K+ +  + L  EF   D + SG +    W + +  +  L+LPW  L  ++A ++  G          ++++     H  +  + + +Y+++ TLET+FR +D DNSG++S+ EF + C++L  ++K  +  + +  +A SID NKDG IDLNE LEAFR+
Sbjct:    1 MGCGPSSGRQN--------------PSTELTIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALSHYAKPSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTL-RERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGG--THAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 635          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 529.635 bits (1363), Expect = 2.605e-179
Identity = 263/623 (42.22%), Postives = 388/623 (62.28%), Query Frame = 3
Query:  207 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQN-------------LSSDSLFTKAL---NKSTSIKRSSE--YENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP---------SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVK-LTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            + +KS I IQKWYR  +ARLEARR+ +W I+ ++EY+GEQDQLKL++FF D++  M ++N             +S+ S + K     ++  ++K+  E     ++ ++ +Y GP +  PL    +  +I AF   ++LH  Y+  +L + R I K  P++S    SI   +TICGDLHG+  DL  I  +N YP   NPY+FNGDF+DRG  S+E+  +LF+ +I+ P  ++LNRGNHED IMNLRYGFIKE+ TKYK  +  I  L  D+F WLP+ATII   IF+ HGGIS++ ++  L  I R ++ S L  P          +S ++  EW Q+LDI+WSDPK  KGC  N+FRGGG YFG DIT  FLEK+ FRLL+RSHECK  GYE+ H +  LT+FSASNYY+TGSN+GA+VK + KS +P  + + A K  +K  L  E +  +EESA++EL+ K+ +  + L  EF   D + SG +    W + +  +  L+LPW  L  ++A ++  G          ++++     H  +  + + +Y+++ TLET+FR +D DNSG++S+ EF + C++L  ++K  +  + +  +A SID NKDG IDLNE LEAFR+
Sbjct:   81 LTIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALSHYAKPSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTL-RERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGG--THAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 700          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 464.537 bits (1194), Expect = 9.476e-156
Identity = 225/521 (43.19%), Postives = 327/521 (62.76%), Query Frame = 3
Query:  459 NDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP---------SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVK-LTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
             ++ ++ +Y GP +  PL    +  +I AF   ++LH  Y+  +L + R I K  P++S    SI   +TICGDLHG+  DL  I  +N YP   NPY+FNGDF+DRG  S+E+  +LF+ +I+ P  ++LNRGNHED IMNLRYGFIKE+ TKYK  +  I  L  D+F WLP+ATII   IF+ HGGIS++ ++  L  I R ++ S L  P          +S ++  EW Q+LDI+WSDPK  KGC  N+FRGGG YFG DIT  FLEK+ FRLL+RSHECK  GYE+ H +  LT+FSASNYY+TGSN+GA+VK + KS +P  + + A K  +K  L  E +  +EESA++EL+ K+ +  + L  EF   D + SG +    W + +  +  L+LPW  L  ++A ++  G          ++++     H  +  + + +Y+++ TLET+FR +D DNSG++S+ EF + C++L  ++K  +  + +  +A SID NKDG IDLNE LEAFR+
Sbjct:   48 TNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTL-RERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGG--THAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 565          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pph-5 (Serine/threonine-protein phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q9NES8])

HSP 1 Score: 265.774 bits (678), Expect = 2.400e-80
Identity = 135/327 (41.28%), Postives = 191/327 (58.41%), Query Frame = 3
Query:  459 NDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLT-KSLEPKIISFNA 1430
            N + +E  Y GP ++  +T   +  LI  F N+Q LH  Y F++L++    +K+ P + E  +   K  TICGD+HGQ  DL  IFE N YP  +NPY+FNGDF+DRG  SVE    +  F +LYP   F++RGNHE  +MN  YGF  EV+ KY      + ++F + F WLPL  +I+ KIF+CHGG+   + + LE ++  DR++       P D  +       + D+LWSDP+P  G R    RG GC FGPD+T ++ E      ++RSHE KP GYE  H  +  T+FSA NY D  +NKGAF+ +T  +L P+   F+A
Sbjct:  168 NAMAIEDSYDGPRLEDKITKEFVLQLIKTFKNQQKLHKKYAFKMLLEFYNYVKSLPTMVEITVPTGKKFTICGDVHGQFYDLCNIFEINGYPSETNPYLFNGDFVDRGSFSVETIFTMIGFKLLYPNHFFMSRGNHESDVMNKMYGFEGEVKAKY---TQQMCDMFTETFCWLPLCHLINEKIFVCHGGLFKEDGVTLEDIRKTDRNRQ------PPDEGI-------MCDLLWSDPQPING-RSPSKRGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQCFTVFSAPNYCDQMNNKGAFITITGDNLTPRFTPFDA 477          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: C47A4.3 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q9U3L7])

HSP 1 Score: 162.54 bits (410), Expect = 2.469e-44
Identity = 98/304 (32.24%), Postives = 162/304 (53.29%), Query Frame = 3
Query:  519 TVITSLINAFNNEQ----ILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGIS----NRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLE 1406
            ++I  +++A  +E+    ++    + +LL    G+ K +  + E +  I     +CGD+HGQ  DL+ +F    +P P+  Y+F GD++DRG+ S+E  V+L ++ + +P   FL RGNHE + +N  YGF +E Q +Y+  +  +   F D+F WLPL  +I+ KI   HGG+S        L+TL+ I+R         P++ +    E L V D+LW+DP        N  RG GC FG D       +++  L+ R+H+    GYE+    +++TIFSA +Y     N  AF+   + L+
Sbjct:    8 SIIIDVLSASTHEKPLCKVITEERVLKLLDLALGVFKAQKPMVEVNAPI----KVCGDIHGQFPDLLRLFHRGGWP-PTANYLFLGDYVDRGRFSIETIVLLLAYKVKFPCNFFLLRGNHECEFVNKTYGFYEECQKRYQ--SVRMYAAFQDVFNWLPLTGLIATKILCMHGGLSPLMTKEFTLDTLRKIER---------PTEGK----EGL-VADLLWADPISGLSGFMNNQRGAGCGFGRDSVLNLCSEFQLDLVCRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSCDEKLQ 290          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342946)

HSP 1 Score: 501.516 bits (1290), Expect = 8.929e-169
Identity = 248/604 (41.06%), Postives = 376/604 (62.25%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----GQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLE-TDYSGPIIQFPLTLTVITSLINAFNNEQ--ILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-SDSE-LDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            +++ I IQKWYR +QAR E +R+C+W I+Q++EY+ EQDQ +L+ FF DL+  M    G++N    S     L+           ++D+  E  D     I+ P+    I  LI+ F  ++   LH  Y+  +L +    LK  PNIS    ++ + +T+CGDLHG+L DL+ +  +N  P  SNPYVFNGDF+DRGK  +E+ ++L S  + +P  VFLNRGNHED +MN RYGFI+EV++KY  +   I+    +++RWLPL +++++++ I HGG S+   L+ +K+IDR KY+S L  P +D E LD+ EW Q+ DI+WSDP+   GC  N  RG G +FGPD+T  FL++++   +IRSHECKP G+E+ H ++++TIFSASNYY  GSNKGA+++L   L P  + + +     K +   + +  +E SAL+EL  ++  +R +L  EF   D  +SG I   HWC +M  V +L LPWR LR++LA  T S  +NY+ T +LL      +   + +SV D +Y  + +L  +F I+D+DNSG I++DEF+    +L +H     +   M +  R +D+N DG +DLNEFLEAFR+++
Sbjct:    6 IRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD----------KDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 599          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0473730)

HSP 1 Score: 500.745 bits (1288), Expect = 2.229e-168
Identity = 248/604 (41.06%), Postives = 376/604 (62.25%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----GQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLE-TDYSGPIIQFPLTLTVITSLINAFNNEQ--ILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-SDSE-LDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            +++ I IQKWYR +QAR E +R+C+W I+Q++EY+ EQDQ +L+ FF DL+  M    G++N    S     L+           ++D+  E  D     I+ P+    I  LI+ F  ++   LH  Y+  +L +    LK  PNIS    ++ + +T+CGDLHG+L DL+ +  +N  P  SNPYVFNGDF+DRGK  +E+ ++L S  + +P  VFLNRGNHED +MN RYGFI+EV++KY  +   I+    +++RWLPL +++++++ I HGG S+   L+ +K+IDR KY+S L  P +D E LD+ EW Q+ DI+WSDP+   GC  N  RG G +FGPD+T  FL++++   +IRSHECKP G+E+ H ++++TIFSASNYY  GSNKGA+++L   L P  + + +     K +   + +  +E SAL+EL  ++  +R +L  EF   D  +SG I   HWC +M  V +L LPWR LR++LA  T S  +NY+ T +LL      +   + +SV D +Y  + +L  +F I+D+DNSG I++DEF+    +L +H     +   M +  R +D+N DG +DLNEFLEAFR+++
Sbjct:   22 IRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD----------KDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 615          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342949)

HSP 1 Score: 501.901 bits (1291), Expect = 8.619e-168
Identity = 248/604 (41.06%), Postives = 376/604 (62.25%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----GQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLE-TDYSGPIIQFPLTLTVITSLINAFNNEQ--ILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-SDSE-LDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            +++ I IQKWYR +QAR E +R+C+W I+Q++EY+ EQDQ +L+ FF DL+  M    G++N    S     L+           ++D+  E  D     I+ P+    I  LI+ F  ++   LH  Y+  +L +    LK  PNIS    ++ + +T+CGDLHG+L DL+ +  +N  P  SNPYVFNGDF+DRGK  +E+ ++L S  + +P  VFLNRGNHED +MN RYGFI+EV++KY  +   I+    +++RWLPL +++++++ I HGG S+   L+ +K+IDR KY+S L  P +D E LD+ EW Q+ DI+WSDP+   GC  N  RG G +FGPD+T  FL++++   +IRSHECKP G+E+ H ++++TIFSASNYY  GSNKGA+++L   L P  + + +     K +   + +  +E SAL+EL  ++  +R +L  EF   D  +SG I   HWC +M  V +L LPWR LR++LA  T S  +NY+ T +LL      +   + +SV D +Y  + +L  +F I+D+DNSG I++DEF+    +L +H     +   M +  R +D+N DG +DLNEFLEAFR+++
Sbjct:   91 IRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD----------KDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 684          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342947)

HSP 1 Score: 501.901 bits (1291), Expect = 8.619e-168
Identity = 248/604 (41.06%), Postives = 376/604 (62.25%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----GQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLE-TDYSGPIIQFPLTLTVITSLINAFNNEQ--ILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-SDSE-LDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            +++ I IQKWYR +QAR E +R+C+W I+Q++EY+ EQDQ +L+ FF DL+  M    G++N    S     L+           ++D+  E  D     I+ P+    I  LI+ F  ++   LH  Y+  +L +    LK  PNIS    ++ + +T+CGDLHG+L DL+ +  +N  P  SNPYVFNGDF+DRGK  +E+ ++L S  + +P  VFLNRGNHED +MN RYGFI+EV++KY  +   I+    +++RWLPL +++++++ I HGG S+   L+ +K+IDR KY+S L  P +D E LD+ EW Q+ DI+WSDP+   GC  N  RG G +FGPD+T  FL++++   +IRSHECKP G+E+ H ++++TIFSASNYY  GSNKGA+++L   L P  + + +     K +   + +  +E SAL+EL  ++  +R +L  EF   D  +SG I   HWC +M  V +L LPWR LR++LA  T S  +NY+ T +LL      +   + +SV D +Y  + +L  +F I+D+DNSG I++DEF+    +L +H     +   M +  R +D+N DG +DLNEFLEAFR+++
Sbjct:   91 IRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD----------KDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 684          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342948)

HSP 1 Score: 501.901 bits (1291), Expect = 8.619e-168
Identity = 248/604 (41.06%), Postives = 376/604 (62.25%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----GQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLE-TDYSGPIIQFPLTLTVITSLINAFNNEQ--ILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-SDSE-LDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            +++ I IQKWYR +QAR E +R+C+W I+Q++EY+ EQDQ +L+ FF DL+  M    G++N    S     L+           ++D+  E  D     I+ P+    I  LI+ F  ++   LH  Y+  +L +    LK  PNIS    ++ + +T+CGDLHG+L DL+ +  +N  P  SNPYVFNGDF+DRGK  +E+ ++L S  + +P  VFLNRGNHED +MN RYGFI+EV++KY  +   I+    +++RWLPL +++++++ I HGG S+   L+ +K+IDR KY+S L  P +D E LD+ EW Q+ DI+WSDP+   GC  N  RG G +FGPD+T  FL++++   +IRSHECKP G+E+ H ++++TIFSASNYY  GSNKGA+++L   L P  + + +     K +   + +  +E SAL+EL  ++  +R +L  EF   D  +SG I   HWC +M  V +L LPWR LR++LA  T S  +NY+ T +LL      +   + +SV D +Y  + +L  +F I+D+DNSG I++DEF+    +L +H     +   M +  R +D+N DG +DLNEFLEAFR+++
Sbjct:   91 IRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD----------KDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 684          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 303.908 bits (777), Expect = 5.479e-92
Identity = 150/305 (49.18%), Postives = 200/305 (65.57%), Query Frame = 3
Query:  207 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKS----TSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDS 1109
            + +K+ I IQ+WYR Y A LE RR+ +W I+QSIEY+GEQDQL+L +FF  +++   Q N +   L +  L+      T   R  +YE  I +   YSGP + FPL++T   +L++AF  EQ LHG Y+ +LL +T+  LK  PN+     S  K ITICGDLHG+L DL+ IF +N  P   NPY+FNGDF+DRGK S EI +ILF+F++LYP  + LNRGNHED IMNLRYGF +EV  KYK H   I+ L  D+F  LP+AT+I NK+ I HGGIS++  L+ L  ++R K  SAL  P  S
Sbjct:   29 LTIKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSVVDPLTEEVRQLKYEQ-IMVPESYSGPRLSFPLSVTDTNALLSAFKEEQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALRLPKRS 332          

HSP 2 Score: 295.819 bits (756), Expect = 5.813e-89
Identity = 141/298 (47.32%), Postives = 197/298 (66.11%), Query Frame = 3
Query: 1098 PSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            P +   ++ EW QV+DILWSDPK Q GC  N FRGGGCYFGPD+T   L+K+   LLIRSHECK  GYE CH  +V+TIFSASNYY+ GSN+GA+VKL   L P+   +   +  +K + +++ +   E SALR L+ K+  +RS+LM+ F   D +N+G I    W  ++ +VL+LDLPWRTLR +LA +   G + Y S FE +S  +        +  ++ +Y+YR  LE +F I+D D+SG+ISI+EF++  K+  SH    +  + ++D+ARSID NKDGSID  EFLEAFR+
Sbjct:  423 PPELPREELEWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRK-LTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLGTDGNVEYESCFEDISPGEPIPPVTPNL--AETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGVAVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRV 717          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 303.138 bits (775), Expect = 7.276e-92
Identity = 150/303 (49.50%), Postives = 199/303 (65.68%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKS----TSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDS 1109
            +K+ I IQ+WYR Y A LE RR+ +W I+QSIEY+GEQDQL+L +FF  +++   Q N +   L +  L+      T   R  +YE  I +   YSGP + FPL++T   +L++AF  EQ LHG Y+ +LL +T+  LK  PN+     S  K ITICGDLHG+L DL+ IF +N  P   NPY+FNGDF+DRGK S EI +ILF+F++LYP  + LNRGNHED IMNLRYGF +EV  KYK H   I+ L  D+F  LP+AT+I NK+ I HGGIS++  L+ L  ++R K  SAL  P  S
Sbjct:   20 IKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSVVDPLTEEVRQLKYEQ-IMVPESYSGPRLSFPLSVTDTNALLSAFKEEQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALRLPKRS 321          

