SMED30014948

Overview
NameSMED30014948
Smed IDSMED30014948
Length (bp)1834
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014948

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30014948SMESG000057287.1 Contig4521_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014948 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000690:113817..115689 +9128
Homology
BLAST of SMED30014948 vs. Ensembl Human
Match: KLC2 (kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC:20716])

HSP 1 Score: 80.1073 bits (196), Expect = 5.039e-15
Identity = 99/427 (23.19%), Postives = 185/427 (43.33%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ-----RADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++  N PI+  A E +     R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQER-C----------ILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSA 429          
BLAST of SMED30014948 vs. Ensembl Human
Match: KLC2 (kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC:20716])

HSP 1 Score: 80.1073 bits (196), Expect = 5.039e-15
Identity = 99/427 (23.19%), Postives = 185/427 (43.33%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ-----RADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++  N PI+  A E +     R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQER-C----------ILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSA 429          
BLAST of SMED30014948 vs. Ensembl Human
Match: KLC2 (kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC:20716])

HSP 1 Score: 80.1073 bits (196), Expect = 5.039e-15
Identity = 99/427 (23.19%), Postives = 185/427 (43.33%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ-----RADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++  N PI+  A E +     R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQER-C----------ILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSA 429          
BLAST of SMED30014948 vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 75.485 bits (184), Expect = 1.138e-13
Identity = 90/417 (21.58%), Postives = 187/417 (44.84%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDP--------------------LMPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ +K+V++ L  L  +H   +   Q  L  +    K+D+   + E   + +  +   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L     +L + E ++A+ +EE  H E +++++  D      E++      E  + +   D  DP                     +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E
Sbjct:   23 EIISKTKQVIQGLEALKNEHNSIL---QSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEE 432          
BLAST of SMED30014948 vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 75.485 bits (184), Expect = 1.171e-13
Identity = 90/417 (21.58%), Postives = 187/417 (44.84%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDP--------------------LMPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ +K+V++ L  L  +H   +   Q  L  +    K+D+   + E   + +  +   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L     +L + E ++A+ +EE  H E +++++  D      E++      E  + +   D  DP                     +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E
Sbjct:   23 EIISKTKQVIQGLEALKNEHNSIL---QSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEE 432          
BLAST of SMED30014948 vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 69.707 bits (169), Expect = 3.277e-12
Identity = 86/428 (20.09%), Postives = 184/428 (42.99%), Query Frame = 3
Query:  360 GLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLES-----------EVWELVIHPDNKDPL-----------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ----RADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADP 1508
            G+ +++ ++ V +LT  ++    K + + +R   EN  L+ +L+    +L + E  +A+ +EE  H + ++ I+  D   +SD   S            + EL   P++++ +                       +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++ L  +HP +A TL+  A+++GK  K   A      AL++ E     D    ++ +Q           G  E+  K  + AL  +ES L  ++ +   T   ++        + +   +  +++   HE+ +G IS +N PI+++A E +    + + ATA   A          P V  +L+ +   Y  + ++ +A  +E+      K  +P
Sbjct:   66 GVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHP--DVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEDVALRAKKQHEP 491          
BLAST of SMED30014948 vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 69.707 bits (169), Expect = 3.277e-12
Identity = 86/428 (20.09%), Postives = 184/428 (42.99%), Query Frame = 3
Query:  360 GLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLES-----------EVWELVIHPDNKDPL-----------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ----RADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADP 1508
            G+ +++ ++ V +LT  ++    K + + +R   EN  L+ +L+    +L + E  +A+ +EE  H + ++ I+  D   +SD   S            + EL   P++++ +                       +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++ L  +HP +A TL+  A+++GK  K   A      AL++ E     D    ++ +Q           G  E+  K  + AL  +ES L  ++ +   T   ++        + +   +  +++   HE+ +G IS +N PI+++A E +    + + ATA   A          P V  +L+ +   Y  + ++ +A  +E+      K  +P
Sbjct:   66 GVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHP--DVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEDVALRAKKQHEP 491          
BLAST of SMED30014948 vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 68.9366 bits (167), Expect = 4.472e-12
Identity = 84/417 (20.14%), Postives = 181/417 (43.41%), Query Frame = 3
Query:  360 GLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLES-----------EVWELVIHPDNKDPL-----------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ----RADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIEN 1475
            G+ +++ ++ V +LT  ++    K + + +R   EN  L+ +L+    +L + E  +A+ +EE  H + ++ I+  D   +SD   S            + EL   P++++ +                       +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++ L  +HP +A TL+  A+++GK  K   A      AL++ E     D    ++ +Q           G  E+  K  + AL  +ES L  ++ +   T   ++        + +   +  +++   HE+ +G IS +N PI+++A E +    + + ATA   A          P V  +L+ +   Y  + ++ +A  +E+
Sbjct:   66 GVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHP--DVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLED 480          
BLAST of SMED30014948 vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 68.9366 bits (167), Expect = 4.472e-12
Identity = 84/417 (20.14%), Postives = 181/417 (43.41%), Query Frame = 3
Query:  360 GLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLES-----------EVWELVIHPDNKDPL-----------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ----RADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIEN 1475
            G+ +++ ++ V +LT  ++    K + + +R   EN  L+ +L+    +L + E  +A+ +EE  H + ++ I+  D   +SD   S            + EL   P++++ +                       +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++ L  +HP +A TL+  A+++GK  K   A      AL++ E     D    ++ +Q           G  E+  K  + AL  +ES L  ++ +   T   ++        + +   +  +++   HE+ +G IS +N PI+++A E +    + + ATA   A          P V  +L+ +   Y  + ++ +A  +E+
Sbjct:   66 GVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHP--DVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLED 480          
BLAST of SMED30014948 vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 68.9366 bits (167), Expect = 5.247e-12
Identity = 84/417 (20.14%), Postives = 181/417 (43.41%), Query Frame = 3
Query:  360 GLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLES-----------EVWELVIHPDNKDPL-----------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ----RADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIEN 1475
            G+ +++ ++ V +LT  ++    K + + +R   EN  L+ +L+    +L + E  +A+ +EE  H + ++ I+  D   +SD   S            + EL   P++++ +                       +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++ L  +HP +A TL+  A+++GK  K   A      AL++ E     D    ++ +Q           G  E+  K  + AL  +ES L  ++ +   T   ++        + +   +  +++   HE+ +G IS +N PI+++A E +    + + ATA   A          P V  +L+ +   Y  + ++ +A  +E+
Sbjct:   87 GVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHP--DVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLED 501          
BLAST of SMED30014948 vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0075951)

HSP 1 Score: 75.0998 bits (183), Expect = 6.430e-14
Identity = 92/417 (22.06%), Postives = 179/417 (42.93%), Query Frame = 3
Query:  162 MGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKL-----ESEVWELVIHPDNKD-----PL-------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            M   E++T +K V++ L  L  +H   +    +   +  ++ K D L +  E +          +LGL ++  ++ +      +E  + K++T+ +R   EN  L+ +L     +    E  +A+ +EE  H E ++ ++  D  +E D          V EL    +N+D     P              +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R +TL  NHP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  ++  K  + AL  +ES L  ++ +   T   +A        + +   +  +++   HE+ +G I  KN PI++VA E
Sbjct:    4 MSQDEIITNTKTVLQGLEALRVEHVSIMNGIAE---VQKDNEKSDMLRKNIENI----------ELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEE 405          
BLAST of SMED30014948 vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331555)

HSP 1 Score: 75.0998 bits (183), Expect = 6.430e-14
Identity = 92/417 (22.06%), Postives = 179/417 (42.93%), Query Frame = 3
Query:  162 MGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKL-----ESEVWELVIHPDNKD-----PL-------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            M   E++T +K V++ L  L  +H   +    +   +  ++ K D L +  E +          +LGL ++  ++ +      +E  + K++T+ +R   EN  L+ +L     +    E  +A+ +EE  H E ++ ++  D  +E D          V EL    +N+D     P              +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R +TL  NHP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  ++  K  + AL  +ES L  ++ +   T   +A        + +   +  +++   HE+ +G I  KN PI++VA E
Sbjct:    4 MSQDEIITNTKTVLQGLEALRVEHVSIMNGIAE---VQKDNEKSDMLRKNIENI----------ELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEE 405          
BLAST of SMED30014948 vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331556)