HSP 2 Score: 295.819 bits (756), Expect = 4.616e-89
Identity = 141/298 (47.32%), Postives = 198/298 (66.44%), Query Frame = 3
Query: 1098 PSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            P +   ++ EW QV+DILWSDPK Q GC  N FRGGGCYFGPD+T   L+K+   LLIRSHECK  GYE CH  +V+TIFSASNYY+ GSN+GA+VKL   L P+   +   +  +K + +++ +   E SALR L+ K+  +RS+LM+ F   D +N+G I    W  ++ +VL+LDLPWRTLR +LA +   G + Y S FE +S  +         ++++ +Y+YR  LE +F I+D D+SG+ISI+EF++  K+  SH    +  + ++D+ARSID NKDGSID  EFLEAFR+
Sbjct:  412 PPELPREELEWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRK-LTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLGTDGNVEYESCFEDISPGEPIPPVTP--NLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGVAVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRV 706          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 303.138 bits (775), Expect = 7.276e-92
Identity = 150/303 (49.50%), Postives = 199/303 (65.68%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKS----TSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDS 1109
            +K+ I IQ+WYR Y A LE RR+ +W I+QSIEY+GEQDQL+L +FF  +++   Q N +   L +  L+      T   R  +YE  I +   YSGP + FPL++T   +L++AF  EQ LHG Y+ +LL +T+  LK  PN+     S  K ITICGDLHG+L DL+ IF +N  P   NPY+FNGDF+DRGK S EI +ILF+F++LYP  + LNRGNHED IMNLRYGF +EV  KYK H   I+ L  D+F  LP+AT+I NK+ I HGGIS++  L+ L  ++R K  SAL  P  S
Sbjct:   20 IKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSVVDPLTEEVRQLKYEQ-IMVPESYSGPRLSFPLSVTDTNALLSAFKEEQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALRLPKRS 321          

HSP 2 Score: 295.819 bits (756), Expect = 4.616e-89
Identity = 141/298 (47.32%), Postives = 198/298 (66.44%), Query Frame = 3
Query: 1098 PSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            P +   ++ EW QV+DILWSDPK Q GC  N FRGGGCYFGPD+T   L+K+   LLIRSHECK  GYE CH  +V+TIFSASNYY+ GSN+GA+VKL   L P+   +   +  +K + +++ +   E SALR L+ K+  +RS+LM+ F   D +N+G I    W  ++ +VL+LDLPWRTLR +LA +   G + Y S FE +S  +         ++++ +Y+YR  LE +F I+D D+SG+ISI+EF++  K+  SH    +  + ++D+ARSID NKDGSID  EFLEAFR+
Sbjct:  412 PPELPREELEWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRK-LTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLGTDGNVEYESCFEDISPGEPIPPVTP--NLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGVAVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRV 706          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: CU695117.1 (protein phosphatase with EF-hand domain 2a [Source:NCBI gene;Acc:100537120])

HSP 1 Score: 271.166 bits (692), Expect = 1.182e-79
Identity = 130/289 (44.98%), Postives = 190/289 (65.74%), Query Frame = 3
Query: 1125 EWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            EW Q+LD+LWSDP  Q GC  N  RGGGCY+GP+IT  FL ++  +L+IRSHECK  GYE+CH  +V+T+FSASNYY+ GSN+GAFV+L   L P  I + A     + +   + +   E +AL+ LR K+  ++S L+S F   D +N+GLI    W   +  VL LDLPWR L  QL   T +G +NY   F  L+ +    + + + S+ + +Y++R TLET+FRI+D+DNSG IS ++F++  K+L ++ K  ++ E + +L  S+D N DGSID++EF+EAFR+
Sbjct:  387 EWKQILDLLWSDPMSQDGCVPNEVRGGGCYWGPNITEDFLNRHNLQLIIRSHECKQDGYEFCHNRKVVTLFSASNYYEIGSNRGAFVRLGPDLMPYFIQYQATS-MTRGLSFPQNVKRTEHTALKVLREKLFAHKSDLLSAFQELDKENTGLISLSDWARAVERVLHLDLPWRILHPQLVSSTTNGMLNYHGWFCDLA-LKKPNSEVIEQSMLETLYRHRSTLETIFRIVDTDNSGLISFEDFRQTLKLLSAYLKMEISDEVINELVVSMDTNNDGSIDIDEFMEAFRL 673          

HSP 2 Score: 268.085 bits (684), Expect = 1.809e-78
Identity = 131/284 (46.13%), Postives = 182/284 (64.08%), Query Frame = 3
Query:  264 LEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYE-----NDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            +E RR+ +W I+QS+EY+  QDQ+KL+NF   L++       SS+      + +   + R +E+E      +I +   YSGP + FPL +     L+ AF N+Q LH  Y+ +LL++T  +L+  PNI+       K ITICGDLHGQL+DL+ IF +N  P    PYVFNGD++DRGK S+E+ +ILF+FL++YPG V+LNRGNHED I+NLRYGF KEV  KYK H   I+ L   IF WLPL T+I  ++ I HGGIS+   L  +  +DR +Y+SAL  P
Sbjct:    1 MEMRRRYTWNIFQSMEYADLQDQIKLYNFLGYLVDNFTPS--SSERNLISHIFRENEVCRDAEWERYFNYTNIDVPDIYSGPRLTFPLDMDQAADLVEAFKNKQQLHSRYVLQLLLETWKLLRVLPNINRVSTCHSKEITICGDLHGQLEDLLLIFYKNGMPSMEKPYVFNGDYVDRGKDSMEVLLILFAFLLVYPGDVYLNRGNHEDHIINLRYGFTKEVLGKYKLHGKRILKLLQKIFSWLPLVTVIDQRVLIVHGGISDSTNLALIARVDRHRYVSALRPP 282          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 259.61 bits (662), Expect = 6.678e-78
Identity = 141/337 (41.84%), Postives = 205/337 (60.83%), Query Frame = 3
Query:  432 SIKRSSEYENDIPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            S+  S + EN + +E DY+GP ++   +TL  +  L++ F +++ LH    +++LVQ + +L   P++ E  L   + ITICGD HGQ  DL+ IFE N  P P+NPY+FNGDF+DRG  SVE+ + LF F +LYP    L RGNHE   MN  YGF  EV+ KY   ++ +  LF+++F+WLPLA  I++K+ + HGG+   + + L+ ++ IDR++       P DS         + D+LWSDP+ Q G R    RG  C FGPD+T +FLE+ K   ++RSHE K  GYE  H  + +T+FSA NY D   NKGA++ L  S L+P+   F A
Sbjct:  150 SVVDSLDIEN-MTIEDDYAGPKLEDGKVTLKFMEDLMDWFKDQKKLHRKCAYQILVQVKEVLTKLPSLVEITLKESEKITICGDTHGQYYDLLNIFELNSLPSPTNPYLFNGDFVDRGSFSVEVILTLFGFKLLYPEHFHLLRGNHETDNMNQMYGFEGEVKAKY---SSQMFKLFSEVFQWLPLAQCINDKVLVMHGGLFSEDGVTLDDIRKIDRNRQ------PPDSG-------PMCDLLWSDPQLQNG-RSISKRGVSCQFGPDVTERFLEQNKLEYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQFTA 468          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: usp43 (ubiquitin specific peptidase 43 [Source:Xenbase;Acc:XB-GENE-940625])

HSP 1 Score: 482.256 bits (1240), Expect = 6.232e-161
Identity = 268/642 (41.74%), Postives = 374/642 (58.26%), Query Frame = 3
Query:  207 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNL-RYGFIKEVQTKYKAHANSI-----INLFADIFRWLPLATIISNKI-------------------FICHGGISNRI--QLETLKNIDRSKYISALNCPSDSELD-------------------QAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLS-RMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            + +K+ I IQ+WYR Y ARLE RR+ +  I+QSIEY+ EQ QL+L NFF  +M+           L +   N S    +  +YE  I +   Y GP I FPLT++   +L+ AF   Q LH  Y+ +L  +T+  LK  PNI     S  K ITICGDLHG+L DL+ IF +N  P   N Y+FNGD +DRGK+S+EI V+LF+FL++YP  V +NRGNHED IMNL R      V +K       I     ++  + I R+   + + + K                     +  G   NR    + T  NI +++       P   E++                   + EW QV+DILWSDP+ Q GC  N FRGGGCYFGP++T + L KY F++LIRSHECK  GYE CH  +V+TIFSASNYYD GSN+GA++KL+  L P+ + +   K  +K + +++ + A+E++ALR LR KI  +RS+L++ F  CD   +G I    W + + AVL LDLPWRTLR +L  +T  G+++Y S+FE L      K+   N +   + IY+Y+  LE +F I+D D+SG IS++EF++  K+  SH   N+   A++DLA SID NKDGSID NEFLEAFR+
Sbjct:   17 LAIKAAILIQRWYRFYTARLEMRRRYTLNIFQSIEYAEEQAQLQLSNFFTFMMDHFAHWKGQGPDLISDISN-SKEGHKFIDYEK-IEVPNSYGGPRITFPLTVSDTNALLRAFKQGQQLHARYVLQLFHETKKFLKQLPNIVHLSTSYSKEITICGDLHGKLDDLLLIFYKNGLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMNLSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYKSALRTPKTDSEKCTSRDKMLDGKNKKSSVDVGANQNRANKHMTTSSNISQNRSQQGFRSPGILEINYMDSRIQLPDKMPELPDSIRKEWKQVVDILWSDPRNQNGCTPNSFRGGGCYFGPNVTKKLLAKYNFKMLIRSHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRFVPYQVSKCTRK-LTLHQRVSAVEDTALRALREKIYAHRSELINAFKLCDPKETGKISISEWASAVEAVLHLDLPWRTLRPRLIKLTSDGSVDYLSSFEDLQIEQPIKEVQPNLV---ETIYRYKADLEIIFNIIDKDHSGLISVEEFRQTWKLFSSHLHINIDDSAIDDLAHSIDTNKDGSIDFNEFLEAFRV 652          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: PPEF2 (protein phosphatase, EF-hand calcium binding domain 2 [Source:NCBI gene;Acc:100496073])

HSP 1 Score: 297.36 bits (760), Expect = 1.509e-89
Identity = 144/296 (48.65%), Postives = 199/296 (67.23%), Query Frame = 3
Query: 1104 DSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            + ++D  E  Q++DILWSDP PQ GC+ N  RGGGCYFGPD+T + L+K+  ++LIRSHECK  GYE+CH  +VLTIFSASNYY+ GSNKGAFVKL   L P  + + A +    ++ + + +  +EESALR LR K+  ++S LM+ F   D + +G I    W  ++ +VL L LPWR LR QL   +P G + Y   F+ LS     Q H++  S+ + +Y+ R  LET+FRI+DSD+SG IS +EF+   K+L SH    ++ EA+  +ARSID NKDG+ID+NEFLEAFR+
Sbjct:  400 ECDIDDEEKKQIVDILWSDPIPQDGCKSNTVRGGGCYFGPDVTEKILQKHGLQMLIRSHECKQEGYEFCHSGKVLTIFSASNYYEVGSNKGAFVKLGPDLVPHFVQYQASR-LTNNLTLRQRVSTVEESALRALREKLFAHKSDLMNAFRNYDNNQTGYINLSDWAIVLESVLNLGLPWRMLRPQLIHSSPEGLLRYREWFDELSVCQPIQEHLHD-SLLEALYRNRSDLETIFRIIDSDSSGLISFEEFQHTWKLLSSHLNIEVSDEAICKMARSIDFNKDGNIDINEFLEAFRL 693          

HSP 2 Score: 281.567 bits (719), Expect = 1.144e-83
Identity = 137/282 (48.58%), Postives = 182/282 (64.54%), Query Frame = 3
Query:  261 RLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDS----LFTKALN-KSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISAL 1091
            ++E RR+C+W I+QSIEY+GEQDQ+KL++FF  LM+     N         +FT+  N K T +++  +YE  I +   Y+GP + FP+  T  T+L+ AF   Q LH  Y+  LL +T+  LK  PNI     S  K ITICGDLHG+L DL  IF +N  P P  PY+FNGDF+DRGK S+EI +ILF+F ++YP  V LNRGNHED I+NLRYGF KEV  KYK H   I+ +   +F WLPLAT+I  K+ + HGG+S+   LE L  I+R K+ S L
Sbjct:    1 QMEVRRRCTWSIFQSIEYTGEQDQIKLYDFFNLLMDHFTPDNSKERDFICRIFTEEENFKDTELEKYCDYET-IEVPESYTGPHLSFPIKPTHATALVEAFKQNQQLHSRYVLHLLHETKKYLKQLPNIKRISTSYGKEITICGDLHGRLDDLFLIFYKNGLPSPEKPYIFNGDFVDRGKQSIEILMILFAFQLVYPKVVHLNRGNHEDYIVNLRYGFTKEVMKKYKVHGKKILKMLQSVFSWLPLATLIDQKVLVTHGGVSDTTDLEILSKIERHKFASTL 281          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 258.84 bits (660), Expect = 3.570e-77
Identity = 134/326 (41.10%), Postives = 197/326 (60.43%), Query Frame = 3
Query:  465 IPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            + +E +Y+GP ++   +T+  +  L+  + +++ LH   ++++LVQ + IL   P++ E  L   + +T+CGD HGQ  DL+ IF  N  P  +NPY+FNGDF+DRG  SVE+ V LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    +  LF+++F+WLPLA  ++ ++ I HGG+   + + L+ +++I+R++       P DS         + D+LWSDP+PQ G R +  RG  C FGPD+T +FLE+     +IRSHE KP GYE  H    +T+FSA NY D   NKGA++ L  S L+PK   F A
Sbjct:  182 MTIEDEYTGPQLKDGNVTIDFMLELMQFYKDQKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSAQ---MFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQ------PPDSG-------PMCDLLWSDPQPQDG-RSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKFHQFEA 490          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 239.965 bits (611), Expect = 4.616e-70
Identity = 128/326 (39.26%), Postives = 192/326 (58.90%), Query Frame = 3
Query:  465 IPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            + +E +Y+GP ++   +T+  +  L+  + +++ LH   ++++LVQ + IL   P++ E  L   + +T+CGD HGQ  DL+ IF  N  P  +NPY+FNGDF+DRG  SVE+ V LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    +  LF+++F+WLPLA  ++ ++ I HGG+   + + L+ +++I+R++       P DS +     L +   ++SD       R +  RG  C FGPD+T +FLE+     +IRSHE KP GYE  H    +T+FSA NY D   NKGA++ L  S L+PK   F A
Sbjct:  182 MTIEDEYTGPQLKDGNVTIDFMLELMQFYKDQKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSAQ---MFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQ------PPDSGVTLVLLLLLSFPIFSD------GRSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKFHQFEA 492          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 227.639 bits (579), Expect = 6.514e-66
Identity = 128/326 (39.26%), Postives = 185/326 (56.75%), Query Frame = 3
Query:  465 IPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            + +E +Y+GP ++   +T+  +  L+  + +++ LH     + + Q R  L                + +CGD HGQ  DL+ IF  N  P  +NPY+FNGDF+DRG  SVE+ V LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    +  LF+++F+WLPLA  ++ ++ I HGG+   + + L+ +++I+R++       P DS         + D+LWSDP+PQ G R +  RG  C FGPD+T +FLE+     +IRSHE KP GYE  H    +T+FSA NY D   NKGA++ L  S L+PK   F A
Sbjct:  165 MTIEDEYTGPQLKDGNVTIDFMLELMQFYKDQKKLHR----KCVYQVRFCLS---------------LYMCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSAQ---MFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQ------PPDSG-------PMCDLLWSDPQPQDG-RSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKFHQFEA 454          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef1 (protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157])

HSP 1 Score: 499.975 bits (1286), Expect = 2.896e-168
Identity = 259/626 (41.37%), Postives = 383/626 (61.18%), Query Frame = 3
Query:  210 MMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALN---KSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-----------------------------SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            ++K+ + IQ WYR Y+ARL  R+  +  I+QSIEYS EQ Q++L +FF  ++    + N    +L T+  +   + + IK   ++   I +   Y GP +QFPLT T I  L+ AF  +QILH HY+ E+L + R +LK  PN S       K ITICGDLHG+L DL+ IF +N  P  +NPYVFNGDF+DRG +S+EI +IL    ++YP  + LNRGNHED +MNLRYGF KE+  KYK H   I+ +  +++ WLP+ TII N+I + HGGIS    L TL  + R+K  S L  P                                +L + EW Q++DILWSDP+ +KGC  N  RGGGCYFGPD+T + L K + ++LIRSHECKP GYE  H  +V+T+FSASNYY+ GSN+GA+++L+    P+   +        + L ++ ++A+E SA + L+ K+++ ++ L++ F   D   SG I    W   M  +L L+LPWR+L + L  +  SG+++Y S+F+ + R++     M K ++++ +Y+YR  L+ +F I+DSD SG IS+DEF+   K+  +H KA++    +++LA  +D NKDG+ID NEFL+AF +
Sbjct:   16 VIKAALVIQNWYRRYRARLRVRQHYALAIFQSIEYSDEQGQMQLSSFFSFMLENYTKTNNEDSALVTRIFDNTRRESQIKDRDDFLGLIEVPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGTMPQFFQYQVTSTSCLNPL-HQRMNAMESSAFKILKEKMISRKTDLINAFELRDHSRSGRISLAEWAFSMENILGLNLPWRSLSSHLVTIDSSGSVDYMSSFDDI-RIEKPTKDM-KSNLTETMYRYRSDLKIIFNIIDSDQSGLISMDEFRTMWKLFNAHYKAHIDDSQIDELASIVDFNKDGNIDFNEFLKAFYV 638          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 306.605 bits (784), Expect = 9.529e-93
Identity = 148/293 (50.51%), Postives = 201/293 (68.60%), Query Frame = 3
Query: 1125 EWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDN 2003
            EW QV+DILWSDP  Q+GC+ N  RGGGCYFGPD+T + +EKYK +LLIRSHECKP GYE+CH  +VLTIFSASNYY+ GSN+GA+VKL  +L P I+ + A K   + + + + I  +EESALR LR K+  + S L+ EF   D D SG+I    W   + +VL L LPWR LR QL   +    + Y S  + L++    + ++   S+ +++Y+ R  LET+FRI+DSD+SG IS+DEF++  K+  SH   ++T + + DLARSID NKDG ID+NEFLEAFR+ E +
Sbjct:  441 EWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKATHR-LTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNSSADNVLEYRSWLDSLAKEQLSRENIQS-SLLEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSIDITDDGICDLARSIDFNKDGHIDINEFLEAFRLVEQS 731          

HSP 2 Score: 291.582 bits (745), Expect = 3.949e-87
Identity = 138/310 (44.52%), Postives = 194/310 (62.58%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSS----DSLFTKA-LNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAE 1127
             K+   IQ+WYR Y ARLE RR+C+W I+QSIEY+G+QDQ+KLH FF  L++     +       + +FT+    +    +   ++E+ I +   Y+GP + FPL     T+L+ AF   Q LH  Y+  LL +TR  L   PNI+       + +T+CGDLHGQL DLI+IF +N  P P   YVFNGDF+DRGK SVE+ ++LF+F+++YP    LNRGNHED ++NLRYGF KEV  KYK H   I+    D+F WLPLAT++  K+ + HGG+S++  LE L  +DR K +S + C +  E +  E
Sbjct:   20 FKAAALIQRWYRRYMARLEMRRRCTWNIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGDFES-IEVPDSYTGPRLSFPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRKESENRE 328          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 306.605 bits (784), Expect = 9.529e-93
Identity = 148/293 (50.51%), Postives = 201/293 (68.60%), Query Frame = 3
Query: 1125 EWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDN 2003
            EW QV+DILWSDP  Q+GC+ N  RGGGCYFGPD+T + +EKYK +LLIRSHECKP GYE+CH  +VLTIFSASNYY+ GSN+GA+VKL  +L P I+ + A K   + + + + I  +EESALR LR K+  + S L+ EF   D D SG+I    W   + +VL L LPWR LR QL   +    + Y S  + L++    + ++   S+ +++Y+ R  LET+FRI+DSD+SG IS+DEF++  K+  SH   ++T + + DLARSID NKDG ID+NEFLEAFR+ E +
Sbjct:  441 EWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKATHR-LTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNSSADNVLEYRSWLDSLAKEQLSRENIQS-SLLEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSIDITDDGICDLARSIDFNKDGHIDINEFLEAFRLVEQS 731          

HSP 2 Score: 291.582 bits (745), Expect = 3.949e-87
Identity = 138/310 (44.52%), Postives = 194/310 (62.58%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSS----DSLFTKA-LNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAE 1127
             K+   IQ+WYR Y ARLE RR+C+W I+QSIEY+G+QDQ+KLH FF  L++     +       + +FT+    +    +   ++E+ I +   Y+GP + FPL     T+L+ AF   Q LH  Y+  LL +TR  L   PNI+       + +T+CGDLHGQL DLI+IF +N  P P   YVFNGDF+DRGK SVE+ ++LF+F+++YP    LNRGNHED ++NLRYGF KEV  KYK H   I+    D+F WLPLAT++  K+ + HGG+S++  LE L  +DR K +S + C +  E +  E
Sbjct:   20 FKAAALIQRWYRRYMARLEMRRRCTWNIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGDFES-IEVPDSYTGPRLSFPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRKESENRE 328          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 247.669 bits (631), Expect = 2.994e-73
Identity = 134/326 (41.10%), Postives = 191/326 (58.59%), Query Frame = 3
Query:  465 IPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            + +E +YSGP ++   +T+T +  L+  + +++ LH    +++LVQ + +L     + ET L   + IT+CGD HGQ  DL+ IFE N  P  +NPY+FNGDF+DRG  SVE+ + LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    +  LF+++F WLPLA  I+ K+ I HGG+   + + L+ ++ I+R++       P DS         + D+LWSDP+PQ G R    RG  C FGPD+T  FLE+ +   +IRSHE K  GYE  H    +T+FSA NY D   NK +++ L  S L P+   F A
Sbjct:  170 MTIEDEYSGPKLEDGKVTITFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQ---MYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQ------PPDSG-------PMCDLLWSDPQPQNG-RSVSKRGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTA 478          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef1 (protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157])

HSP 1 Score: 219.55 bits (558), Expect = 4.652e-66
Identity = 104/211 (49.29%), Postives = 137/211 (64.93%), Query Frame = 3
Query:  423 KSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETL 1055
            + + IK   ++   I +   Y GP +QFPLT T I  L+ AF  +QILH HY+ E+L + R +LK  PN S       K ITICGDLHG+L DL+ IF +N  P  +NPYVFNGDF+DRG +S+EI +IL    ++YP  + LNRGNHED +MNLRYGF KE+  KYK H   I+ +  +++ WLP+ TII N+I + HGGIS    L TL
Sbjct:   25 RESQIKDRDDFLGLIEVPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTL 235          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|G5EBX9|PPE_CAEEL (Serine/threonine-protein phosphatase with EF-hands pef-1 OS=Caenorhabditis elegans OX=6239 GN=pef-1 PE=1 SV=1)

HSP 1 Score: 529.635 bits (1363), Expect = 3.313e-178
Identity = 263/623 (42.22%), Postives = 388/623 (62.28%), Query Frame = 3
Query:  207 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQN-------------LSSDSLFTKAL---NKSTSIKRSSE--YENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP---------SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVK-LTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            + +KS I IQKWYR  +ARLEARR+ +W I+ ++EY+GEQDQLKL++FF D++  M ++N             +S+ S + K     ++  ++K+  E     ++ ++ +Y GP +  PL    +  +I AF   ++LH  Y+  +L + R I K  P++S    SI   +TICGDLHG+  DL  I  +N YP   NPY+FNGDF+DRG  S+E+  +LF+ +I+ P  ++LNRGNHED IMNLRYGFIKE+ TKYK  +  I  L  D+F WLP+ATII   IF+ HGGIS++ ++  L  I R ++ S L  P          +S ++  EW Q+LDI+WSDPK  KGC  N+FRGGG YFG DIT  FLEK+ FRLL+RSHECK  GYE+ H +  LT+FSASNYY+TGSN+GA+VK + KS +P  + + A K  +K  L  E +  +EESA++EL+ K+ +  + L  EF   D + SG +    W + +  +  L+LPW  L  ++A ++  G          ++++     H  +  + + +Y+++ TLET+FR +D DNSG++S+ EF + C++L  ++K  +  + +  +A SID NKDG IDLNE LEAFR+
Sbjct:   81 LTIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALSHYAKPSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTL-RERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGG--THAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACEVLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 700          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O14829|PPE1_HUMAN (Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens OX=9606 GN=PPEF1 PE=1 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 5.167e-171
Identity = 255/626 (40.73%), Postives = 374/626 (59.74%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELD-------------------------------QAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKE--FQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            +++ + IQ WYRGY+ARL+AR+  +  I+QSIEY+ EQ Q++L  FF  ++      +     L  ++L     ++   +Y + I +   Y+GP +QFPLT T I  L+ AF  +QILH HY+ E+L +T+ +LK  PN +    S  K +TICGDLHG+L DL  IF +N  P   NPYVFNGDF+DRGK+S+EI +IL    ++YP  + LNRGNHED +MNLRYGF KE+  KYK H   I+ +  + + WLP+ TI+ N+I + HGGIS    L  L  ++R+K  S L  P+++  D                               + EW Q++DILWSDP+ + GC  N  RGGGCYFGPD+T + L KY+ ++LIRSHECKP GYE CH  +V+TIFSASNYY+ GSN+GA++KL     P+   +   K   FQ    + + +  +E SA++ LR ++++ +S L   F   D   SG +    W   M  +L L+LPWR+L + L  +  +G + Y S+F+ + R++      +   V + +Y+YR  LE +F  +D+D+SG IS++EF+   K+  SH   ++    +  LA  +D+NKDGSID NEFL+AF +
Sbjct:   17 LRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQP---LRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNI-RIEKPVQEAHSTLV-ETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYV 637          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|Q3SWT6|PPE1_RAT (Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus OX=10116 GN=Ppef1 PE=2 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 2.797e-169
Identity = 251/615 (40.81%), Postives = 374/615 (60.81%), Query Frame = 3
Query:  210 MMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKAL-NKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP--------------------SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            ++++ + IQ WYR Y+ARL AR+  +  I+QSIEY+ EQ Q++L +FF  ++      +    +L ++   N     K   EY   I +   Y GP +QFPLT T I  L+ AF  +Q LH HY+ E+L + R ILK  PN +       K ITICGDLHG+L DL+ IF +N  P   NPYVFNGDF+DRG +S+EI +IL    ++YP  + LNRGNHED +MNLRYGF KE+  KYK H   I+ +  +++ WLP+ TII N+I + HGGIS    L  L+ + R+K  S L  P                    +  +L + EW Q++D+LWSDP+ +KGC  N  RGGGCYFGPD+T + L K + +++IRSHECKP GYE CH  +V+T+FSASNYY+ GSN+GA+++L+    P+   +        + L  + ++A+E SA R L+ +++  ++ L++ F   D   +G I    W   M ++L L+LPWR+L + L     SG+++Y S+F+ +  ++     M K  + + +Y+YR  L+ +F I+D+D SG IS+DEF+   K+  +H K ++    +++LA ++D NKDG+ID NEFL AF +
Sbjct:   16 VVRAALIIQNWYRRYRARLSARQHYALAIFQSIEYADEQGQMQLSSFFSFMLENYTNTHKEDSALVSRLFENTRLESKDREEYVGLIDVPDSYDGPRLQFPLTFTDINLLLQAFKQQQTLHAHYVLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGKKILQVLEELYTWLPIGTIIDNEILVIHGGISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKKNKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMVIRSHECKPDGYEICHDGKVITVFSASNYYEEGSNRGAYIRLSYGTSPQFFQYQVTSTSCLNPLY-QRVNAMEFSAFRILKERMIARKTDLINAFELRDHSRTGKISLAQWAFSMESILGLNLPWRSLSSHLVSTDSSGSVDYMSSFDDI-HIEKPMKDM-KSDLIETMYRYRSDLKIIFNIIDTDQSGLISMDEFRTMWKLFNAHYKVHIDDSQIDELASTMDSNKDGNIDFNEFLRAFYV 627          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|P40421|RDGC_DROME (Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster OX=7227 GN=rdgC PE=2 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 8.951e-168
Identity = 248/604 (41.06%), Postives = 376/604 (62.25%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----GQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLE-TDYSGPIIQFPLTLTVITSLINAFNNEQ--ILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-SDSE-LDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            +++ I IQKWYR +QAR E +R+C+W I+Q++EY+ EQDQ +L+ FF DL+  M    G++N    S     L+           ++D+  E  D     I+ P+    I  LI+ F  ++   LH  Y+  +L +    LK  PNIS    ++ + +T+CGDLHG+L DL+ +  +N  P  SNPYVFNGDF+DRGK  +E+ ++L S  + +P  VFLNRGNHED +MN RYGFI+EV++KY  +   I+    +++RWLPL +++++++ I HGG S+   L+ +K+IDR KY+S L  P +D E LD+ EW Q+ DI+WSDP+   GC  N  RG G +FGPD+T  FL++++   +IRSHECKP G+E+ H ++++TIFSASNYY  GSNKGA+++L   L P  + + +     K +   + +  +E SAL+EL  ++  +R +L  EF   D  +SG I   HWC +M  V +L LPWR LR++LA  T S  +NY+ T +LL      +   + +SV D +Y  + +L  +F I+D+DNSG I++DEF+    +L +H     +   M +  R +D+N DG +DLNEFLEAFR+++
Sbjct:    6 IRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD----------KDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANKASLVAIFNIIDADNSGEITLDEFETAIDLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRLSD 599          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O35655|PPE1_MOUSE (Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus OX=10090 GN=Ppef1 PE=2 SV=2)