HSP 1 Score: 75.0998 bits (183), Expect = 6.940e-14
Identity = 92/417 (22.06%), Postives = 179/417 (42.93%), Query Frame = 3
Query:  162 MGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKL-----ESEVWELVIHPDNKD-----PL-------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            M   E++T +K V++ L  L  +H   +    +   +  ++ K D L +  E +          +LGL ++  ++ +      +E  + K++T+ +R   EN  L+ +L     +    E  +A+ +EE  H E ++ ++  D  +E D          V EL    +N+D     P              +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R +TL  NHP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  ++  K  + AL  +ES L  ++ +   T   +A        + +   +  +++   HE+ +G I  KN PI++VA E
Sbjct:    4 MSQDEIITNTKTVLQGLEALRVEHVSIMNGIAE---VQKDNEKSDMLRKNIENI----------ELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEE 405          
BLAST of SMED30014948 vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 72.0182 bits (175), Expect = 1.041e-12
Identity = 98/443 (22.12%), Postives = 196/443 (44.24%), Query Frame = 3
Query:  108 KDSNASLLSFSVAGGKKDMG----ATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-------------GEEESDKL---ESEVWELVIHPDNKDPL---------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            ++  +S+L      G+ D+G      E++  +++V++ L  L  +H+  +E     L  +  S +E +  E  E   + +  M   +LGL ++  ++ +     A+E  + K+R + +R   EN+ L+ +L     RL + E ++A+ +EE  H E +++++  D               E  D L   E +     I P +   +         +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E
Sbjct:    2 REDMSSVLCVKETEGQGDLGEKLSQDELLCRTREVMQGLEALRAEHQAILEGLMGTLRCLKQS-QEGRAVE--EKTAMIQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDLSPSDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEE 437          
BLAST of SMED30014948 vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 71.633 bits (174), Expect = 1.230e-12
Identity = 98/443 (22.12%), Postives = 196/443 (44.24%), Query Frame = 3
Query:  108 KDSNASLLSFSVAGGKKDMG----ATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-------------GEEESDKL---ESEVWELVIHPDNKDPL---------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            ++  +S+L      G+ D+G      E++  +++V++ L  L  +H+  +E     L  +  S +E +  E  E   + +  M   +LGL ++  ++ +     A+E  + K+R + +R   EN+ L+ +L     RL + E ++A+ +EE  H E +++++  D               E  D L   E +     I P +   +         +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E
Sbjct:    2 REDMSSVLCVKETEGQGDLGEKLSQDELLCRTREVMQGLEALRAEHQAILEGLMGTLRCLKQS-QEGRAVE--EKTAMIQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDLSPSDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEE 437          
BLAST of SMED30014948 vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 66.2402 bits (160), Expect = 7.533e-11
Identity = 95/433 (21.94%), Postives = 199/433 (45.96%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDG------EEESDKLESEVWEL--------VIHPDNKDPL---------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSW-----MDTIVK--------MAKTCND---CKF----HDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ +K V++ L  L ++H   +   Q  L  +    K+++   ++E  ++ +  +   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L    +++ + E ++A+ +EE  H E +++++  D       E+ SD  +  + +L        V H  N   +         +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++TL +++P +A TL+  A++YGK  K   A      AL++ E           LGR++            P+   +L  LALL  ++    EEV +     +D   K        +AKT N+   C      + +   +  E++   HEK +G +  +N PI+  A E
Sbjct:   19 EIISSTKLVIQGLEALKSEHNSIL---QSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKNSDTPKDSLDDLFPNDEDDQVSHQHNSAAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKV---------LGREH------------PDVAKQLNNLALLC-QNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGCVDAENKPIWMHAEE 426          
BLAST of SMED30014948 vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 66.2402 bits (160), Expect = 7.533e-11
Identity = 95/433 (21.94%), Postives = 199/433 (45.96%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDG------EEESDKLESEVWEL--------VIHPDNKDPL---------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSW-----MDTIVK--------MAKTCND---CKF----HDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ +K V++ L  L ++H   +   Q  L  +    K+++   ++E  ++ +  +   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L    +++ + E ++A+ +EE  H E +++++  D       E+ SD  +  + +L        V H  N   +         +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++TL +++P +A TL+  A++YGK  K   A      AL++ E           LGR++            P+   +L  LALL  ++    EEV +     +D   K        +AKT N+   C      + +   +  E++   HEK +G +  +N PI+  A E
Sbjct:   19 EIISSTKLVIQGLEALKSEHNSIL---QSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKNSDTPKDSLDDLFPNDEDDQVSHQHNSAAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKV---------LGREH------------PDVAKQLNNLALLC-QNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGCVDAENKPIWMHAEE 426          
BLAST of SMED30014948 vs. Ensembl Zebrafish
Match: klc3 (kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-060929-772])