HSP 1 Score: 499.975 bits (1286), Expect = 2.026e-167
Identity = 259/626 (41.37%), Postives = 383/626 (61.18%), Query Frame = 3
Query:  210 MMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALN---KSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-----------------------------SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            ++K+ + IQ WYR Y+ARL  R+  +  I+QSIEYS EQ Q++L +FF  ++    + N    +L T+  +   + + IK   ++   I +   Y GP +QFPLT T I  L+ AF  +QILH HY+ E+L + R +LK  PN S       K ITICGDLHG+L DL+ IF +N  P  +NPYVFNGDF+DRG +S+EI +IL    ++YP  + LNRGNHED +MNLRYGF KE+  KYK H   I+ +  +++ WLP+ TII N+I + HGGIS    L TL  + R+K  S L  P                                +L + EW Q++DILWSDP+ +KGC  N  RGGGCYFGPD+T + L K + ++LIRSHECKP GYE  H  +V+T+FSASNYY+ GSN+GA+++L+    P+   +        + L ++ ++A+E SA + L+ K+++ ++ L++ F   D   SG I    W   M  +L L+LPWR+L + L  +  SG+++Y S+F+ + R++     M K ++++ +Y+YR  L+ +F I+DSD SG IS+DEF+   K+  +H KA++    +++LA  +D NKDG+ID NEFL+AF +
Sbjct:   16 VIKAALVIQNWYRRYRARLRVRQHYALAIFQSIEYSDEQGQMQLSSFFSFMLENYTKTNNEDSALVTRIFDNTRRESQIKDRDDFLGLIEVPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGTMPQFFQYQVTSTSCLNPL-HQRMNAMESSAFKILKEKMISRKTDLINAFELRDHSRSGRISLAEWAFSMENILGLNLPWRSLSSHLVTIDSSGSVDYMSSFDDI-RIEKPTKDM-KSNLTETMYRYRSDLKIIFNIIDSDQSGLISMDEFRTMWKLFNAHYKAHIDDSQIDELASIVDFNKDGNIDFNEFLKAFYV 638          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8HDQ7 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 297/639 (46.48%), Postives = 427/639 (66.82%), Query Frame = 3
Query:  177 EDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLS-------SDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKH--------------------ITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP----SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLS---RMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            +D E      + ++S + IQKWYR Y+ARLEARR+ SWMIYQSIEYS E  QL L+NFF D++ L G            ++ L  +++ +           ++I +E +Y GP + FPL+ T +  +I++F    +LH  YL +LL +TR +LKT+ NI     SI K                     +T+ GDLHG+L+DL+ +  +N  PD +NPY+FNGDF+DRG +SVEI  ILF+  +++P  VFLNRGNHED++MNLRYGFIKEVQ KY+  AN ++N+F+++F W+PLAT+I +++F+ HGGIS+++ L+ ++ +DR +Y+S L  P    SD ++D  EW QVLD+LWSDPK Q GC+ N FRGGGCYFGP++T  FL+KY ++LL+RSHECK  G+E+CH+D VLT+FSASNYY+ GSNKGA+VK      P+++ F A +  +  +   + + ++EESALR+LR KIL N+S+L+  FL  D + +G I    WC+ M   L+L+LPWRTLR  LA +   G + Y STF+  +   R+   +   N  SV++ +YK ++ LET+FRI+D DNSG+IS++EFKE C+IL   ++  MT + + D+A+S+D+N DG ID NEFLEAFRI
Sbjct:   49 DDMEAEAKNEVSLQSAVLIQKWYRRYKARLEARRQTSWMIYQSIEYSSESSQLHLYNFFNDMLRLGGGSVGGASANAGFAERLRQRSIEEEDEELLEHTGYSEITVERNYKGPKLSFPLSATHVQLMIDSFRQGGLLHARYLLQLLHETRSVLKTRQNIQLVSSSISKQLDSVIKKLSLNANFHAPILKVTVVGDLHGKLEDLLIVLYKNGLPDVTNPYIFNGDFVDRGPNSVEILAILFACQLVWPSAVFLNRGNHEDQVMNLRYGFIKEVQYKYRQTANKVLNMFSEVFAWMPLATVIDDRVFVTHGGISDKVDLDRVRRLDRHRYVSVLRPPVAKSSDEKVDYMEWRQVLDLLWSDPKAQPGCKPNTFRGGGCYFGPNVTRAFLDKYGYKLLVRSHECKQDGWEFCHEDTVLTVFSASNYYEEGSNKGAYVKFDSECRPRLVQFVASR--RDKLPKGQRLSSVEESALRDLRGKILANKSELIDAFLRLDPEKTGAIRVSQWCSTMEEQLRLELPWRTLRPHLAQLNKDGRLLYMSTFQRAAIQHRLSGGKEMAN--SVTETVYKNKEELETIFRIMDKDNSGQISLEEFKESCRILCQATQRQMTEDEVADMAKSLDLNSDGYIDFNEFLEAFRI 683          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8GHE3 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 295/629 (46.90%), Postives = 425/629 (67.57%), Query Frame = 3
Query:  207 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLS-------SDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKH--------------------ITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP----SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLS---RMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            + ++S + IQKWYR Y+ARLEARR+ SWMIYQSIEYS E  QL L+NFF D++ L G            ++ L  K++ +           +++ +E +Y GP + FPL+ T +  +I++F    +LH  YL +LL +TR +LKT+ NI     SI K                     +T+ GDLHG+L+DL+ +  +N  PD +NPY+FNGDF+DRG +SVEI  ILF+  +++P  VFLNRGNHED++MNLRYGFIKEVQ KY+  AN ++N+F+++F W+PLAT+I +++F+ HGGIS+++ L+ ++ +DR +Y+S L  P    SD ++D  EW QVLD+LWSDPK Q+GC+ N FRGGGCYFGP++T  FL+KY ++LL+RSHECK  G+E+CH+D VLT+FSASNYY+ GSNKGA+VK      P+++ F A +  +  +   + + ++EESALR+LR KIL ++S+L+  FL  D + +G I    WC+ M   L+L+LPWRTLR  LA +   G + Y STF+  +   R+   +   N  SV++ +YK R+ LET+FRI+D DNSG+IS++EFKE C+IL   ++  MT + + D+A+S+D+N DG ID NEFLEAFRI
Sbjct:   59 VSLQSAVLIQKWYRRYKARLEARRQTSWMIYQSIEYSSESSQLHLYNFFNDMLRLGGGGVGGASANAGFAERLRQKSIEEEDEELLEHTGYSEMTVERNYKGPKLSFPLSATHVQLMIDSFRQGGLLHARYLLQLLHETRSVLKTRQNIQLVSSSISKQLDLVIKMLSLNANFHAPILKVTVVGDLHGKLEDLLIVLYKNGLPDVTNPYIFNGDFVDRGPNSVEILAILFACQLVWPSAVFLNRGNHEDQVMNLRYGFIKEVQYKYRQTANKLLNMFSEVFAWMPLATVIDDRVFVTHGGISDKVDLDRVRRLDRHRYVSVLRPPVAKSSDEKVDYMEWRQVLDLLWSDPKAQQGCKPNTFRGGGCYFGPNVTRAFLDKYGYKLLVRSHECKQDGWEFCHEDTVLTVFSASNYYEEGSNKGAYVKFDSECRPRLVQFVASR--RDKLPKGQRLSSVEESALRDLRGKILASKSELIDAFLRLDPEKTGAIRVSQWCSTMEEKLRLELPWRTLRPHLAQLNKDGRLLYMSTFQRAAIQHRLSGGKEMAN--SVTETVYKNREELETIFRIMDKDNSGQISLEEFKESCRILCQATQRQMTEDEVADMAKSLDLNSDGYIDFNEFLEAFRI 683          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A267DFW7 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022204g1 PE=3 SV=1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 301/633 (47.55%), Postives = 415/633 (65.56%), Query Frame = 3
Query:  177 EDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----------------GQQNLSSDSLFTKALNKSTSIKRS-----SEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-SDSE---LDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLS---RMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            +D  D   + + +KS + IQKWYR Y+ARLEARR+ +WMIYQSIEYS E  QL L+NFF D+M L                 G  + +++    +   KS   +       + YE  I +E  Y GP + FPL+ + +  LI++F     LH  YL +LL + R +LKTKPN+ +   SI + +T+ GDLHG+L DL+ IF +N  PD +NPYVFNGDF+DRG +SVE A +LF+ L+++P  VF+NRGNHED +MN RYGFIKEVQ KYK  AN I+ LF D F WLPLAT I +KI + HGGIS+++ +E ++ +DR +Y+SAL  P SD+E   +D  EW QVLD+LWSDPKPQ GC  N FRGGGCYFGP+IT  FL K+KF LL+RSHECKP G+E+CH   VLT+FSASNYY+ GSNKGA+ K     +P I+ + A K   + + +   +  +EE AL++LR K++ ++++L + F   D D +G I    WC  M   L+L LPWRTLR  LA +   G + Y ++F+ +S   ++ +        S+++ +YK ++ LET+FRI+D DNSG+IS+DEF+E C++L   +   MT   + D+ARS+D+N DG ID NEFLEAFRI
Sbjct:   78 KDVTDASVEALSIKSALLIQKWYRRYKARLEARRRTTWMIYQSIEYSSEASQLHLYNFFSDMMQLADGKQPQQPQQQHLSPAGSGDPANNRFAERLRQKSLEEEDQELLELTSYEG-IQVEKSYRGPHLSFPLSASHVQVLIDSFRQGTQLHSRYLLQLLHEARLLLKTKPNVYQASTSISRQVTVVGDLHGKLDDLLVIFYKNGLPDVTNPYVFNGDFVDRGANSVETAALLFACLLVWPSAVFINRGNHEDHLMNCRYGFIKEVQAKYKTPANKIVRLFGDTFSWLPLATNIDDKILVTHGGISDKVDMERVQKLDRHQYLSALKPPVSDNENAKVDYKEWRQVLDLLWSDPKPQAGCAPNTFRGGGCYFGPNITEAFLRKHKFSLLVRSHECKPDGWEFCHGGAVLTLFSASNYYEDGSNKGAYAKFDAEGKPHIVQYMASK--ARKLPVGRRLSTVEEGALKDLRAKVIASKTELTAAFQRFDPDKTGSIRLADWCEAMEQTLRLGLPWRTLRPHLAQLAKDGRLLYMTSFDCVSIQTKLGASAGKEVAGSLTEAVYKNKEELETIFRIMDKDNSGQISLDEFQESCRVLTQATGRQMTEAEVGDMARSMDLNSDGYIDFNEFLEAFRI 707          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A2B4SS40 (Serine/threonine-protein phosphatase with EF-hands OS=Stylophora pistillata OX=50429 GN=Ppef1 PE=3 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 304/637 (47.72%), Postives = 420/637 (65.93%), Query Frame = 3
Query:  120 MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYE--------NDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPS-----DSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            MGC  S   +NG  S +    +E      I ++S I IQKW+R YQAR+EARR+C+W I+QS+EY+GEQDQLKL NFF D++N +   + ++  +  K    S++   S   E        + I +E  Y GP +  PLTL  + ++I  + + ++LH  Y+  +L +TR  LK  PNI      I K ITICGDLHG+L DL  IF +N  P   NPY+FNGD +DRG +SVEIA+ILFSF +LYP  V++NRGNHED IMNLRYGF+KEV  KYK H++ ++ LF DIF WLPLAT+++NKI I HGGISN   L  +  IDR KY+S L  P          D  EW QVLD+LWSDPKP  GC+ N FRGGGCYFGPDIT + L+K+   LL+RSHECK  GYE+ H  +V+TIFSAS+YY+ GSN+GA++K+   + P  + + A K  +KH+ + + I  +EESA+RELR ++  N+  LM+ F   D  N+G +    W + + +VL+LD+PW  LR+QLA V P G + Y S F+    +     H N  S+++ +Y++R  LET+FR++D DNSG +S++EF+E C +L  H+ +N+  +++EDLA+SID++KDG ID NEFLEAFR+
Sbjct:    1 MGCGVS--VENGDDSSVALGKSE------IAIRSAILIQKWFRRYQARIEARRRCTWKIFQSVEYAGEQDQLKLFNFFNDMLNHVADGDNNAVDILRKGSASSSTSTISKTSEKLEMLTDPSKITVEETYKGPHVALPLTLLTVRNIIELYKSHKLLHVKYVLLILRETREKLKVLPNIYRASTRISKQITICGDLHGKLDDLFVIFHKNGLPSAENPYIFNGDLVDRGPYSVEIAIILFSFFLLYPTGVYINRGNHEDHIMNLRYGFVKEVMDKYKEHSSKVMQLFGDIFGWLPLATVVNNKILITHGGISNITDLSFIDKIDRHKYVSILKPPGMDKAHPDTFDLLEWRQVLDLLWSDPKPFPGCKPNTFRGGGCYFGPDITDRILKKHDLELLVRSHECKFEGYEYMHGGKVITIFSASDYYEQGSNRGAYMKIGPDMNPYFVQYQASKA-KKHLTLKQRIGIVEESAIRELRERLYANKIALMAAFEERDKGNTGYLTATQWASAVESVLKLDVPWNMLRHQLAHVLPDGKVEYRSCFD--QYIIETGLHKNGPSITETLYRHRSNLETIFRLMDKDNSGFVSMEEFEECCHLLNEHTNSNIPVDSIEDLAKSIDMDKDGHIDFNEFLEAFRL 626          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8HG20 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 292/619 (47.17%), Postives = 418/619 (67.53%), Query Frame = 3
Query:  237 KWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLS-------SDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKH--------------------ITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP----SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLS---RMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            KWYR Y+ARLEARR+ SWMIYQSIEYS E  QL L+NFF D++ L G            ++ L  +++ +           ++I +E +Y GP + FPL+ T +  +I++F    +LH  YL +LL +TR +LKT+ NI     SI K                     +T+ GDLHG+L+DL+ +  +N  PD +NPY+FNGDF+DRG +SVEI  ILF+  +++P  VFLNRGNHED++MNLRYGFIKEVQ KY+  AN ++N+F+++F W+PLAT+I +++F+ HGGIS+++ L+ ++ +DR +Y+S L  P    SD ++D  EW QVLD+LWSDPK Q+GC+ N FRGGGCYFGP++T  FL+KY ++LL+RSHECK  G+E+CH+D VLT+FSASNYY+ GSNKGA+VK      P+++ F A +  +  +   + + ++EESALR+LR KIL ++S+L+  FL  D + +G I    WC+ M   L+L+LPWRTLR  LA +   G + Y STF+  +   R+   +   N  SV++ +YK R+ LET+FRI+D DNSG+IS++EFKE C+IL   ++  MT + + D+A+S+D+N DG ID NEFLEAFRI
Sbjct:    1 KWYRRYKARLEARRQTSWMIYQSIEYSSESSQLHLYNFFNDMLRLGGGGVGGASANAGFAERLRQRSIEEEDEELLEHTGYSEITVERNYKGPKLSFPLSATHVQLMIDSFRQGGLLHARYLLQLLHETRSVLKTRQNIQLVSSSISKQLDLVIKIFSLNANFHAPILKVTVVGDLHGKLEDLLIVLYKNGLPDVTNPYIFNGDFVDRGPNSVEILAILFACQLVWPSAVFLNRGNHEDQVMNLRYGFIKEVQYKYRQTANKLLNMFSEVFAWMPLATVIDDRVFVTHGGISDKVDLDRVRRLDRHRYVSVLRPPVAKSSDEKVDYMEWRQVLDLLWSDPKAQQGCKPNTFRGGGCYFGPNVTRAFLDKYGYKLLVRSHECKQDGWEFCHEDTVLTVFSASNYYEEGSNKGAYVKFDSECRPRLVQFVASR--RDKLPKGQRLSSVEESALRDLRGKILASKSELIDAFLRLDPEKTGAIRVSQWCSTMEEKLRLELPWRTLRPHLAQLNKDGRLLYMSTFQRAAIQHRLSGGKEMAN--SVTETVYKNREELETIFRIMDKDNSGQISLEEFKESCRILCQATQRQMTEDEVADMAKSLDLNSDGYIDFNEFLEAFRI 615          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 310.842 bits (795), Expect = 1.214e-94
Identity = 161/332 (48.49%), Postives = 215/332 (64.76%), Query Frame = 3
Query:  120 MGCQQS-DLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIK----RSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            MGC  S  ++  G  S +  + +  L S  + MK+ I IQ+WYR Y ARLE RR+ +W I+QSIEY+GEQDQL+L +FF  +++   Q N +   L +  L+ +        R S+YE  +  E+ YSGP + FPL++T    L++AF  +Q LH  Y+ +LL +T+  LK  PN+     S  K ITICGDLHG+L DL+ IF +N  P   NPY+FNGDF+DRGK S+EI +ILF+FL+LYP  + LNRGNHED IMNLRYGF KEV  KYK H   I+ L  D+F  LP+ATII NK+ I HGGIS++  LE L +++R K  SAL  P
Sbjct:    1 MGCGTSVAIENQGRPSEV--DVSARLPSPALTMKAAILIQRWYRRYVARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLNGNGPDLISHLLDSAVDPVVDEVRQSKYEQIVVPES-YSGPRLSFPLSVTDTNVLLSAFKEQQTLHAKYVLQLLHETQKFLKQMPNVIYLSSSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSIEIIIILFAFLLLYPDHMHLNRGNHEDHIMNLRYGFTKEVMQKYKTHGREILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALRLP 329          

HSP 2 Score: 290.812 bits (743), Expect = 3.658e-87
Identity = 141/302 (46.69%), Postives = 198/302 (65.56%), Query Frame = 3
Query: 1086 ALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            AL  P   EL   EW Q++D+LWSDPK Q GC  N FRGGGCYFGPD+T   L+K+   LLIRSHECK  GYE CH  +V+TIFSASNYY+ GSN+GA++KL   L P+   +   +  +K + + + +   E SAL+ L+ K+ T+RS+LM+ F   D +N+G I    W  ++  VL+LDLPWRTLR +L  +   G + Y S FE +S    +       + ++ +Y+YR  LE +F I+D D+SG+ISI+EF++  K+  +H   ++  +A+ D+AR+ID NKDGSID NEFLEAFR+
Sbjct:  421 ALPEPPREEL---EWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYIKLGPELIPRFFQYQVSRSTRK-LTLQQRVSVAESSALKALQEKLFTHRSELMAFFQQYDINNTGRISINEWAQVLDTVLRLDLPWRTLRPRLVRLASDGNVEYESCFENISA--GQPLPQVTPNFAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSAHLGVDVDDQAIVDMARNIDFNKDGSIDFNEFLEAFRV 716          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 308.531 bits (789), Expect = 5.552e-94
Identity = 153/302 (50.66%), Postives = 202/302 (66.89%), Query Frame = 3
Query:  207 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIK----RSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            + MK+ I IQ+WYR Y ARLE RR+ +W I+QSIEY+GEQDQL+L +FF  +++   Q N +   L +  L+ +        R S+YE  +  E+ YSGP + FPL++T    L++AF  +Q LH  Y+ +LL +T+  LK  PN+     S  K ITICGDLHG+L DL+ IF +N  P   NPY+FNGDF+DRGK S+EI +ILF+FL+LYP  + LNRGNHED IMNLRYGF KEV  KYK H   I+ L  D+F  LP+ATII NK+ I HGGIS++  LE L +++R K  SAL  P
Sbjct:   18 VAMKAAILIQRWYRRYVARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLNGNGPDLISHLLDSAVDPVVDEVRQSKYEQIVVPES-YSGPRLSFPLSVTDTNVLLSAFKEQQTLHAKYVLQLLHETQKFLKQMPNVIYLSSSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSIEIIIILFAFLLLYPDHMHLNRGNHEDHIMNLRYGFTKEVMQKYKTHGREILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALRLP 318          

HSP 2 Score: 290.812 bits (743), Expect = 2.768e-87
Identity = 141/302 (46.69%), Postives = 198/302 (65.56%), Query Frame = 3
Query: 1086 ALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            AL  P   EL   EW Q++D+LWSDPK Q GC  N FRGGGCYFGPD+T   L+K+   LLIRSHECK  GYE CH  +V+TIFSASNYY+ GSN+GA++KL   L P+   +   +  +K + + + +   E SAL+ L+ K+ T+RS+LM+ F   D +N+G I    W  ++  VL+LDLPWRTLR +L  +   G + Y S FE +S    +       + ++ +Y+YR  LE +F I+D D+SG+ISI+EF++  K+  +H   ++  +A+ D+AR+ID NKDGSID NEFLEAFR+
Sbjct:  410 ALPEPPREEL---EWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYIKLGPELIPRFFQYQVSRSTRK-LTLQQRVSVAESSALKALQEKLFTHRSELMAFFQQYDINNTGRISINEWAQVLDTVLRLDLPWRTLRPRLVRLASDGNVEYESCFENISA--GQPLPQVTPNFAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSAHLGVDVDDQAIVDMARNIDFNKDGSIDFNEFLEAFRV 705          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ENSAMXT00000016118.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:38271079:38284894:-1 gene:ENSAMXG00000015666.2 transcript:ENSAMXT00000016118.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 307.375 bits (786), Expect = 2.086e-93
Identity = 148/301 (49.17%), Postives = 203/301 (67.44%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYE-----NDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            M++ + IQ+WYR Y ARLE RR+C+W I+QSIEYSGEQDQ+KL+NFF  LM+       SS+      + + + + + +E+E       I +   Y+GP + FPLT+ +IT L+ AF ++Q LH  Y+ +LL +T  +L+  PNI+E      K ITICGDLHGQL+DL+ +F +N  P    PYVFNGDF+DRGK S+EI +ILF+F ++YP  V LNRGNHED I+NLRYGF KEV  KY+ H   I+ L   IF WLPLAT+I  K+ I HGGIS+   L+ +  ++R++Y+SAL  P
Sbjct:    1 MRAALLIQRWYRQYVARLEMRRRCTWNIFQSIEYSGEQDQIKLYNFFGFLMDHFTPA--SSERNLISHIFRESEVFQDAEWEPYFCYKSIDVPDMYTGPHLTFPLTVNIITELVEAFKHKQHLHARYVLQLLGETWRLLRILPNINEVSTFHSKEITICGDLHGQLEDLLLVFYKNGLPSVETPYVFNGDFVDRGKDSIEILLILFAFQLVYPNDVHLNRGNHEDHIVNLRYGFTKEVLGKYRVHGKKILKLLQKIFSWLPLATVIDQKVLILHGGISDTTDLKLIAKLERNRYVSALRPP 299          

HSP 2 Score: 289.656 bits (740), Expect = 6.955e-87
Identity = 139/295 (47.12%), Postives = 193/295 (65.42%), Query Frame = 3
Query: 1110 ELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQL-AVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            E D  EW Q++D+LWSDP  Q GC  N  RGGGCY+GPDIT   L ++  RLLIRSHECK  GYE+CH   VLTIFSASNYY+ GSN+GA+++L   L P ++ + A +   + + + + +   E SALR LR ++  ++S L S +   D +++G+I  +HW      VLQL LPWR LR QL    T  G INY+  F  L+ MD     +    + + +Y++   LET+FRI+D+D+SG IS +EF++  K+L SH K  ++ +A+ DLA SID NKDGSID+NEF+EAFR+
Sbjct:  398 ETDAEEWKQIVDMLWSDPMSQDGCIPNEVRGGGCYWGPDITEDVLNRHNLRLLIRSHECKQDGYEFCHNRRVLTIFSASNYYEVGSNRGAYIRLGPDLNPHVVQYQASRS-TRELTLRQSVGRTERSALRALREQVFAHKSDLTSAYEEFDPEHTGVISMKHWAVATETVLQLGLPWRVLREQLVGDSTQDGIINYNDWFRELALMDPN-TELAHTGLLETMYRHHSNLETIFRIIDTDHSGLISFEEFRQTWKLLSSHLKMEISDKAISDLALSIDFNKDGSIDINEFMEAFRL 690          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 287.345 bits (734), Expect = 2.044e-85
Identity = 137/295 (46.44%), Postives = 199/295 (67.46%), Query Frame = 3
Query: 1119 QAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDN 2003
            Q EW Q+LD+LWSDP    GC  N  RGGGCY+GP++T +FL K+  +L+IRSHECK  GYE+CH  +VLTIFSASNYY+ GSN+GAFV+L   L P  I + A     + + + + +   E SAL+ LR ++  ++S LMS F   D +N+GLI    W + M+ VL LDLPWR LR+QL   T    ++Y + F  L+  +    H+ + ++ D +YK+R TLET+FRI+D+DNSG IS ++F++  K+L ++ K  ++ E++ DL  SID NKDG+ID++EF+E+FR+ + N
Sbjct:  439 QNEWKQILDLLWSDPMIPDGCVPNEVRGGGCYWGPNVTEEFLNKHSMQLIIRSHECKQDGYEFCHNRKVLTIFSASNYYEVGSNRGAFVRLGPDLVPYFIQYQANS-MTREMSVRQSLRRTEHSALKVLREQLFAHKSDLMSAFQQHDKENTGLISLSDWGSAMSQVLHLDLPWRMLRSQLITTTTDDMLDYHNWFRNLAIKEKSYEHIEQ-TLLDTLYKHRSTLETIFRIVDTDNSGFISFEDFRQTWKLLNAYLKMEISEESINDLVVSIDTNKDGNIDIDEFMESFRLVDKN 731          

HSP 2 Score: 272.322 bits (695), Expect = 7.495e-80
Identity = 143/300 (47.67%), Postives = 194/300 (64.67%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM----GQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            +++ + IQ+WYR Y AR+E RR+ +W I+QSIEY+G+QDQ+KL+NF   L++       ++NL S       + +    +R  +Y + I +   YSGP + FPL       L+ AF ++Q LH  Y+ +LL +T  +L+  PNI+       K ITICGDLHGQL+DL+ IF +N  P     YVFNGDF+DRGK S+EI +ILF+FL++YPG V LNRGNHED I+NLRYGF KEV  KYK H   I+ L   IF WLPLAT+I  K+ I HGGIS+   L  +  +DR KY+S+L  P
Sbjct:   33 IRAAVLIQRWYRQYVARMELRRRYTWNIFQSIEYAGQQDQIKLYNFLGYLVDNFTPSSNERNLISHIFRENEVCRDIEWERFFDYRH-IEVPDIYSGPRLTFPLNADQAADLVEAFRSKQQLHSRYVLQLLGETWKLLRVLPNINRISTCHSKEITICGDLHGQLEDLLLIFYKNGMPSMEKAYVFNGDFVDRGKDSIEILLILFAFLLVYPGEVHLNRGNHEDHIINLRYGFTKEVLGKYKMHGKRILKLLQKIFSWLPLATVIDQKVLIVHGGISDTTDLALVARVDRHKYVSSLRPP 331          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:103034548])

HSP 1 Score: 263.077 bits (671), Expect = 2.695e-79
Identity = 145/349 (41.55%), Postives = 210/349 (60.17%), Query Frame = 3
Query:  405 FTKALNKSTSIKRSSEYENDI---PLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            F +A+  S  +KRS     DI    +E +Y+GP ++   +TL  +  +++ F +++ LH    +++LVQ + +L   P++ E  L   + ITICGD HGQ  DL+ IFE N  P P+NPY+FNGDF+DRG  S+E+ + LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    +  LF+++F+WLPLA  I++K+ + HGG+   + + L+ L+ IDR++       P DS         + D+LWSDP+PQ G R    RG  C FGPD+T +FLE+ K + ++RSHE K  GYE  H  + +T+FSA NY D   NKGA++ L  S L+P+   F A
Sbjct:  141 FERAI-ASDELKRSVVDSLDIENMTIEDEYAGPKLEDGKVTLKFMKEMMDWFKDQKKLHRKCAYQMLVQVKEVLSKLPSLVEITLKETEKITICGDTHGQYYDLLNIFELNGLPSPTNPYLFNGDFVDRGSFSMEVILTLFGFKLLYPDHFHLLRGNHETDNMNQMYGFEGEVKAKYTAQ---MFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDLRKIDRNRQ------PPDSG-------PMCDLLWSDPQPQNG-RSISKRGVSCQFGPDVTQRFLEQNKLQYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQFTA 471          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 254.603 bits (649), Expect = 4.139e-77
Identity = 136/330 (41.21%), Postives = 202/330 (61.21%), Query Frame = 3
Query:  459 NDIPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKH--ITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLT-KSLEPKIISFNA 1430
            + + +E DY+GP +    +T+T +  LI  F +++ LH  Y +++L+Q +  L+  P++ E  +   +   IT+CGD+HGQ  DL++IFE N  P  +NPYVFNGDF+DRG  SVE+ ++LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    + + F+++F+WLPLA  I++++ I HGG+   + + L+ ++ IDR++       P DS         + D+LWSDP+PQ G R    RG  C FGPD++  F+E+    L+IRSHE KP GYE  H    +T+FSA NY D   NKG+++ LT  +L+P+   F A
Sbjct:  128 DSMAIEDDYTGPKVDNGQVTITFMKELIEWFKDQKKLHRKYAYQILLQVKQSLQKLPSLVEVTIKDEQGDMITVCGDIHGQYFDLLHIFELNGLPSETNPYVFNGDFVDRGSWSVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKYTAQ---MFDFFSEVFQWLPLAMCINSRVLIMHGGLFSEDGVTLDDIRKIDRNRQ------PPDSG-------PMCDLLWSDPQPQPG-RSVSKRGVSCQFGPDVSRAFMEQNNLELIIRSHE-KPDGYEVAHDGRCVTVFSAPNYCDQMGNKGSYIHLTAPALKPEFHEFAA 439          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 161.77 bits (408), Expect = 1.032e-44
Identity = 112/311 (36.01%), Postives = 166/311 (53.38%), Query Frame = 3
Query:  552 NEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDP-KPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHA 1478
            N Q+  G  +  L +++R I  ++P + E +  +     ICGD+HGQ  DL+ +FE   +P  SN Y+F GD++DRGK S+E   +L ++ I YP   FL RGNHE  I N  YGF  E + +Y      +   F D F  LP+A I+  KIF CHGG+S  +Q +E ++ I R         P+D   DQ     + D+LWSDP K   G  +N  RG    FG ++  +FL K+   L+ R+H+    GYE+  K +++T+FSA NY     N GA + + ++L   + SF   K   K      G++A
Sbjct:    9 NVQLTEGE-IRGLCLKSREIFLSQPILLELEAPL----KICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASI-NRIYGFYDECKRRYNI---KLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMR---------PTDVP-DQG---LLCDLLWSDPDKDTMGWGEND-RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETL---MCSFQILKPADKKKFPYVGLNA 292          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 5.923e-42
Identity = 99/284 (34.86%), Postives = 151/284 (53.17%), Query Frame = 3
Query:  675 GDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDP-KPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSL--EPKIISFNAKKEFQKHILINEGIHAIEESALRELRTK 1514
            GD+HGQ  DL+ +FE   +P  +N Y+F GD++DRGK S+E   +L ++ I YP   FL RGNHE   +N  YGF  E + ++      +   F D F  LP+A I+  KIF CHGG+S  +Q +E ++ I R         P+D   D  +   + D+LWSDP K  +G  +N  RG    FG D+  +FL ++   L+ R+H+    GYE+  K +++T+FSA NY     N G  + + ++L    +I+  + KK   ++  +N G       A   L  K
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNI---KLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMR---------PTDVP-DTGDAGLLCDLLWSDPDKDVQGWGEND-RGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTPPKAAVPLPKK 269          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 137.502 bits (345), Expect = 1.121e-34
Identity = 87/265 (32.83%), Postives = 134/265 (50.57%), Query Frame = 3
Query:  636 ETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDP-------KPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDE------VLTIFSASNYYDTGSNKGAFVK 1388
            +T + I   +T+CGD+HGQ  DL+ +FE    P  +  Y+F GD++DRG  S+E  + L++  ILYP  +FL RGNHE + +   + F +E + KY     ++ +   D F  LPLA +++ +    HGG+S  +  LE ++ +DR K   A                + D+LWSDP       K Q+    N  RG   ++       FL+      +IR+HE +  GY    K +      ++TIFSA NY D  +NK A +K
Sbjct:   59 KTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGSPANTR-YLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKY---TETVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFKEPPAFG-------------PMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLK 306          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 126.716 bits (317), Expect = 2.119e-33
Identity = 81/220 (36.82%), Postives = 120/220 (54.55%), Query Frame = 3
Query:  588 LLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDP-KPQKGCRQNLFRGGGCYFGPDITHQF 1241
            L +++R I  ++P + E +  +     ICGD+HGQ  DL+ +FE   +P  SN Y+F GD++DRGK S+E   +L ++ I YP   FL RGNHE   +N  YGF  E + ++      +   F D F  LP+A I+  KIF CHGG+S  +Q +E ++ I R   +       D+ L       + D+LWSDP K  +G  +N  RG    FG D+  +F
Sbjct:   24 LCIKSREIFLSQPILLELEAPL----KICGDIHGQYTDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNI---KLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDV------PDTGL-------LCDLLWSDPDKDVQGWGEND-RGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPT1 (Protein serine/threonine phosphatase; regulates Hsp90 chaperone by affecting its ATPase and cochaperone binding activities; has similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth [Source:SGD;Acc:S000003355])