HSP 1 Score: 65.4698 bits (158), Expect = 9.149e-11
Identity = 90/416 (21.63%), Postives = 179/416 (43.03%), Query Frame = 3
Query:  162 MGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSH---KEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEES--DK--------------LESEVWELVIHPDNKDPL--------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIY 1307
            +   E++  +++V+  L  L  ++R  ++  Q+ L    +S    +++K   + E L        R +LGL ++  ++ +     +LE  + K+R + +R   EN+ L+ +L+    +L E E  +   +E+  H + +S IR  D EE S  DK               E E    +  P +            +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E    TD    ++ +Q           G  ++  +  E AL  ++S L  ++ +   T   +A        +     +  E++   HEK +G +     P++
Sbjct:    2 LSGEEILCSTQQVIAGLEALRGENRTLLDSLQETLQSQTSSESSLEQEKTSIILESL-------ERIELGLGEAQVMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELSRAQQQLQEREQEVVTLEEQNRHLQFMSSIRKYDHEETSLEDKDSTSGKESLDDLFPTEEEEQTHMSQPHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHSHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGMDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHP--DVAKQLNNLALLCQNQGKYQEVEQYYERALHIYQSQLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDGRPVW 408          
BLAST of SMED30014948 vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 55.0694 bits (131), Expect = 3.148e-7
Identity = 74/326 (22.70%), Postives = 138/326 (42.33%), Query Frame = 3
Query:  666 MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPT--YLPPLVAASLREIIIAYSSRYEFGSARIIENYL----KECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSL 1598
            +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E ++            G         P V  +L+ +   Y  + +F +A  +E       K+ L  A    +   LND E         I +R +R+SL
Sbjct:  209 IPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKQKDGTFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQALDNAHKQRVAEVLNDPES--------IEKRRSRESL 522          
BLAST of SMED30014948 vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 52.373 bits (124), Expect = 2.065e-6
Identity = 75/333 (22.52%), Postives = 140/333 (42.04%), Query Frame = 3
Query:  666 MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYL----KECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSL 1598
            +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E ++           +G    Y           P V  +L+ +   Y  + +F +A  +E       K+ L  A    +   LND E         I +R +R+SL
Sbjct:  209 IPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQK-----DGTFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQALDNAHKQRVAEVLNDPES--------IEKRRSRESL 524          
BLAST of SMED30014948 vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 51.9878 bits (123), Expect = 2.179e-6
Identity = 75/333 (22.52%), Postives = 140/333 (42.04%), Query Frame = 3
Query:  666 MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYL----KECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSL 1598
            +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E ++           +G    Y           P V  +L+ +   Y  + +F +A  +E       K+ L  A    +   LND E         I +R +R+SL
Sbjct:  184 IPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQK-----DGTFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQALDNAHKQRVAEVLNDPES--------IEKRRSRESL 499          
BLAST of SMED30014948 vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 51.9878 bits (123), Expect = 2.215e-6
Identity = 75/333 (22.52%), Postives = 140/333 (42.04%), Query Frame = 3
Query:  666 MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYL----KECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSL 1598
            +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E ++           +G    Y           P V  +L+ +   Y  + +F +A  +E       K+ L  A    +   LND E         I +R +R+SL
Sbjct:  209 IPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQK-----DGTFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQALDNAHKQRVAEVLNDPES--------IEKRRSRESL 524          
BLAST of SMED30014948 vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 51.9878 bits (123), Expect = 2.668e-6
Identity = 75/333 (22.52%), Postives = 140/333 (42.04%), Query Frame = 3
Query:  666 MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYL----KECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSL 1598
            +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E ++           +G    Y           P V  +L+ +   Y  + +F +A  +E       K+ L  A    +   LND E         I +R +R+SL
Sbjct:  209 IPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQK-----DGTFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQALDNAHKQRVAEVLNDPES--------IEKRRSRESL 524          
BLAST of SMED30014948 vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 83.5741 bits (205), Expect = 2.946e-16
Identity = 99/425 (23.29%), Postives = 186/425 (43.76%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIY---EVAAECQRADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++ +N PI+   E   E +R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQER-C----------LLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDSLDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESKRRDSA 427          
BLAST of SMED30014948 vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 83.5741 bits (205), Expect = 2.946e-16
Identity = 99/425 (23.29%), Postives = 186/425 (43.76%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIY---EVAAECQRADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++ +N PI+   E   E +R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQER-C----------LLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDSLDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESKRRDSA 427          
BLAST of SMED30014948 vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 83.5741 bits (205), Expect = 2.946e-16
Identity = 99/425 (23.29%), Postives = 186/425 (43.76%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIY---EVAAECQRADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++ +N PI+   E   E +R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQER-C----------LLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDSLDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESKRRDSA 427          
BLAST of SMED30014948 vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 80.8777 bits (198), Expect = 1.611e-15
Identity = 99/427 (23.19%), Postives = 186/427 (43.56%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ-----RADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++ +N PI+  A E +     R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQER-C----------LLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDSLDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESKDKRRDSA 429          
BLAST of SMED30014948 vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 75.0998 bits (183), Expect = 1.062e-13
Identity = 90/417 (21.58%), Postives = 191/417 (45.80%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGE----EESDKLESEVWELVIHPDNKDPL---------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ +K+V++ L  L  +H   +   Q  L  +    K+D+   + E  ++ +  +   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L     +L + E ++A+ +EE  H E +++++  D +    E+ D   S+     + P+++D                       +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E
Sbjct:   23 EIISKTKQVIQGLEALKNEHNSIL---QSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEE 432          
BLAST of SMED30014948 vs. UniProt/SwissProt
Match: sp|O88448|KLC2_MOUSE (Kinesin light chain 2 OS=Mus musculus OX=10090 GN=Klc2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.249e-14
Identity = 95/414 (22.95%), Postives = 181/414 (43.72%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD     EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++ +N PI+  A E
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQER-C----------LLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEMLPQEEKGDVPKDSLDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEE 416          
BLAST of SMED30014948 vs. UniProt/SwissProt
Match: sp|Q9H0B6|KLC2_HUMAN (Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.420e-14
Identity = 99/427 (23.19%), Postives = 185/427 (43.33%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRS----QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDPL----------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQ-----RADSA 1343
            E+V  +K V++ L  L  +HR  +          A    +++ C          +L+ RS    +LGL ++  ++ +     A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H   +S+IR LD      EE+ D  +  + +L  + D + P                 +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  + + L  ++ +   T   +A        + D  T+  E++   HEK +G ++  N PI+  A E +     R DSA
Sbjct:   16 EIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQER-C----------ILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSA 429          
BLAST of SMED30014948 vs. UniProt/SwissProt
Match: sp|P37285|KLC1_RAT (Kinesin light chain 1 OS=Rattus norvegicus OX=10116 GN=Klc1 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 4.625e-13
Identity = 90/417 (21.58%), Postives = 188/417 (45.08%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDP--------------------LMPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ +K+V++ L  L  +H   +   Q  L  +    K+D+   + E  ++ +  +   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L     +L + E ++A+ +EE  H E +++++  D      E++      E  + +   D  DP                     +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E
Sbjct:   23 EIISKTKQVIQGLEALKNEHNSIL---QSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEE 432          
BLAST of SMED30014948 vs. UniProt/SwissProt
Match: sp|P46824|KLC_DROME (Kinesin light chain OS=Drosophila melanogaster OX=7227 GN=Klc PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.446e-13
Identity = 92/417 (22.06%), Postives = 179/417 (42.93%), Query Frame = 3
Query:  162 MGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKL-----ESEVWELVIHPDNKD-----PL-------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            M   E++T +K V++ L  L  +H   +    +   +  ++ K D L +  E +          +LGL ++  ++ +      +E  + K++T+ +R   EN  L+ +L     +    E  +A+ +EE  H E ++ ++  D  +E D          V EL    +N+D     P              +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R +TL  NHP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  ++  K  + AL  +ES L  ++ +   T   +A        + +   +  +++   HE+ +G I  KN PI++VA E
Sbjct:    4 MSQDEIITNTKTVLQGLEALRVEHVSIMNGIAE---VQKDNEKSDMLRKNIENI----------ELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEE 405          
BLAST of SMED30014948 vs. UniProt/SwissProt
Match: sp|Q07866|KLC1_HUMAN (Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 8.975e-13
Identity = 90/417 (21.58%), Postives = 187/417 (44.84%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDKLESEVWELVIHPDNKDP--------------------LMPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ +K+V++ L  L  +H   +   Q  L  +    K+D+   + E   + +  +   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L     +L + E ++A+ +EE  H E +++++  D      E++      E  + +   D  DP                     +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+     + AL  +++ L  ++ +   T   +A +C     KF     T+  E++   HE+ +G +  +N PI+  A E
Sbjct:   23 EIISKTKQVIQGLEALKNEHNSIL---QSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA-SCYLKQGKFK-QAETLYKEILTRAHEREFGSVDDENKPIWMHAEE 432          
BLAST of SMED30014948 vs. TrEMBL
Match: A0A448WKR2 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS7567 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.229e-63
Identity = 166/535 (31.03%), Postives = 281/535 (52.52%), Query Frame = 3
Query:   60 EMKSGLRVGRGRKLKTKDSNASLLSFSVAGGKKDMGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVH---KVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWE---TLSKIRL---LDGEEESDKLESEVWELVIHPDNKDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDE------AGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSA-TAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLA--DPDIINSPLNDGEGNKDTKQNLITRRLARQSLFSSK 1610
            E K   R+   R L ++ S+A+L+              ++    K V+EK + L  Q +E + K    L  M  S K +++ ++  +   H     LM++ QL  Y ++ +++  +  D  E    KI+++ K+   EN++LK  ++++I ++ + EG L+ +KEE  +W+    L+KI     L  +E +   E +++++  + D   PLM   +  +   I+     EA++++ +  Q       VDE      A  L ++AKR  EE   T +   +   +  R ++  +  P IA TL+  A+IY        A++ A++AL ++E    T K    L RQY  +G FL  WG+ ++GIKLM++AL+  E+ LP EE  W   I KMA+ CND KFHDD M + CELIDY+ EK +GPIS+KN  IYE+A   Q A +  T    A   P P YLPP VA +++E+ IAY+ +++F +A  I  Y+++C      +PD + +       +++ +++LI  + + Q L S+K
Sbjct:   41 EDKKKTRLRDTRSLDSRGSSAALVR----------TGPDIKNGCKSVLEKTTQLNEQIKERINK----LMTMRKSEK-NRILQI-NMEAEHGEWASLMAKCQLAAYAASLMVYATDAVDTSETVINKIKSDFKKAVRENKELKASISFVIEKIHDTEGRLSASKEESLYWKFLYDLNKIEYSLNLTIDEHAVWHEVKIFDVQWNSDIAGPLMRA-VEPIYVAIDANFEEEALELIDKLPQ-------VDEENLPTLATYLEIIAKRAYEEGLFTMAEAQMKRVLEIRTKSYGAGKPIIAATLNVLALIYNGMNNLQKATETAYQALDILEKDSVTSKDKTILIRQYTRTGHFLVNWGYYQEGIKLMQMALVEMEANLPKEEQGWSILICKMARACNDAKFHDDAMVIACELIDYYQEKRFGPISEKNLTIYEIAYAQQMASTKDTTNQEATRLPDPVYLPPQVAMAMKEVAIAYACKFQFRAANTIREYIEKCATSCQEEPDTLTTTTPKAFRDRERRRSLI--KGSAQQLMSTK 549          
BLAST of SMED30014948 vs. TrEMBL
Match: A0A183ASJ7 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9932 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 9.657e-54
Identity = 119/395 (30.13%), Postives = 207/395 (52.41%), Query Frame = 3
Query:  333 KVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDN-----KDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRA--DSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLK 1496
            K+L ++++ G   +N L  + E  D ++      R E +R S ENR+LK  + Y I ++ + E  LA A E   +W+ + ++  LD E  +   ESE+W   +  D          +  +   V ++I+ G + +  K++ +    ++ +     A VL ++A+RC +E+     ++I++ A++ R     SNHP I+ +L+  A++Y    +   A+K A +A+ +ME   +  K+   + RQY+ +G     W    +GI+ ++ A+  +E LLP EE SW   + +MA+TCND  +HDD M + C+++DYFH K +G +S + P IYEVA     A  D  +  L       P +L      +LREI I+++ R E  +A++I  YL  C K
Sbjct:   71 KLLETKARAGEMATNLLEIIAEFLDTIDRGLNTARMELRRLSRENRELKASIAYCIEKIYDAESQLASATESGAYWKFMRELLQLDYELSTAGEESELWNAHVPYDKLWDTEYAGFVSHKAQTVFELIDTGNMKDVSKLIDEIP-VREAQDKASYATVLQMIARRCYKEEYFKICLDILNKALSIRLSMYGSNHPIISASLNCLALVYSGLGELDKATKIAVDAMAIMERHPEFSKNRALMARQYMQTGQMFIAWNHIPEGIRALQTAVGIWEELLPREEDSWCQALNQMARTCNDNDYHDDAMGLSCDIVDYFHMKFFGSVSDRYPTIYEVAYAHDLAFHDPHSVNLDLYPIGSPIHLSRAQQLALREIAISFACRGELKAAQVIATYLHACTK 464          
BLAST of SMED30014948 vs. TrEMBL
Match: A0A504YIB1 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_11998 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.595e-50
Identity = 115/392 (29.34%), Postives = 204/392 (52.04%), Query Frame = 3
Query:  336 VLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDN-----KDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEV--AAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKEC 1490
            +L  ++Q G+  +  L    E+ D ++      R E +  S ENR+LK  ++YLI ++ ++E  LA A+E   +W+ + ++  LD +  +   ES +W+  +  D          +      V D I+ G + +   +V+     ++ +     A VL ++A+RC +E+     +++++ ++  R  T  SNHP I+ +L+  A++YG+  +   A++ A +AL ++E   +   +   + RQY+ +G  L  +    +GI+ M+ A+  +E LLP EE  W   + +MA+TCND  +HDD M +  +LIDYFH K +G +S + P IYEV  A E    ++    L       P +L      +LREI I+++ R E  +A+II  YL  C
Sbjct:   73 LLKRKTQAGVMSTRLLEIAAEVLDTIDQGLNTARMELRNLSRENRELKASISYLIEKIYDVESRLASARESGAYWKFMRELLQLDHKLNTAGDESALWDACVPYDRLWDTEYAGFVSETAQTVLDRIDSGNMKDITALVEAIP-IREAQDKASYATVLQIIAQRCYQEECFKICLDVLNKSLTIRLSTYGSNHPIISASLNCLALVYGELGELETATRFALDALTILEKHLELSSNRSLMARQYMQTGQMLVSFNHVPEGIRSMQTAVGMWEDLLPREENYWCQAVNQMARTCNDNDYHDDAMGLGFDLIDYFHMKAFGSVSDRYPTIYEVAYAHELAHQNAQVVNLDLYPIGNPVHLSRPQQLALREIAISFACRGELKAAQIIATYLHLC 463          
BLAST of SMED30014948 vs. TrEMBL
Match: A0A2H1CLL5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_04234 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 7.913e-50
Identity = 115/392 (29.34%), Postives = 202/392 (51.53%), Query Frame = 3
Query:  336 VLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDN-----KDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEV--AAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKEC 1490
            +L  ++Q G   +  L    E+ D ++      R E +  S ENR+LK  ++YLI ++ ++E  LA A+E   +W+ + ++  LD +  +   ES +W   +  D          +      V D I+ G + +   +V+     ++ +     A VL ++A+RC +E+     +++++ ++  R  T  SNHP I+ +L+  A++YG+  +   A++ A +AL ++E   +   +   + RQY+ +G  L  +    +GI+ M++A+  +E LLP EE  W   + +MA+TCND  +HDD M +  +LIDYFH K +G +S + P IYEV  A E    +     L       P +L      +LREI I+++ R E  +A+II  YL  C
Sbjct:   73 LLKRKTQAGEMSTRLLEIAAEVLDTIDQGLNTARMELRNLSRENRELKANISYLIEKIYDVESRLASARESGAYWKFMRELLQLDHKLNTAGDESALWNACVPYDRLWDTEYAGFVSETTQTVLDKIDSGNMKDITALVEAIP-IREAQDKASYATVLQIIAQRCYQEECFKICLDVLNKSLTIRLSTYGSNHPIISASLNCLALVYGELGELETATRFALDALTILEKHLELSSNRSLMARQYMQTGQMLVSFNHVPEGIRSMQIAVGMWEDLLPREENYWCQAVNQMARTCNDNDYHDDAMGLGFDLIDYFHMKAFGSVSDRYPTIYEVAYAHELAHQNPQVVNLDLYPIGNPVHLSRPQQLALREIAISFACRGELKAAQIIATYLHLC 463          
BLAST of SMED30014948 vs. TrEMBL
Match: A0A074Z617 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_09416 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.853e-46
Identity = 129/399 (32.33%), Postives = 203/399 (50.88%), Query Frame = 3
Query:  327 VHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPLMPPEL-----LEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDE----AGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRA-DSATAKLIALNGPRPTYLP-PLVAASLREIIIAYSSRYEFGSARIIENYLKEC 1490
            V+  L  +SQ  +  ++  + V E     +    + + E ++ S ENR+LK  + Y I R+ + EG LA AKEE  +W  L  +  LD E    + +SE W     P   D L   E       EV  +I E   S A +++K+   ++K    + +    A +L L+A+R  E D+  +   ++D  +  R++T    HP IA TL   +I YG  KK   A K   +AL +++   +  +    +  QY   G  L  WG P+ GI++M+ ++   E LLP EE  W D I +MA+ CND  + DD MT+ C+++DY+H + +G  + + P I EVA   Q A  +    L   + P  + L  PLV A L+E+ IA++ R EF +A+II +YL  C
Sbjct:   68 VYAQLKFKSQTMVASTSLFVTVAECLMMAQQQTEQRQQELRKLSRENRELKADIAYSIERIHDAEGKLAAAKEETSYWHLLCSLSQLDYELYLAEDDSESW---YEPVRYDSLWNAEYAGSAGTEVNAIIAEVDYSSADELIKRI--NEKSTPDIQDIPTYASLLELVARRFFEVDDFDSCSVLLDKVITLRRQTYTDTHPIIAATLVCLSITYGGQKKFREAQKLIGDALDILKQHPEPGRYREIIAGQYKRIGQKLISWGQPQAGIRVMQQSMRLLEDLLPKEETQWCDVINRMARICNDRGYFDDAMTLLCDVVDYYHGRQHGHYAARIPTIVEVAYAHQLAKHNPVLDLSNFSIPPSSLLSRPLVTA-LKEVGIAFACRNEFTAAQIIASYLNAC 460          
BLAST of SMED30014948 vs. Ensembl Cavefish
Match: ENSAMXT00000055945.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 88.5817 bits (218), Expect = 5.450e-18
Identity = 114/454 (25.11%), Postives = 199/454 (43.83%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD----------GEEESDKLESEVWELVIHPDNKDPL--------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYLKECL---KLADPDIINSP-----LNDGEGNKDTKQN 1565
            +LGL ++  +I +     A+E+ + K+R + +R   EN+ L+ +L    ++L + E N+A+ +EE  H E +++IR  D          GE+E D L+    +L  + D++ P               +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  +ES L A++ +   T   +A TC     KF  D   +  E++   HEK +G ++  N PI+  A E  R +S   K  +  GP   Y           P V  +L+ +   Y  + +  +A  +E    EC    +    D IN       L DG    D +QN
Sbjct:   69 ELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDDDASPSEEKPGEKEKDNLD----DLFPNDDDQGPAQPSGEVAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLA-TCYLKQGKFK-DAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEE--REESKGKKKDS--GPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLE----ECATKNRKQGIDAINQSKVVELLKDGVPGGDRRQN 506          
BLAST of SMED30014948 vs. Ensembl Cavefish
Match: ENSAMXT00000055398.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 88.5817 bits (218), Expect = 5.450e-18
Identity = 114/454 (25.11%), Postives = 199/454 (43.83%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD----------GEEESDKLESEVWELVIHPDNKDPL--------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYLKECL---KLADPDIINSP-----LNDGEGNKDTKQN 1565
            +LGL ++  +I +     A+E+ + K+R + +R   EN+ L+ +L    ++L + E N+A+ +EE  H E +++IR  D          GE+E D L+    +L  + D++ P               +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  +ES L A++ +   T   +A TC     KF  D   +  E++   HEK +G ++  N PI+  A E  R +S   K  +  GP   Y           P V  +L+ +   Y  + +  +A  +E    EC    +    D IN       L DG    D +QN
Sbjct:   69 ELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDDDASPSEEKPGEKEKDNLD----DLFPNDDDQGPAQPSGEVAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLA-TCYLKQGKFK-DAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEE--REESKGKKKDS--GPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLE----ECATKNRKQGIDAINQSKVVELLKDGVPGGDRRQN 506          
BLAST of SMED30014948 vs. Ensembl Cavefish
Match: ENSAMXT00000032282.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 88.5817 bits (218), Expect = 5.450e-18
Identity = 114/454 (25.11%), Postives = 199/454 (43.83%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD----------GEEESDKLESEVWELVIHPDNKDPL--------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYLKECL---KLADPDIINSP-----LNDGEGNKDTKQN 1565
            +LGL ++  +I +     A+E+ + K+R + +R   EN+ L+ +L    ++L + E N+A+ +EE  H E +++IR  D          GE+E D L+    +L  + D++ P               +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  +ES L A++ +   T   +A TC     KF  D   +  E++   HEK +G ++  N PI+  A E  R +S   K  +  GP   Y           P V  +L+ +   Y  + +  +A  +E    EC    +    D IN       L DG    D +QN
Sbjct:   69 ELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDDDASPSEEKPGEKEKDNLD----DLFPNDDDQGPAQPSGEVAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLA-TCYLKQGKFK-DAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEE--REESKGKKKDS--GPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLE----ECATKNRKQGIDAINQSKVVELLKDGVPGGDRRQN 506          
BLAST of SMED30014948 vs. Ensembl Cavefish
Match: ENSAMXT00000031936.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 88.5817 bits (218), Expect = 5.450e-18
Identity = 114/454 (25.11%), Postives = 199/454 (43.83%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD----------GEEESDKLESEVWELVIHPDNKDPL--------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYLKECL---KLADPDIINSP-----LNDGEGNKDTKQN 1565
            +LGL ++  +I +     A+E+ + K+R + +R   EN+ L+ +L    ++L + E N+A+ +EE  H E +++IR  D          GE+E D L+    +L  + D++ P               +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  +ES L A++ +   T   +A TC     KF  D   +  E++   HEK +G ++  N PI+  A E  R +S   K  +  GP   Y           P V  +L+ +   Y  + +  +A  +E    EC    +    D IN       L DG    D +QN
Sbjct:   69 ELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDDDASPSEEKPGEKEKDNLD----DLFPNDDDQGPAQPSGEVAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLA-TCYLKQGKFK-DAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEE--REESKGKKKDS--GPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLE----ECATKNRKQGIDAINQSKVVELLKDGVPGGDRRQN 506          
BLAST of SMED30014948 vs. Ensembl Cavefish
Match: ENSAMXT00000044075.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 88.1965 bits (217), Expect = 6.438e-18
Identity = 111/451 (24.61%), Postives = 198/451 (43.90%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD----------GEEESDKLESEVWELVIHPDNKDPL--------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL------PPLVAASLREIIIAYSSRYEFGSARIIENYLKECL---KLADPDIINSP-----LNDGEGNKDTKQN 1565
            +LGL ++  +I +     A+E+ + K+R + +R   EN+ L+ +L    ++L + E N+A+ +EE  H E +++IR  D          GE+E D L+    +L  + D++ P               +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  +ES L A++ +   T   +A TC     KF  D   +  E++   HEK +G ++  N PI+  A E + +   T K     G   ++        P V  +L+ +   Y  + +  +A  +E    EC    +    D IN       L DG    D +QN
Sbjct:   69 ELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDDDASPSEEKPGEKEKDNLD----DLFPNDDDQGPAQPSGEVAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLA-TCYLKQGKFK-DAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEEREESKGKT-KDSGFYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLE----ECATKNRKQGIDAINQSKVVELLKDGVPGGDRRQN 506          
BLAST of SMED30014948 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009139.1 (pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 gene:ENSPMAG00000008222.1 transcript:ENSPMAT00000009139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 4.848e-12
Identity = 87/416 (20.91%), Postives = 178/416 (42.79%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGE----EESDKLESEVWELVIHPDNKDPL----------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            E+++ ++ V++ L  L  +H   +E     L  +   ++ D+   + E   + +  +   +LGL ++  ++ +     ++E  + K+R + +R   EN  L+ +L     RL   E ++A+ +EE  H + + ++R  D E    EE D   S+     + P+++D                        +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D    ++ +Q           G  E+       AL  +   L  ++ +   T   +A        + D   +  E++   HE+ +G +  +N PI+  A E
Sbjct:   19 EILSNTRVVMQGLEALRNEHHSILESLITTLSCL---NRADEGSLVSEKTGIIQHSLDSIELGLSEAQVIVALASHLGSVEAEKQKLRAQVRRLCQENAWLREELATAQQRLQRSEQSVAQLEEENRHLQFMGQLRKYDDEASPPEEKDGESSKEPLDDLFPNDEDEQSSSMTQSRGMSGAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAGNLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHP--DVAKQLNNLALLCQNQGKYEEVETYYRRALDIYLLQLGTDDPNVAKTKNNLASCYLKQGKYKDAEALYKEILTRAHEREFGSVDGENKPIWVHAEE 429          
BLAST of SMED30014948 vs. Ensembl Sea Lamprey
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 65.0846 bits (157), Expect = 2.499e-11
Identity = 96/455 (21.10%), Postives = 187/455 (41.10%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPL-----------------------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL------PPLVAASLREIIIAYSSRYEFGSARIIENYLKECL---KLADPDIINSP-----LNDGEGNK 1550
            +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L     +L   E  +A+ +EE  H E +++++  D     D +     E V  P  K+PL                                   +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q              E+     + AL  ++S L  ++ +   T   +A        + +   +  +++   HEK +G +  +N PI+ + AE +       K     G   ++        P V  +L+ +   Y  + +  +A  +E    EC    +    D+I  P     LNDGE +K
Sbjct:   34 RLGLGEAQVMVALTSHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQAVAQLEEEKKHLEFMNQMKKYD-----DDISPSQEEKVSEP-CKEPLDDLFPNEEDEQEQGSQPSHNAVNSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKVHPDVAKQLNNLALLCQNQSKYEEVEHYYQRALDIYQSQLGPDDPNVAKTKNNLASCYLKQGKYKEAEGLYKDILTRAHEKEFGSVDGENKPIW-MHAEEREEQKGKHKESPPYGEYGSWYKACKVDSPTVGTTLKNLSALYRRQGKLEAAETLE----ECAARSRRQGVDVIRQPRVADILNDGEQDK 475          
BLAST of SMED30014948 vs. Ensembl Nematostella
Match: EDO43009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV0])