HSP 1 Score: 178.718 bits (452), Expect = 5.254e-49
Identity = 108/327 (33.03%), Postives = 167/327 (51.07%), Query Frame = 3
Query:  477 TDYSGPIIQFP----------------LTLTVITSLINA-FNNEQILHGHYLFELLVQTRGILKTKPNISE--TDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISN--RIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLT 1394
             +Y GP ++F                 ++   I+ ++N  F   + L   Y+  ++     + + +P++ E   + +    I++CGD HGQ  D++ +F +     P + Y+FNGDF+DRG  S E+A++ +   IL+P   FLNRGNHE   MN  YGF  E + KY   +  I N+FA  F  LPLAT+I+N   + HGG+ +     L   KNIDR         P D           +++LW+DP+   G   +  RG G  FGPDIT +FL   K R + RSHE +  G ++  K +++T+FSA NY D+  N G  + + 
Sbjct:  163 ANYEGPKLEFEQLYDDKNAFKGAKIKNMSQEFISKMVNDLFLKGKYLPKKYVAAIISHADTLFRQEPSMVELENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMNKIYGFEDECKYKY---SQRIFNMFAQSFESLPLATLINNDYLVMHGGLPSDPSATLSDFKNIDRFA-----QPPRDGAF--------MELLWADPQEANGMGPSQ-RGLGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGGVIHVV 472          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 162.155 bits (409), Expect = 5.659e-45
Identity = 106/296 (35.81%), Postives = 154/296 (52.03%), Query Frame = 3
Query:  588 LLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRI-QLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDP-KPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEG 1469
            L  + R I   +P + E +  I     ICGD+HGQ  DL+ +FE   +P  SN Y+F GD++DRGK S+E   +L ++ I YP   F+ RGNHE   +N  YGF  E + +Y      +   F D F  LP+A II  KIF  HGG+S  +  +E ++ + R   I  +               + D+LWSDP K   G  +N  RG    FGPD+ ++FL+K    L+ R+H+    GYE+  K +++T+FSA NY     N GA + + +SL   + SF   K  QK +    G
Sbjct:   37 LCSKARSIFIKQPILLELEAPI----KICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNI---KLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGL-------------LCDLLWSDPDKDIVGWSEND-RGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESL---LCSFQILKPAQKSLPRQAG 307          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 154.451 bits (389), Expect = 1.345e-41
Identity = 87/257 (33.85%), Postives = 142/257 (55.25%), Query Frame = 3
Query:  663 ITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNA 1430
            +TICGD+HGQ  DL+ +F+    P P   Y+F GD++DRG +SVE    L +  + YP  + + RGNHE + +   YGF  E   KY + AN +  +F D+F + P+  ++ NKIF  HGG+S  I+ ++ +++++R + +     P +  +         D+LWSDP  + G   +  RG G  FG DI+ QF       L+ R+H+    GY W H+  V+TIFSA NY     N+ A +++ ++   + + ++ 
Sbjct:  120 VTICGDVHGQFHDLLELFKIGG-PCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGS-AN-VWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIETIDQVRDLNRIQEV-----PHEGPM--------CDLLWSDPDDRGGWGISP-RGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDP 359          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 154.066 bits (388), Expect = 1.635e-41
Identity = 86/257 (33.46%), Postives = 141/257 (54.86%), Query Frame = 3
Query:  663 ITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNA 1430
            +TICGD+HGQ  DL+ +F+    P P   Y+F GD++DRG +SVE    L +  + YP  + + RGNHE + +   YGF  E   KY + AN +  +F D+F + P+  ++ NKIF  HGG+S  I+ ++ ++ ++R + +     P +  +         D+LWSDP  + G   +  RG G  FG D++ QF       L+ R+H+    GY W H+  V+TIFSA NY     N+ A +++ ++   + + ++ 
Sbjct:  112 VTICGDVHGQFHDLLELFKIGG-PCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGS-AN-VWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEV-----PHEGPM--------CDLLWSDPDDRGGWGISP-RGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDP 351          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 144.821 bits (364), Expect = 6.248e-39
Identity = 92/285 (32.28%), Postives = 151/285 (52.98%), Query Frame = 3
Query:  579 LFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGIS-NRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNA 1430
            +F L + ++ +L  + N+++ D  +    TICGD+HGQL DL+ +FE++   + +  Y+F GDF+DRG +S+E  ++L  + + YP  + L RGNHE + +   YGF  EV  KY    +++     ++F +L L  II+N IF  HGG+S +   ++ ++ IDR + +     P +  +         D+LWSDP+       +  RG G  FG     QFLEK    L+ R+H+    GY+      ++T++SA NY     N  A +K+   L  +   F A
Sbjct:   22 VFRLCLNSQELLMNEGNVTQVDTPV----TICGDIHGQLHDLLTLFEKSGGVEKTR-YIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKYG--NSNVWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRKQEV-----PHEGAM--------CDLLWSDPEDVDTWSLSP-RGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYTIFEA 285          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO47034 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RNB7])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 293/610 (48.03%), Postives = 408/610 (66.89%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM-------GQQNLSSDSLFTKALNKSTSIKRSSEYE-----NDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP-----SDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            ++S + IQ W+R Y+ARLEARR+C+W I+QSIEYSGEQDQLKL NFF D++  +        + N+  D+L       STS K S+  E     +DI +E  Y+G +++ P+TL  + ++I      +++H  Y+  +L + R   +  PN+      I K +TICGDLHG+L DL  IF +N  P P NPY+FNGD +DRG  S+EI +ILF+F ILYP  V++NRGNHED IMNLRYGF+KEV  KYK HA+ II LF DIF WLPLATI++NKIF+ HGGISN   L+ ++ IDR KY+S L  P     + S     EW QVLD+LWSDPKP  GC+ N FRGGGCYFGPD+T Q L K+ F LL+RSHECK  GYE+ H  +V+TIFSASNYY+ GSN+GA++K+   + P  + +   +  +KH+ + + +  +EESA+REL+ K+  N+S LM  F   D  ++G + C  W   + + L LD+PW  LR+QLA V P G ++Y S  E  + ++ K    N  S+++ +Y+ R  LET+FR++D DNSG +S++EF+  C++L  HS+  +  ++++DLARSID++KDG ID NEFLEAFR+
Sbjct:   29 LRSAVLIQNWFRRYRARLEARRRCTWKIFQSIEYSGEQDQLKLFNFFTDMLTHVQPDNTGASRANIIEDTLSRNGSASSTSSKSSTTLEAATDPSDIKVEPTYTGHVVKLPITLMSVRNIIEQCKLNKLVHAKYVLLILREARERFRALPNVIRVTTRIAKQMTICGDLHGKLDDLFMIFHKNGLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHEDHIMNLRYGFVKEVMDKYKDHASKIIRLFEDIFGWLPLATIVNNKIFVAHGGISNITDLDIIERIDRHKYVSVLKPPNIVKDNPSLSSLKEWRQVLDLLWSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRSHECKYEGYEYMHNKKVITIFSASNYYEQGSNRGAYMKIGPDMTPYFVQYQVSRT-KKHLTLKQRVGIVEESAIRELKEKLYANKSALMEAFTKRDEQHTGYLTCSQWAAAIESTLHLDVPWNMLRHQLAYVAPDGKVDYRSCLEQYA-IEGKTKK-NGPSITEALYRNRSNLETIFRLMDKDNSGHVSMEEFQASCRLLNQHSETEIPEDSIQDLARSIDMDKDGYIDFNEFLEAFRL 635          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 168.318 bits (425), Expect = 1.551e-46
Identity = 110/299 (36.79%), Postives = 163/299 (54.52%), Query Frame = 3
Query:  588 LLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDP-KPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHA 1478
            L +++R I  ++P + E +  +     ICGD+HGQ  DL+ +FE   +P  SN Y+F GD++DRGK S+E   +L ++ I YP   FL RGNHE   +N  YGF  E + +Y      +   F D F  LP+A I+  KIF CHGG+S  +Q +E ++ I R         P+D   DQ     + D+LWSDP K  +G  +N  RG    FGPDI  +FL K+   L+ R+H+    GYE+  K +++T+FSA NY     N GA + + ++L   + SF   K   K      G+++
Sbjct:   38 LCLKSREIFLSQPILLELEAPL----KICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNI---KLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQSMEQIRRIMR---------PTDVP-DQG---LLCDLLWSDPDKDVQGWGEND-RGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETL---MCSFQILKPADKKKFPYGGLNS 311          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 162.925 bits (411), Expect = 8.046e-45
Identity = 102/308 (33.12%), Postives = 160/308 (51.95%), Query Frame = 3
Query:  555 EQILHGHYLFELLVQT-----RGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFE-ENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFN-AKKEFQKHI 1454
            EQ++    L E  V+T     + IL  + N+ E    +    T+CGD+HGQ  DL+ +F    + PD +  Y+F GD++DRG +SVE   +L +  + +P  + + RGNHE + +   YGF  E   KY     S+   F D+F +LPL  ++ N+IF  HGG+S  I  L+ ++ +DR + +     P +  +         D+LWSDP  + G   +  RG G  FG DI+  F       L+ R+H+    GY WCH   V+TIFSA NY     N+ A ++L  +L+   + F+ A +  + H+
Sbjct:   16 EQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCPV----TVCGDVHGQFHDLMELFRIGGKSPDTN--YLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGN--ASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQEV-----PHEGPM--------CDLLWSDPDDRGGWGISP-RGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAPRRGEPHV 301          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 155.221 bits (391), Expect = 3.435e-42
Identity = 98/302 (32.45%), Postives = 156/302 (51.66%), Query Frame = 3
Query:  537 INAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKE 1439
            I    N +++    + +L  + R IL  + N+   D      +T+CGD+HGQ  DL  +F+      P   Y+F GDF+DRG +SVE  ++L +  + YP  + L RGNHE + +   YGF  E   KY   + ++    A+IF +L L+ II N++F  HGG+S  I  L+ +++IDR + +     P D  +         D+LWSDP+  +G   +  RG G  FG D+  Q+       L+ R+H+    GY+W   + VLT++SA NY     N  A ++L + L+ +   F A  +
Sbjct:   11 IEKLRNCELITEKEVKQLCAKAREILVEESNVQRVD----SPVTVCGDIHGQFYDLKELFKVGG-DVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYG--SITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQEV-----PHDGPM--------CDLLWSDPEDIQGWGVSP-RGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLKREFTIFEAAPQ 291          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 135.961 bits (341), Expect = 3.794e-34
Identity = 93/303 (30.69%), Postives = 146/303 (48.18%), Query Frame = 3
Query:  540 NAFNNEQILHGHYLFELLVQTRGILKTKPNIS------ETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQ-LETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDP-------KPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDE------VLTIFSASNYYDTGSNKGAFVK 1388
            N      +L  H++ E  V+    LK   + +      +T L +   IT+CGD+HGQ  DL+ +FE    P  +  Y+F GD++DRG  S+E  + L++   LY   +FL RGNHE + +   + F  E + KY   + ++ +   + F  LPLA +++ +    HGG+S  I  L+ +K +DR K   A                + D+LWSDP       K  +    N  RG   ++    T +FL+      +IR+HE +  GY    K +      ++TIFSA NY D  +NK A +K
Sbjct:   16 NGKPRADVLKAHFILEGRVEDEVALKIINDGTAILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTR-YLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKY---SEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPPAFG-------------PMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLK 301          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ppef1 (protein phosphatase with EF-hand domain 1 [Source:NCBI gene;Acc:101174574])

HSP 1 Score: 294.278 bits (752), Expect = 2.493e-88
Identity = 139/306 (45.42%), Postives = 204/306 (66.67%), Query Frame = 3
Query: 1080 ISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKIS--VSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            +S++  PS  + +Q EW Q++DILWSDPK Q+GC  NLFRGGGCYFGPD+T + L ++  ++LIRSHECK  GYE CH  +V+TIFSASNYY+ GSN+GA++KL + L P+   +   +   + + + + I A E SALR L+ K+  +RS+L+  F   D DN+G +    W  ++  VL+LDLPWRTLR  LA +   G++ Y S FE +    +    + K++  +++ +++YR  +E +F I+D D+SG ISI+EF+   ++  +H    +   A++DLARSID NKDGSID  EFLEAFR+
Sbjct:  426 LSSIPLPSPPQHEQ-EWKQIVDILWSDPKTQEGCSPNLFRGGGCYFGPDVTQKLLLQHGLQMLIRSHECKQEGYEICHGGKVITIFSASNYYEEGSNRGAYIKLGRELVPRFYQYQVSR-ITRKLTLTQRIRAAEGSALRALKEKLFAHRSELVGSFQQYDPDNTGTVSVCEWAQVLECVLRLDLPWRTLRPHLARLASDGSVEYQSCFEDMEPGAT----LPKVTPNLAETLFRYRTDIEIIFNIIDKDHSGLISIEEFRHTWRLFSAHLGVAIDDRAIDDLARSIDFNKDGSIDFTEFLEAFRV 725          