HSP 1 Score: 54.6842 bits (130), Expect = 7.643e-8
Identity = 71/312 (22.76%), Postives = 139/312 (44.55%), Query Frame = 3
Query:  174 EVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYEL-LTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPL---------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTD 1022
            E++  +K VV  L  L  +H   +      L +  ++  E +  EL E    V +  + + +LGL ++  L+ +      +E  + K+R + KR   EN  L+ +L+    +L E E ++A+ +EE  H E ++ ++  D +E    +E+++   ++  D  D                       +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  ++  A+  R++TL  +HP +A TL+  A++YGK  K   A      AL++ E     D
Sbjct:   14 EIINNTKNVVRGLETLKNEHSGILNG----LALYEDTKTESQ-SELEEAKAGVVQDSLDKIELGLGEAQVLMALCSHLSTVEAEKQKLRAQVKRLCQENAWLREELSVTQQKLQESEQSVAQLEEEKKHLEFMNSLKKYDDDE---GIENDISSDILSQDEDDHDVDDETLSQTSNVSASTSGVYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLHDALTIREKTLGEDHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKD 317          
BLAST of SMED30014948 vs. Ensembl Medaka
Match: ENSORLT00000016251.2 (kinesin light chain 1 [Source:NCBI gene;Acc:101171520])