HSP 2 Score: 279.256 bits (713), Expect = 1.141e-82
Identity = 152/329 (46.20%), Postives = 207/329 (62.92%), Query Frame = 3
Query:  120 MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTS--IKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            MGC  S   +  +  +   E      S  + +K+ + IQ+WYR Y ARLE RR+ +W I+QSIEY+GEQDQL+L +FF  +++   Q + +   L T+ L+      + R   Y N +P+   Y+GP I FPL ++   +L++AF  +QILH  Y+ +LL + + +LK  PNI+    S  K ITICGDLHG L DL+ IF +N  P    PYVFNGDF+DRGK SVE+ ++LF++ +LYP  + LNRGNHED IMNLRYGF KEV  KYK H   I+ LF D+F  LP+AT+I  K+ I HGGIS++  L  L +I R K  SAL  P
Sbjct:    1 MGCGTSVATETQLKKLETDEAGRT-PSLALTIKAAVLIQRWYRRYMARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLSGNGPDLITQLLDPVVDPWLDREICY-NLVPVPDSYTGPRISFPLGVSDTNTLLSAFKEQQILHARYVLQLLYEAKKLLKQMPNINHLSTSYTKDITICGDLHGHLDDLLLIFYKNGLPSAETPYVFNGDFVDRGKKSVEVVIMLFAYFLLYPDYMHLNRGNHEDPIMNLRYGFTKEVMQKYKIHGREILQLFQDVFSLLPIATVIDGKVLIVHGGISDQTDLNLLSSIKRHKVKSALRFP 327          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000000429.2 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 287.73 bits (735), Expect = 3.136e-86
Identity = 140/308 (45.45%), Postives = 205/308 (66.56%), Query Frame = 3
Query: 1086 ALNCPSDS---ELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPS-GAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            ALN  +DS   +    EW Q+LD+LWSDP  Q GC+ N  RGGGCY+GPDIT  FL ++  +L+IRSHECK  GYE+CH   VLT+FSASNYYD GSN+GA+VK+   LEP +I + A     + +   + I   E SAL+ LR ++  ++S L+  F   D +N+GL+    W   + +V+ L+LPWR LR QL     S G I+Y++ F  L+      +H+ + ++ + +Y++R TLET+FRI+D+DNSG IS+++F++  K+L  + K  +T EA+ DLA +ID N+DGSID++EF+EAFR+ +
Sbjct:  366 ALNVSTDSVRSDNSNEEWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVLTLFSASNYYDVGSNRGAYVKMGPDLEPYVIQYQASS-MTRELTAKQSIGRTERSALKVLREQLFAHKSDLICAFRGFDTENAGLVSLSDWACAVESVMHLNLPWRMLRCQLVTCKGSDGMIDYNAWFHELAIKGPNTDHIEQ-TLLETLYRHRSTLETIFRIVDTDNSGFISMEDFRQTWKLLSVYLKMEITDEAISDLAVTIDSNQDGSIDIDEFMEAFRLTD 671          

HSP 2 Score: 259.996 bits (663), Expect = 4.670e-76
Identity = 139/281 (49.47%), Postives = 183/281 (65.12%), Query Frame = 3
Query:  273 RRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYEN-----DIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            RR+ +W I+QSIEYSGEQ Q+KL+NF   LM+       SS+      + +   I R +E+E      +I +   YSGP + FPLTL     L++AF N++ LH  Y+ +LL++T  +L+  PNI+       K +TICGDLHGQL+DL+ IF +N  P    PYVFNGDF+DRGK S+EI +ILFSFL++YP  V+LNRGNHED I+NLRYGF KEV TKY+ H   I+ L   IF WLPLAT+I  K+ + HGGIS+   L  L  +DR  Y+SAL  P
Sbjct:    2 RRRYTWNIFQSIEYSGEQAQIKLYNFLGYLMDNFTPS--SSERNLISHIFRENDICRDAEWERYFCYKNIEVPEVYSGPHLTFPLTLEQAIGLLDAFRNKKQLHSRYVLQLLLETWRLLRMLPNINRISTCHSKEVTICGDLHGQLEDLLLIFYKNGMPSLEKPYVFNGDFVDRGKDSIEILLILFSFLLIYPSDVYLNRGNHEDHIINLRYGFTKEVLTKYRVHGKRILKLLQKIFSWLPLATVIDQKVLVLHGGISDTTDLAVLAKLDRHSYVSALRPP 280          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000036394.1 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 287.345 bits (734), Expect = 7.386e-86
Identity = 140/308 (45.45%), Postives = 205/308 (66.56%), Query Frame = 3
Query: 1086 ALNCPSDS---ELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPS-GAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINE 1997
            ALN  +DS   +    EW Q+LD+LWSDP  Q GC+ N  RGGGCY+GPDIT  FL ++  +L+IRSHECK  GYE+CH   VLT+FSASNYYD GSN+GA+VK+   LEP +I + A     + +   + I   E SAL+ LR ++  ++S L+  F   D +N+GL+    W   + +V+ L+LPWR LR QL     S G I+Y++ F  L+      +H+ + ++ + +Y++R TLET+FRI+D+DNSG IS+++F++  K+L  + K  +T EA+ DLA +ID N+DGSID++EF+EAFR+ +
Sbjct:  403 ALNVSTDSVRSDNSNEEWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVLTLFSASNYYDVGSNRGAYVKMGPDLEPYVIQYQASS-MTRELTAKQSIGRTERSALKVLREQLFAHKSDLICAFRGFDTENAGLVSLSDWACAVESVMHLNLPWRMLRCQLVTCKGSDGMIDYNAWFHELAIKGPNTDHIEQ-TLLETLYRHRSTLETIFRIVDTDNSGFISMEDFRQTWKLLSVYLKMEITDEAISDLAVTIDSNQDGSIDIDEFMEAFRLTD 708          

HSP 2 Score: 282.722 bits (722), Expect = 5.171e-84
Identity = 148/301 (49.17%), Postives = 197/301 (65.45%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYEN-----DIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            +++ + IQ+WYR Y AR E RR+ +W I+QSIEYSGEQ Q+KL+NF   LM+       SS+      + +   I R +E+E      +I +   YSGP + FPLTL     L++AF N++ LH  Y+ +LL++T  +L+  PNI+       K +TICGDLHGQL+DL+ IF +N  P    PYVFNGDF+DRGK S+EI +ILFSFL++YP  V+LNRGNHED I+NLRYGF KEV TKY+ H   I+ L   IF WLPLAT+I  K+ + HGGIS+   L  L  +DR  Y+SAL  P
Sbjct:   19 IRAAVLIQRWYRQYVARTEMRRRYTWNIFQSIEYSGEQAQIKLYNFLGYLMDNFTPS--SSERNLISHIFRENDICRDAEWERYFCYKNIEVPEVYSGPHLTFPLTLEQAIGLLDAFRNKKQLHSRYVLQLLLETWRLLRMLPNINRISTCHSKEVTICGDLHGQLEDLLLIFYKNGMPSLEKPYVFNGDFVDRGKDSIEILLILFSFLLIYPSDVYLNRGNHEDHIINLRYGFTKEVLTKYRVHGKRILKLLQKIFSWLPLATVIDQKVLVLHGGISDTTDLAVLAKLDRHSYVSALRPP 317          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: PPEF2 (serine/threonine-protein phosphatase with EF-hands 2 [Source:NCBI gene;Acc:101170112])

HSP 1 Score: 286.96 bits (733), Expect = 7.942e-86
Identity = 143/300 (47.67%), Postives = 202/300 (67.33%), Query Frame = 3
Query:  213 MKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMN----LMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCP 1100
            +++ + IQ+WYR Y ARLE RR+C+W I+QSIEY+GEQDQ+KL++FF  LM+       ++NL S       + + T  +R   Y+ DI +   Y+GP + FP+T   ++ L+ AF ++Q LH  Y+ ++L +T  +L+  PNI+   +S  K ITICGDLHGQL+DL+ IF +N  P    PY+FNGDF+DRGK S+EI +ILF FL++YP  + LNRGNHED I+NLRYGF KE+  KY+ H   I+ L   IF WLPLAT+I++K+ + HGGISN   L  +  +DR +Y+S L  P
Sbjct:   26 IRAALLIQRWYRQYVARLEMRRRCTWNIFQSIEYAGEQDQIKLYSFFGFLMDHFTPASSERNLISHIFHENEICRDTEWERYFCYK-DIEVPDSYTGPHLTFPMTFCGVSKLVEAFKHKQQLHARYVLQILGETWRLLRILPNINYVSVSQTKEITICGDLHGQLEDLLLIFYKNGLPSSEKPYIFNGDFVDRGKSSLEILLILFGFLLVYPNDLHLNRGNHEDHIVNLRYGFTKEILGKYRVHGKKILKLLQKIFSWLPLATVINDKVLVVHGGISNSTDLCVVSRVDRHRYVSVLRPP 324          

HSP 2 Score: 280.026 bits (715), Expect = 2.710e-83
Identity = 137/305 (44.92%), Postives = 201/305 (65.90%), Query Frame = 3
Query: 1101 SDSELDQAE--------WLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            SDS+ D AE        W Q++++LWSDP PQ GC  N  RGGGCY+GPD+T + L ++  +LLIRSHECK  GYE+CH   VLTIFSASNYY+ GSN+GA++++   L P +I + A +  ++ + + + +   E SALR LR ++  ++S L+  +   D   +G I  +HW +   +VL+L LPWR LR+QL   T  G ++Y    + LS  + K   ++  S+ + +YK    LET+FRI+D+D+SG IS++EF++  K+L SH K  ++ +A+ DLA SID NKDGSID+NEF+EAFR+
Sbjct:  408 SDSDPDFAEASKANGHDWKQIVNLLWSDPMPQNGCISNEVRGGGCYWGPDVTEEVLGRHNLQLLIRSHECKQDGYEFCHNRRVLTIFSASNYYEVGSNRGAYIRMGADLVPHLIQYQASRTCRE-LTLRQSVGWTERSALRALREQLFVHKSDLIRAYQEFDPHQTGKISMRHWASATESVLKLGLPWRVLRSQLVSRTHYGMVDYQQWIKELSITEPKLE-VSDTSILETMYKNHSNLETIFRIIDTDHSGLISLEEFRQTWKLLSSHLKMEISDKAIADLAHSIDFNKDGSIDINEFMEAFRL 710          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:101158545])

HSP 1 Score: 257.684 bits (657), Expect = 2.852e-77
Identity = 136/326 (41.72%), Postives = 196/326 (60.12%), Query Frame = 3
Query:  465 IPLETDYSGPIIQ-FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS-LEPKIISFNA 1430
            + +E DY+GP ++   +T++ +T ++  F  ++ LH    +++LVQ + +L   P++ E  L     +TICGD HGQ  DL+ IF+ N  P  +NPY+FNGDF+DRG  S+E+ + LF F +LYP    L RGNHE   MN  YGF  EV+ KY A    +  LF+++F+WLPLA  I++K+ + HGG+   + + L+ ++ IDR++       P DS         + D+LWSDP+PQ G R    RG  C FGPD+T  FLEK K   +IRSHE K  GYE  H  + +T+FSA NY D   NKGA++ L  S L+P+   F A
Sbjct:  162 MTIEDDYAGPKLEDGKVTVSFMTDMMEWFKEQKKLHRKCAYQILVQVKDVLSKLPSLVEITLKETDKLTICGDTHGQYYDLLNIFKLNGLPSDANPYLFNGDFVDRGSFSLEVILTLFGFKLLYPDNFHLLRGNHETDNMNQMYGFEGEVKAKYTAQ---MFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDIRKIDRNRQ------PPDSG-------PMCDLLWSDPQPQNG-RSVSKRGVSCQFGPDVTESFLEKNKLDYIIRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQFTA 470          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 1305.04 bits (3376), Expect = 0.000e+0
Identity = 630/630 (100.00%), Postives = 630/630 (100.00%), Query Frame = 3
Query:  120 MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDNYQ 2009
            MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDNYQ
Sbjct:    1 MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDNYQ 630          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 626/630 (99.37%), Postives = 626/630 (99.37%), Query Frame = 3
Query:  120 MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDNYQ 2009
            MGCQQSDLKKNGIASVLLREDNEDLK    MMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDNYQ
Sbjct:    1 MGCQQSDLKKNGIASVLLREDNEDLK----MMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRINEDNYQ 626          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 330/641 (51.48%), Postives = 449/641 (70.05%), Query Frame = 3
Query:  120 MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM--GQQNLSSDSLFTKALNKSTSIKRSSEYEND------------IPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSD---SELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            MGC QS+  K+         + +++ +    +K+ I IQ WYR Y+A+LEA+R+ +WMIYQSIEYSGEQDQLKL +FF DL++L   GQ+    DS   +AL+K+  +K +    ++            I +E  Y G  + FPL++  +T+LI +F  EQILH  YL ELL  TR +LKTKPN+S+   SI K +TICGDLHGQL DL+ IF +N++PD SNPY+ NGDF+DRG HSVEIA ILFSF +LYP  VFLNRGNHED +MN RYGF+KE+Q KYK++AN I+  FADIF WLPL TII N I +CHGGIS  + L+ ++ +DR K++S L  P +   +E  + EW+Q+LD+LWSDP+ + GC  N +RGGGCYFGPDIT+  L+KY   LLIRSHECK  GYEWCH+++V+T+FSASNYY  GSNKGAF+++      +   +   K+ QKH+ + + ++ IEESALR+L+ KIL  +++L  EF+  D +N G+IE Q WC +M  VL+L LPWRTLR  L  ++  G + YSS FE   ++D+K   M   ++++E+YK ++ LET+FRI+D DNSG IS+ EF++ CK+L  H+  N++ EA+EDLA+ +DINKDG ID NEFLEAFRI
Sbjct:    1 MGCAQSNSPKH---------EYDNIYNSPKAIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQE---CDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFE-AQQVDNK-FLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRI 627          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 325/612 (53.10%), Postives = 437/612 (71.41%), Query Frame = 3
Query:  207 IMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLM--GQQNLSSDSLFTKALNKSTSIKRSSEYEND------------IPLETDYSGPIIQFPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSD---SELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEIYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            I +K+ I IQ WYR Y+A+LEA+R+ +WMIYQSIEYSGEQDQLKL +FF DL++L   GQ+    DS   +AL+K+  +K +    ++            I +E  Y G  + FPL++  +T+LI +F  EQILH  YL ELL  TR +LKTKPN+S+   SI K +TICGDLHGQL DL+ IF +N++PD SNPY+ NGDF+DRG HSVEIA ILFSF +LYP  VFLNRGNHED +MN RYGF+KE+Q KYK++AN I+  FADIF WLPL TII N I +CHGGIS  + L+ ++ +DR K++S L  P +   +E  + EW+Q+LD+LWSDP+ + GC  N +RGGGCYFGPDIT+  L+KY   LLIRSHECK  GYEWCH+++V+T+FSASNYY  GSNKGAF+++      +   +   K+ QKH+ + + ++ IEESALR+L+ KIL  +++L  EF+  D +N G+IE Q WC +M  VL+L LPWRTLR  L  ++  G + YSS FE   ++D+K   M   ++++E+YK ++ LET+FRI+D DNSG IS+ EF++ CK+L  H+  N++ EA+EDLA+ +DINKDG ID NEFLEAFRI
Sbjct:   47 ISIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLTNKGQE---CDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRKEQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLSKEGKVEYSSIFE-AQQVDNK-FLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRI 653          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000003989.1 (SMESG000003989.1)