HSP 1 Score: 67.781 bits (164), Expect = 1.847e-11
Identity = 109/526 (20.72%), Postives = 220/526 (41.83%), Query Frame = 3
Query:  162 MGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-----GEEESDK-------------LESEVWELVIHPDNKDPL---------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYL---------PPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSLFSSK 1610
            +   E+++ +K V++ L  L  +H   +    + +  +    + + + E   LL     ++   +LGL ++  ++ +    +A+E+ + K+R + +R   EN+ L+ +L     +L + E N+A+ +EE  H E +++++  D      +EE D+              + E  + + H  N   +         +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A++ R++TL  +HP +A TL+  A++YGK  K   A      AL++ E      K   ++ +Q           G  E+       AL  +E  L  ++ +   T   +A        + +   +  E++   HEK +G +  +N PI+  A E +       +    N P   Y           P V  +LR +   Y  + +  +A  +E    EC   +    I+ P++     +  K     RR +R SL S K
Sbjct:   15 LSQEEIISNTKLVIQGLEALKNEHNSILHSLLETIKCLKKDEEANLVHEKANLLRKSVEMI---ELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQNVAQLEEEKKHLEFMNQLKKYDEDVSPTQEEKDRETPKDSLDDLFPNEDEENNQGMQHQHNSAAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVL--GKEHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALEIYECRLGPDDPNVAKTKNNLASCFLKQGKYKEAEILYKEILTRAHEKEFGSVDAENKPIWMHAEEREEMSKGKHR---DNTPYGEYGGWYKACKVNSPTVNTTLRNLGALYRRQGKLEAAETLE----ECAVRSRKQGID-PIHQSRVVEILKDTDGDRRRSRDSLASVK 527          
BLAST of SMED30014948 vs. Ensembl Medaka
Match: klc3 (kinesin light chain 1 [Source:NCBI gene;Acc:101163426])

HSP 1 Score: 65.855 bits (159), Expect = 6.662e-11
Identity = 78/356 (21.91%), Postives = 153/356 (42.98%), Query Frame = 3
Query:  342 MSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEE--SDKLE-SEVWEL--VIHPDNKDPL-------------------MPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVA 1316
            + R +LGL ++  ++ +     +LE  + K+R + +R   EN+ L+ +L     RL + E  +   +E+  H + +S +R  D +E    DK   S    L  +   D+++P                    +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E    TD    ++ +Q           G  ++  +  E AL  ++S L  ++ +   T   +A        +     +  E++   HEK +G +     P +  A
Sbjct:   59 LERIELGLSEAQVMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELANAQQRLQDTEQQVVTLEEQNRHLQFMSSMRKYDQDEPPVDDKQNFSNKGSLDDLFPADDEEPSQMSQPHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHTHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGMDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHP--DVAKQLNNLALLCQNQGKYQEVEQYYERALHIYQSKLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDGHPSWSGA 412          
BLAST of SMED30014948 vs. Ensembl Medaka
Match: klc3 (kinesin light chain 1 [Source:NCBI gene;Acc:101163426])

HSP 1 Score: 65.855 bits (159), Expect = 6.787e-11
Identity = 71/325 (21.85%), Postives = 144/325 (44.31%), Query Frame = 3
Query:  342 MSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEV------WELVIHPDNKDPLMPPELLEVQDMI----NEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYG 1277
            + R +LGL ++  ++ +     +LE  + K+R + +R   EN+ L+ +L     RL + E  +   +E+  H + +S +R  D ++E   +  E+      +            +P  L  + +++    ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++ E    TD    ++ +Q           G  ++  +  E AL  ++S L  ++ +   T   +A        +     +  E++   HEK +G
Sbjct:   73 LERIELGLSEAQVMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELANAQQRLQDTEQQVVTLEEQNRHLQFMSSMRKYD-QDEPPVVRKEIPLAGFPYSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHTHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGMDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHP--DVAKQLNNLALLCQNQGKYQEVEQYYERALHIYQSKLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFG 394          
BLAST of SMED30014948 vs. Ensembl Medaka
Match: ENSORLT00000010217.2 (kinesin light chain 2 [Source:NCBI gene;Acc:101159385])

HSP 1 Score: 65.4698 bits (158), Expect = 8.747e-11
Identity = 84/365 (23.01%), Postives = 155/365 (42.47%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-------------------GEEESDKLESEVWELVIHPDNKDPLMPPELLEVQ------------------DMINEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            +LGL ++  +I +     A+E+ + K+R + +R   EN+ L+ +L    ++L   E ++A+ +EE  H E +++I+  D                   GE   D L+    +L  + D++ P  P   +  Q                     ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++        K   ++ +Q           G  ++       AL  + S L  ++ +   T   +A TC     KF  D   +  E++   HEK +G ++  N PI+  A E
Sbjct:   69 ELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELAATQHKLHCSEQSVAQLEEEKKHLEFMNQIKKFDDDASPAEEKNQSCGDGAGAGEASKDSLD----DLFPNDDDQGPAQPSGDVAAQHAGYEIPVRLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRVKVL--GKLHPDVAKQLNNLALLCQNQGKYDEVEYYYTQALEIYVSQLGPDDPNVAKTKNNLA-TCYLKQGKFK-DAEVLYKEILTRAHEKEFGSVNNDNKPIWMHAEE 425          
BLAST of SMED30014948 vs. Ensembl Medaka
Match: ENSORLT00000010213.2 (kinesin light chain 2 [Source:NCBI gene;Acc:101159385])

HSP 1 Score: 65.0846 bits (157), Expect = 1.164e-10
Identity = 84/365 (23.01%), Postives = 155/365 (42.47%), Query Frame = 3
Query:  354 QLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLD-------------------GEEESDKLESEVWELVIHPDNKDPLMPPELLEVQ------------------DMINEGQVSEAVKVVKQYAQS---KKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTC--NDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAE 1322
            +LGL ++  +I +     A+E+ + K+R + +R   EN+ L+ +L    ++L   E ++A+ +EE  H E +++I+  D                   GE   D L+    +L  + D++ P  P   +  Q                     ++G+   AV + KQ  +      G    D A +L +LA    +++    +  +++ A+A R++TL  +HP +A TL+  A++YGK  K   A      AL++        K   ++ +Q           G  ++       AL  + S L  ++ +   T   +A TC     KF  D   +  E++   HEK +G ++  N PI+  A E
Sbjct:   69 ELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELAATQHKLHCSEQSVAQLEEEKKHLEFMNQIKKFDDDASPAEEKNQSCGDGAGAGEASKDSLD----DLFPNDDDQGPAQPSGDVAAQHAGYEIPVRLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRVKVL--GKLHPDVAKQLNNLALLCQNQGKYDEVEYYYTQALEIYVSQLGPDDPNVAKTKNNLA-TCYLKQGKFK-DAEVLYKEILTRAHEKEFGSVNNDNKPIWMHAEE 425          
BLAST of SMED30014948 vs. Planmine SMEST
Match: SMESG000057287.1 (SMESG000057287.1)

HSP 1 Score: 1113.98 bits (2880), Expect = 0.000e+0
Identity = 541/541 (100.00%), Postives = 541/541 (100.00%), Query Frame = 3
Query:   63 MKSGLRVGRGRKLKTKDSNASLLSFSVAGGKKDMGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSLFSSKKGIVNMKETKVNPKTIEEKINKAAK 1685
            MKSGLRVGRGRKLKTKDSNASLLSFSVAGGKKDMGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSLFSSKKGIVNMKETKVNPKTIEEKINKAAK
Sbjct:    1 MKSGLRVGRGRKLKTKDSNASLLSFSVAGGKKDMGATEVVTMSKKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADPDIINSPLNDGEGNKDTKQNLITRRLARQSLFSSKKGIVNMKETKVNPKTIEEKINKAAK 541          
BLAST of SMED30014948 vs. Planmine SMEST
Match: SMESG000045513.1 (SMESG000045513.1)