HSP 1 Score: 356.295 bits (913), Expect = 4.710e-113
Identity = 221/638 (34.64%), Postives = 341/638 (53.45%), Query Frame = 3
Query:  117 LMGCQ-QSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAF---NNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSDS--ELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKK--EFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDN----SGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEI-YKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 1991
            +MGC+  S+L KN     ++   + ++ + L   K+V+ IQK+YR Y+A+ EA+RK  W I+Q +EYS EQ+Q+ +       ++   +++      F+K  +     K++  + +   L+  ++G  +++P+T  ++ +L+  +   NN+  L    L ELL++ + +L+  PN+ E        ITICGD+HG   DL+ IF++N  P  SNPY+FNGDF+DRG  SVE+  +L    +  P  VFLNRGNHED  MN RYGF KE+  KY                                                  K+ S L   SD+  E +  EW QVL++LWSDP+P  GC+ N +RGGGCYFGPD+T QFLEK   +L+IRSHECK  G+++CH+D+VLT+FSASNYY+ GSN GAF  + KS   +I  + +++  +F+K+          EE ++R L ++I   R+ L+ +F   D D     SG+I    W   M+ ++ +DLPWR L+  L    P+  +     +  +      Q    KIS   EI  ++   +E +F +LDS  SG ++  EF E  +   +  +  +  E +  L ++ D+N DG ID  EFL+  RI
Sbjct:   69 VMGCKLSSNLFKNNTNDDMIACKSSNIVATL---KAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNK--LSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKY--------------------------------------------------KFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKN----------EEESVRCLMSEIWRKRNSLLKKFREFDIDKSDKYSGVISIGQWVTAMSTIMNMDLPWRQLKWYL---IPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNT-TLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 634          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPEF11.076e-17140.73protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF19.269e-13437.58protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF28.422e-9250.85protein phosphatase with EF-hand domain 2 [Source:... [more]
PPEF21.241e-9148.00protein phosphatase with EF-hand domain 2 [Source:... [more]
PPP5C1.195e-7240.80protein phosphatase 5 catalytic subunit [Source:HG... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pef-11.333e-18041.26Serine/threonine-protein phosphatase with EF-hands... [more]
pef-12.605e-17942.22Serine/threonine-protein phosphatase with EF-hands... [more]
pef-19.476e-15643.19Serine/threonine-protein phosphatase with EF-hands... [more]
pph-52.400e-8041.28Serine/threonine-protein phosphatase 5 [Source:Un... [more]
C47A4.32.469e-4432.24Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdgC8.929e-16941.06gene:FBgn0265959 transcript:FBtr0342946[more]
rdgC2.229e-16841.06gene:FBgn0265959 transcript:FBtr0473730[more]
rdgC8.619e-16841.06gene:FBgn0265959 transcript:FBtr0342949[more]
rdgC8.619e-16841.06gene:FBgn0265959 transcript:FBtr0342947[more]
rdgC8.619e-16841.06gene:FBgn0265959 transcript:FBtr0342948[more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef15.479e-9249.18protein phosphatase, EF-hand calcium binding domai... [more]
ppef17.276e-9249.50protein phosphatase, EF-hand calcium binding domai... [more]
ppef17.276e-9249.50protein phosphatase, EF-hand calcium binding domai... [more]
CU695117.11.182e-7944.98protein phosphatase with EF-hand domain 2a [Source... [more]
ppp5c6.678e-7841.84protein phosphatase 5, catalytic subunit [Source:Z... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp436.232e-16141.74ubiquitin specific peptidase 43 [Source:Xenbase;Ac... [more]
PPEF21.509e-8948.65protein phosphatase, EF-hand calcium binding domai... [more]
ppp5c3.570e-7741.10protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c4.616e-7039.26protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c6.514e-6639.26protein phosphatase 5, catalytic subunit [Source:N... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppef12.896e-16841.37protein phosphatase with EF hand calcium-binding d... [more]
Ppef29.529e-9350.51protein phosphatase, EF hand calcium-binding domai... [more]
Ppef29.529e-9350.51protein phosphatase, EF hand calcium-binding domai... [more]
Ppp5c2.994e-7341.10protein phosphatase 5, catalytic subunit [Source:M... [more]
Ppef14.652e-6649.29protein phosphatase with EF hand calcium-binding d... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5EBX9|PPE_CAEEL3.313e-17842.22Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O14829|PPE1_HUMAN5.167e-17140.73Serine/threonine-protein phosphatase with EF-hands... [more]
sp|Q3SWT6|PPE1_RAT2.797e-16940.81Serine/threonine-protein phosphatase with EF-hands... [more]
sp|P40421|RDGC_DROME8.951e-16841.06Serine/threonine-protein phosphatase rdgC OS=Droso... [more]
sp|O35655|PPE1_MOUSE2.026e-16741.37Serine/threonine-protein phosphatase with EF-hands... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HDQ70.000e+046.48Serine/threonine-protein phosphatase with EF-hands... [more]
A0A1I8GHE30.000e+046.90Serine/threonine-protein phosphatase with EF-hands... [more]
A0A267DFW70.000e+047.55Serine/threonine-protein phosphatase with EF-hands... [more]
A0A2B4SS400.000e+047.72Serine/threonine-protein phosphatase with EF-hands... [more]
A0A1I8HG200.000e+047.17Serine/threonine-protein phosphatase OS=Macrostomu... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef11.214e-9448.49serine/threonine-protein phosphatase with EF-hands... [more]
ppef15.552e-9450.66serine/threonine-protein phosphatase with EF-hands... [more]
ENSAMXT00000016118.22.086e-9349.17pep primary_assembly:Astyanax_mexicanus-2.0:14:382... [more]
PPEF22.044e-8546.44protein phosphatase with EF-hand domain 2 [Source:... [more]
ppp5c2.695e-7941.55protein phosphatase 5 catalytic subunit [Source:NC... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c4.139e-7741.21protein phosphatase 5, catalytic subunit [Source:Z... [more]
ppp1cab1.032e-4436.01protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.15.923e-4234.86pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp3cb1.121e-3432.83protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp1cb2.119e-3336.82protein phosphatase 1, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PPT15.254e-4933.03Protein serine/threonine phosphatase; regulates Hs... [more]
GLC75.659e-4535.81Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPH221.345e-4133.85Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH211.635e-4133.46Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH36.248e-3932.28Catalytic subunit of protein phosphatase PP4 compl... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470340.000e+048.03Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446481.551e-4636.79Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297598.046e-4533.12Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499363.435e-4232.45Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO362723.794e-3430.69Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef12.493e-8845.42protein phosphatase with EF-hand domain 1 [Source:... [more]
ENSORLT00000000429.23.136e-8645.45serine/threonine-protein phosphatase with EF-hands... [more]
ENSORLT00000036394.17.386e-8645.45serine/threonine-protein phosphatase with EF-hands... [more]
PPEF27.942e-8647.67serine/threonine-protein phosphatase with EF-hands... [more]
ppp5c2.852e-7741.72protein phosphatase 5 catalytic subunit [Source:NC... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076282.10.000e+0100.00SMESG000076282.1[more]
SMESG000076282.10.000e+099.37SMESG000076282.1[more]
SMESG000042202.10.000e+051.48SMESG000042202.1[more]
SMESG000042202.10.000e+053.10SMESG000042202.1[more]
SMESG000003989.14.710e-11334.64SMESG000003989.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014950 ID=SMED30014950|Name=Serine/threonine-protein phosphatase with EF-hands|organism=Schmidtea mediterranea sexual|type=transcript|length=2228bp
AAGACCTTGAAATTTGTTTAACTGCATAAAATGCAAGAAAATTAAATTTG
ATTTATTTTTATATTCTATTTTTTGCAAGAACTTTACAAAAGCTTAATTT
CGTGATCAAATTCAAACTGATGGGATGTCAGCAGTCAGACTTAAAGAAAA
ATGGGATCGCTTCTGTATTGTTACGGGAGGACAATGAAGACTTAAAAAGT
AAATTGATCATGATGAAATCTGTCATTGCCATACAAAAGTGGTATCGAGG
ATACCAGGCGAGATTAGAGGCCAGGCGAAAGTGTAGCTGGATGATTTATC
AGTCAATTGAATATTCTGGCGAACAAGATCAGCTAAAATTGCACAATTTT
TTTCTGGATCTCATGAATCTGATGGGGCAGCAGAATCTCAGTAGTGACTC
ATTATTCACGAAAGCATTAAACAAATCAACATCCATTAAAAGAAGCAGCG
AATACGAGAATGATATCCCATTAGAAACGGACTATTCGGGGCCCATTATC
CAGTTTCCGCTTACTCTCACAGTAATTACCTCTCTCATCAATGCTTTCAA
TAATGAACAAATTCTCCACGGACATTACCTATTTGAATTGTTGGTACAAA
CGAGAGGAATACTCAAAACCAAACCAAACATATCAGAAACCGACCTCAGT
ATATTCAAGCATATCACAATATGTGGTGATCTTCATGGTCAACTGCAAGA
TCTAATTTATATCTTTGAAGAAAATCGGTACCCGGACCCCAGCAATCCTT
ACGTTTTCAATGGGGACTTTATCGATAGGGGAAAACATTCAGTTGAAATT
GCTGTAATACTCTTTTCATTTTTGATTTTATATCCAGGATGCGTTTTCCT
CAACCGTGGCAATCACGAGGACAAAATAATGAACTTAAGGTATGGATTCA
TCAAGGAGGTTCAAACCAAATATAAAGCGCATGCCAATTCCATCATAAAT
CTTTTCGCAGACATTTTTCGTTGGTTGCCATTGGCAACGATAATTAGCAA
CAAGATTTTTATTTGCCATGGAGGGATTTCAAATAGGATTCAATTAGAAA
CGCTCAAAAATATCGACAGATCAAAGTACATCTCGGCCCTGAATTGCCCC
TCTGACAGTGAGCTGGATCAGGCCGAATGGCTTCAGGTTCTGGATATTCT
TTGGAGTGATCCGAAGCCTCAAAAGGGATGTAGACAAAATTTATTCAGAG
GAGGAGGATGTTATTTTGGTCCTGATATCACTCATCAATTTCTGGAAAAA
TACAAATTTCGGCTCCTCATTCGGTCTCACGAGTGCAAACCCCTCGGATA
TGAATGGTGTCACAAAGATGAAGTTCTGACCATATTTTCAGCGTCAAATT
ATTACGATACTGGATCTAATAAAGGCGCCTTTGTCAAACTTACAAAATCA
CTCGAACCAAAAATAATTTCCTTCAACGCGAAGAAAGAATTTCAGAAACA
TATTTTAATTAATGAAGGAATTCACGCAATTGAAGAATCAGCGTTGCGGG
AACTCCGGACAAAGATTCTGACAAATCGCAGTCAATTAATGTCAGAGTTT
CTGGCATGCGATGGAGACAATTCTGGTTTGATTGAATGTCAACATTGGTG
CAATATCATGGCAGCAGTTCTACAACTAGACTTACCATGGAGAACTCTGA
GAAATCAATTGGCAGTTGTGACACCTTCGGGGGCCATCAATTACAGCTCT
ACGTTTGAGCTATTGTCAAGAATGGACTCAAAACAAAATCATATGAATAA
GATCTCCGTCTCGGATGAGATATACAAGTACCGAGACACTCTGGAAACTG
TGTTTCGAATTCTCGATTCCGACAATTCAGGTAGGATCTCGATTGACGAA
TTCAAAGAAGGTTGCAAAATCCTGAAAAGTCATTCCAAAGCAAATATGAC
TCCTGAAGCAATGGAGGACCTTGCAAGATCCATTGATATAAACAAGGATG
GTTCGATTGATCTCAACGAATTTTTAGAAGCATTCCGAATCAACGAGGAC
AACTATCAATAAATATGAGACTTTTGAGGATATTTTCATATATAATATTT
TATTAAATTACTGTTTTACATGATTTCATGCATTTATTTATGTCCAGTAC
TCAGCGCCCTGATATTCAAATCTATTTCACGATATTTGACCTAGAGCTAA
TGGGACAGAGGTTATACATTAAAAATTATAATTAGAAAGGTGGTCAACCC
TTCCTTGAATCTGTGAACCTGTGAACCC
back to top

protein sequence of SMED30014950-orf-1

>SMED30014950-orf-1 ID=SMED30014950-orf-1|Name=SMED30014950-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=631bp
MGCQQSDLKKNGIASVLLREDNEDLKSKLIMMKSVIAIQKWYRGYQARLE
ARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKAL
NKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAFNNEQILH
GHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFE
ENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHE
DKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICH
GGISNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKP
QKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKD
EVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKKEFQKHILINEG
IHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAV
LQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDE
IYKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMED
LARSIDINKDGSIDLNEFLEAFRINEDNYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016787hydrolase activity
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0004721phosphoprotein phosphatase activity
GO:0005506iron ion binding
GO:0030145manganese ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012008Ser/Thr-Pase_EF-hand_contain
IPR006186Ser/Thr-sp_prot-phosphatase
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR013235PPP_dom
IPR000048IQ_motif_EF-hand-BS
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
IPR018247EF_Hand_1_Ca_BS
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0050906detection of stimulus involved in sensory perception
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 181..208
score: 42.68
coord: 211..238
score: 45.54
coord: 281..307
score: 43.56
coord: 379..399
score: 32.41
coord: 244..268
score: 47.8
coord: 401..417
score: 47.35
coord: 322..349
score: 24.75
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 149..439
e-value: 1.3E-108
score: 376.8
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 245..250
IPR002048EF-hand domainSMARTSM00054efh_1coord: 597..625
e-value: 1.1
score: 17.5
coord: 472..500
e-value: 31.0
score: 5.7
coord: 557..585
e-value: 0.0016
score: 27.7
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 557..623
e-value: 6.2E-14
score: 52.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 553..588
score: 13.677
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 593..628
score: 11.054
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 468..503
score: 7.093
IPR002048EF-hand domainCDDcd00051EFhcoord: 558..623
e-value: 1.48996E-12
score: 60.6393
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 181..390
e-value: 1.5E-29
score: 104.0
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 33..50
e-value: 3.4E-4
score: 20.2
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 31..58
score: 7.584
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 450..628
e-value: 3.1E-21
score: 77.9
NoneNo IPR availablePANTHERPTHR45668:SF2SERINE/THREONINE-PROTEIN PHOSPHATASE WITH EF-HANDS 2coord: 331..627
coord: 27..323
NoneNo IPR availablePANTHERPTHR45668FAMILY NOT NAMEDcoord: 331..627
coord: 27..323
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 116..502
IPR013235PPP domainPFAMPF08321PPP5coord: 94..171
e-value: 4.7E-6
score: 26.8
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 97..449
e-value: 9.9E-106
score: 355.1
IPR012008Serine/threonine-protein phosphatase with EF-handsPIRSFPIRSF000912PPEFcoord: 328..630
e-value: 8.8E-121
score: 401.5
coord: 15..334
e-value: 3.1E-120
score: 399.7
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 566..578
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 606..618
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 471..623