HSP 1 Score: 128.257 bits (321), Expect = 4.050e-31
Identity = 98/391 (25.06%), Postives = 193/391 (49.36%), Query Frame = 3
Query:  375 NFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPLMPPELL----EVQDMINEGQVSEAVKVVKQY-AQSKKGKKSVDE-----AGVLCLLAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPN-IAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTR-NLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADPD 1511
            N ++   ++ ++LE    + R + +     N+ LK +L      L+  E  L   +E       +  +   D E+E   +E E+W+  I+  +K  L    +L    ++ ++IN   +SE +    +Y   S  G+   +E     A    L++K C +  N + S++   +    + ++L    P  ++  ++  +++  K  ++  A     E+L+++ES  ++D+  + NL  QY+  G+  +     +DGI+LMEL ++T+ SLLP EE  W++++ K+A+ CND  + +DT+ +C +LI YFH K Y      N  I+++A + +     T   I +  P P  LP  V  ++ E++I ++    F  A ++ ++LK C  + + D
Sbjct:   74 NTVLTCIDVLESLEASIKRCRAKNRELVNANKSLKDQLNKAEKELLTKEERLITIEERSQFCNEMIMLIKYDVEKEIADIEYEIWDQCIY--DKLNLNSTYILKHYSQLVELINSNLLSETMNYADKYLINSHNGRLEKEEIRYQKALSFLLVSKFCYDTSNFSESLKF-GMEALHQSKSLNIEKPRFLSKVMACISLVLLKNNETTKALFYVSESLKLLESISESDQDKKSNLADQYVKLGYIFSNSCLNKDGIELMELGVVTYSSLLPEEEQHWVESLSKLARVCNDWNYIEDTLIICEKLIVYFHNKRYSSDFAFNRNIFDIAVDVEEK-RKTGNSIEVEVPIPVNLPQYVQIAISELVIIFAKHNLFTGASLLSSWLKYCQTVENDD 460          
BLAST of SMED30014948 vs. Planmine SMEST
Match: SMESG000051588.1 (SMESG000051588.1)

HSP 1 Score: 117.087 bits (292), Expect = 2.295e-27
Identity = 102/470 (21.70%), Postives = 209/470 (44.47%), Query Frame = 3
Query:  192 KKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRF-SVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGV---LCLLAKR-----CSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLKLADPDIINSPLNDGEGNKDTKQNLIT 1574
            +K++EKL+FL  Q +   + ++K  +   ++    K+ ++ E + +H  ++S S+  L  S F+    E+ + L       + E K   +V   +LK    Y  + +I+ E +          W  L+ +                        + D   P  LL++ + ++E  ++     ++ Y    +  ++++   +   L  LA R     C   D ++    ++ LA A  +E  ++N+                 +K+G  ++ A   L  ++   ++ KS            FF  KW F E+G+ ++E     FE   P  E+ W   +V +A+  N+    D     C ++I  +H +++GPI++K+ PIYE   +      A+++L+        +LPP +   L+E+II Y+++  F + R +E+Y+ +C++    + I+S  ++ E NKD  +++IT
Sbjct:   24 QKIIEKLTFLHFQQKNINDTARKDFHEKLSTTHFSKVIDISEFIEIHNEILSLSKTILSSSIFIQFTMEIMNTLWIIHNNFKAETKNIMNVYKINLKMSTNY--DEMIQYEKDF---------WSILTSV------------------------SPDASFPKYLLKIDENLSEKNLNTIESNIRVYLIEGRTDENINSPIIGSNLIELASRLLLNFC---DKTSIKFNLLPLAEAFCQE-YQNNY-----------------EKAGAFARKALRNLANIQHLNESQKSYLKFKM-----AFFFIKWKFVEEGLFMLEETSCYFERHFPDTEILWRKNMVTLARFYNEFHKSDFAYNTCVKIIKKYHVQLFGPITQKSKPIYETVTDIFAKTYASSQLMETISGHSEFLPPYLVDILKELIIVYAAKKNFNAVRFVEHYMIDCIESYKVNGISS--DEHEDNKDFWRHIIT 430          
BLAST of SMED30014948 vs. Planmine SMEST
Match: SMESG000051588.1 (SMESG000051588.1)

HSP 1 Score: 110.923 bits (276), Expect = 8.597e-26
Identity = 94/444 (21.17%), Postives = 194/444 (43.69%), Query Frame = 3
Query:  192 KKVVEKLSFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRF-SVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGV---LCLLAKR-----CSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKECLK 1496
            +K++EKL+FL  Q +   + ++K  +   ++    K+ ++ E + +H  ++S S+  L  S F+    E+ + L       + E K   +V   +LK    Y  + +I+ E +          W  L+ +                        + D   P  LL++ + ++E  ++     ++ Y    +  ++++   +   L  LA R     C   D ++    ++ LA A  +E  ++N+                 +K+G  ++ A   L  ++   ++ KS            FF  KW F E+G+ ++E     FE   P  E+ W   +V +A+  N+    D     C ++I  +H +++GPI++K+ PIYE   +      A+++L+        +LPP +   L+E+II Y+++  F + R +E+Y+ +C++
Sbjct:   24 QKIIEKLTFLHFQQKNINDTARKDFHEKLSTTHFSKVIDISEFIEIHNEILSLSKTILSSSIFIQFTMEIMNTLWIIHNNFKAETKNIMNVYKINLKMSTNY--DEMIQYEKDF---------WSILTSV------------------------SPDASFPKYLLKIDENLSEKNLNTIESNIRVYLIEGRTDENINSPIIGSNLIELASRLLLNFC---DKTSIKFNLLPLAEAFCQE-YQNNY-----------------EKAGAFARKALRNLANIQHLNESQKSYLKFKM-----AFFFIKWKFVEEGLFMLEETSCYFERHFPDTEILWRKNMVTLARFYNEFHKSDFAYNTCVKIIKKYHVQLFGPITQKSKPIYETVTDIFAKTYASSQLMETISGHSEFLPPYLVDILKELIIVYAAKKNFNAVRFVEHYMIDCIE 406          
BLAST of SMED30014948 vs. Planmine SMEST
Match: SMESG000022908.1 (SMESG000022908.1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.571e-19
Identity = 96/425 (22.59%), Postives = 180/425 (42.35%), Query Frame = 3
Query:  273 MANSHKEDKLCELYELLTVHKVLMSRSQLGLYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLIEMEGNLAKAKEEMYHWET---------LSKIRLLDGEEESDKLESEVWELVI--HPDNKDPLMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCL--LAKRCSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSGLASKCAFEALQVMESFYKTDKSTRNLGRQYIIS------GFFLAKWGFPEDGIKLMELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFHEKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASLREIIIAYSSRYEFGSARIIENYLKEC 1490
            + NS  +D++  L+ L   +  L++  + G+  +N ++     ++   N + K+  E       N  L+  L+ + N+ I       K K    H +T          S   L +     +  E+ +W + +  + D +   +P +LL+V+   N  Q  + V  V+ +A++     +  +A V+ L  LAK   +  N   +   ID  +   K           F    KA++ G+ K+         E+++++ S     K      + ++I+      G  L  WG  E G++++  A++ FE  LP     W +  +  A+  ND       + +   L DYFH   +G I   N P+YE+A E      +    +  N   P +LP  ++  L E+II++S   +  SA I+EN++  C
Sbjct:   50 IYNSKTKDEIVFLFFLRDAYDELLNLLENGILTANIIVEFMRYSNMQTNQKLKLEKE-------NNFLRKSLSKMGNQFIVSH---QKYKNLNIHQDTKEIELNHLGFSLYILDEFHFNKESTENSLWNIAVGNNLDEQYRNLPIDLLKVKWFCN--QEDDDVSCVQSFAENFHPTNNNIKALVINLGYLAKSFYDCCNFKCASYFIDTIIQLMKVNKLDGQTRFCFYQFCKALLLGRMKQYESGYNLFMESIELIRS-----KEGIAFEKDFLIACQILNVGCVLTNWGVCEIGVEIVAFAVMMFEDNLPETYSKWEEASILSARFYNDNNEFKKALKIAAPLFDYFHILNFGSIKDTNKPLYELAIELTIG--SKVHTVTKNLKYPLFLPKNISILLIEMIISFSGLGDRSSAMILENWMNRC 455          
The following BLAST results are available for this feature:
BLAST of SMED30014948 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLC25.039e-1523.19kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC25.039e-1523.19kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC25.039e-1523.19kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC11.138e-1321.58kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC11.171e-1321.58kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc-23.277e-1220.09Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-23.277e-1220.09Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-24.472e-1220.14Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-24.472e-1220.14Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-25.247e-1220.14Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Klc6.430e-1422.06gene:FBgn0010235 transcript:FBtr0075951[more]
Klc6.430e-1422.06gene:FBgn0010235 transcript:FBtr0331555[more]
Klc6.940e-1422.06gene:FBgn0010235 transcript:FBtr0331556[more]
back to top
BLAST of SMED30014948 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc1a1.041e-1222.12kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc1a1.230e-1222.12kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc47.533e-1121.94kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc47.533e-1121.94kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc39.149e-1121.63kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hira3.148e-722.70histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira2.065e-622.52histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira2.179e-622.52histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira2.215e-622.52histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira2.668e-622.52histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klc22.946e-1623.29kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc22.946e-1623.29kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc22.946e-1623.29kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc21.611e-1523.19kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc11.062e-1321.58kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of SMED30014948 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88448|KLC2_MOUSE1.249e-1422.95Kinesin light chain 2 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9H0B6|KLC2_HUMAN2.420e-1423.19Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=K... [more]
sp|P37285|KLC1_RAT4.625e-1321.58Kinesin light chain 1 OS=Rattus norvegicus OX=1011... [more]
sp|P46824|KLC_DROME6.446e-1322.06Kinesin light chain OS=Drosophila melanogaster OX=... [more]
sp|Q07866|KLC1_HUMAN8.975e-1321.58Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=K... [more]
back to top
BLAST of SMED30014948 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448WKR21.229e-6331.03Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A183ASJ79.657e-5430.13Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A504YIB11.595e-5029.34Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A2H1CLL57.913e-5029.34Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A074Z6174.853e-4632.33Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000055945.15.450e-1825.11kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000055398.15.450e-1825.11kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000032282.15.450e-1825.11kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000031936.15.450e-1825.11kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000044075.16.438e-1824.61kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009139.14.848e-1220.91pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 ge... [more]
klc1a2.499e-1121.10kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014948 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO430097.643e-822.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30014948 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000016251.21.847e-1120.72kinesin light chain 1 [Source:NCBI gene;Acc:101171... [more]
klc36.662e-1121.91kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
klc36.787e-1121.85kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
ENSORLT00000010217.28.747e-1123.01kinesin light chain 2 [Source:NCBI gene;Acc:101159... [more]
ENSORLT00000010213.21.164e-1023.01kinesin light chain 2 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of SMED30014948 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057287.10.000e+0100.00SMESG000057287.1[more]
SMESG000045513.14.050e-3125.06SMESG000045513.1[more]
SMESG000051588.12.295e-2721.70SMESG000051588.1[more]
SMESG000051588.18.597e-2621.17SMESG000051588.1[more]
SMESG000022908.12.571e-1922.59SMESG000022908.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014948 ID=SMED30014948|Name=SMED30014948|organism=Schmidtea mediterranea sexual|type=transcript|length=1834bp
ATTACGATAATATTTTACTATAAATTATCATTATTTTATTGATAATTTAA
ATACATCCTGAAATGAAATCTGGATTGAGAGTAGGCCGTGGGAGAAAGCT
TAAAACAAAAGATTCTAATGCATCTCTTTTGTCCTTTTCTGTTGCTGGGG
GCAAAAAAGATATGGGTGCCACTGAAGTAGTGACAATGTCAAAGAAAGTT
GTAGAAAAACTCAGCTTTTTAGTTACACAGCACCGAGAATTTGTAGAGAA
ATCTCAGAAACAACTTTACATAATGGCCAACTCGCATAAAGAAGATAAAC
TCTGTGAATTATATGAGCTACTAACAGTTCATAAAGTGCTTATGAGCCGA
TCACAATTAGGATTATACGATTCAAATTTTCTAATTCACGTTGGAGAGTT
GACAGATGCCTTAGAGAATCACAGAACTAAAATAAGAACTGAAGCTAAGA
GATTTTCTGTTGAAAATAGAGACCTAAAAACTAAACTCACTTATTTGATT
AATAGATTAATAGAAATGGAAGGAAATTTGGCCAAAGCTAAAGAAGAAAT
GTACCACTGGGAAACATTATCAAAGATAAGACTCTTAGATGGAGAAGAGG
AATCTGATAAATTAGAATCTGAGGTATGGGAACTGGTAATTCATCCTGAT
AATAAAGACCCGCTTATGCCTCCTGAACTTCTAGAAGTTCAAGACATGAT
TAATGAAGGCCAAGTCTCTGAGGCTGTCAAGGTTGTGAAACAGTATGCGC
AATCCAAAAAAGGTAAAAAGAGTGTTGATGAAGCAGGGGTATTATGCTTA
TTGGCTAAGCGATGTTCAGAAGAAGATAATTCAACTACATCCGTTGAAAT
AATAGACTTAGCCGTTGCTTCACGTAAAGAAACGTTGGAATCAAATCACC
CTAATATAGCATTTACTTTGTCTGCAAAGGCTATTATTTATGGCAAAGCA
AAGAAATCTGGTTTAGCATCGAAATGCGCATTTGAAGCTTTACAAGTAAT
GGAATCATTTTACAAGACAGATAAAAGCACTAGAAATCTCGGTCGACAAT
ATATAATAAGTGGATTCTTTTTAGCTAAATGGGGATTTCCTGAAGATGGA
ATAAAATTGATGGAACTAGCTTTATTGACATTTGAGTCATTGCTGCCAGC
TGAAGAAGTTTCATGGATGGATACCATTGTAAAAATGGCAAAAACATGCA
ATGACTGTAAATTTCATGATGATACCATGACAGTTTGTTGTGAATTGATA
GATTATTTCCACGAAAAGATATATGGCCCGATATCTAAAAAGAATCCACC
AATTTATGAAGTGGCCGCTGAATGTCAACGAGCCGATTCAGCCACTGCTA
AACTAATAGCGCTGAATGGCCCAAGACCGACGTATTTGCCACCTTTAGTT
GCAGCATCCCTTAGAGAAATAATAATAGCTTATTCGTCTCGATATGAGTT
CGGCTCCGCTAGAATAATAGAAAATTATTTAAAAGAATGTCTGAAACTGG
CTGATCCTGATATCATCAATTCACCTCTGAATGATGGTGAAGGCAACAAA
GATACGAAACAGAACTTAATAACCAGACGACTCGCCCGACAAAGCCTTTT
TAGTAGTAAAAAAGGTATTGTAAATATGAAAGAAACGAAAGTTAATCCGA
AAACGATAGAAGAGAAAATTAACAAAGCTGCCAAATGATGTTTTCTGAAT
TATTTTGTAATAATTGCTTTGGATGCATTTTAATATTGAGTCTTGTTCTT
TTACTTCAAGAGTTTTTATTTTTCTTTACCTATAAAAATATTTCATTTGA
TAACCGAATAAAATTTGATGATCTTGAAAAAAAA
back to top

protein sequence of SMED30014948-orf-1

>SMED30014948-orf-1 ID=SMED30014948-orf-1|Name=SMED30014948-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
MKSGLRVGRGRKLKTKDSNASLLSFSVAGGKKDMGATEVVTMSKKVVEKL
SFLVTQHREFVEKSQKQLYIMANSHKEDKLCELYELLTVHKVLMSRSQLG
LYDSNFLIHVGELTDALENHRTKIRTEAKRFSVENRDLKTKLTYLINRLI
EMEGNLAKAKEEMYHWETLSKIRLLDGEEESDKLESEVWELVIHPDNKDP
LMPPELLEVQDMINEGQVSEAVKVVKQYAQSKKGKKSVDEAGVLCLLAKR
CSEEDNSTTSVEIIDLAVASRKETLESNHPNIAFTLSAKAIIYGKAKKSG
LASKCAFEALQVMESFYKTDKSTRNLGRQYIISGFFLAKWGFPEDGIKLM
ELALLTFESLLPAEEVSWMDTIVKMAKTCNDCKFHDDTMTVCCELIDYFH
EKIYGPISKKNPPIYEVAAECQRADSATAKLIALNGPRPTYLPPLVAASL
REIIIAYSSRYEFGSARIIENYLKECLKLADPDIINSPLNDGEGNKDTKQ
NLITRRLARQSLFSSKKGIVNMKETKVNPKTIEEKINKAAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003777microtubule motor activity
Vocabulary: cellular component
TermDefinition
GO:0005871kinesin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 142..162
NoneNo IPR availablePANTHERPTHR45783FAMILY NOT NAMEDcoord: 34..183
NoneNo IPR availablePANTHERPTHR45783:SF2KINESIN LIGHT CHAIN 2coord: 34..183
NoneNo IPR availablePANTHERPTHR45783FAMILY NOT NAMEDcoord: 220..422
NoneNo IPR availablePANTHERPTHR45783:SF2KINESIN LIGHT CHAIN 2coord: 220..422
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 209..441
e-value: 2.3E-13
score: 51.7