Gelsolin

Overview
NameGelsolin
Smed IDSMED30014940
Uniprot Best hitGelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1 (E=6.02566e-33)
Length (bp)530
Neoblast Clusters

Zeng et. al., 2018


 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Gelsolin vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 69.3218 bits (168), Expect = 1.907e-14
Identity = 32/76 (42.11%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  303 VKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            + K SA+ + +  +    T PGL +WRIE  +++ +P   FG F++GD YIIL I+K   S  L YD+H+WIG+ S
Sbjct:    1 MTKLSAQVKGSLNI----TTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASS--LSYDIHYWIGQDS 70          
BLAST of Gelsolin vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 69.707 bits (169), Expect = 1.305e-13
Identity = 29/58 (50.00%), Postives = 40/58 (68.97%), Query Frame = 3
Query:  357 TVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            T PGL +WRIE  +++ +P   FG F++GD YIIL I+K   S  L YD+H+WIG+ S
Sbjct:   15 TTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASS--LSYDIHYWIGQDS 70          
BLAST of Gelsolin vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 68.9366 bits (167), Expect = 3.984e-13
Identity = 29/58 (50.00%), Postives = 40/58 (68.97%), Query Frame = 3
Query:  357 TVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            T PGL +WRIE  +++ +P   FG F++GD YIIL I+K   S  L YD+H+WIG+ S
Sbjct:   15 TTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASS--LSYDIHYWIGQDS 70          
BLAST of Gelsolin vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 60.8474 bits (146), Expect = 4.642e-11
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            KA   PGL +WR+EKF ++ +P   +G F+ GD+Y+ILK  +  +   L YD+H+W+G
Sbjct:   10 KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLG 66          
BLAST of Gelsolin vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 60.4622 bits (145), Expect = 4.877e-11
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            KA   PGL +WR+EKF ++ +P   +G F+ GD+Y+ILK  +  +   L YD+H+W+G
Sbjct:   21 KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLG 77          
BLAST of Gelsolin vs. Ensembl Celegans
Match: gsnl-1 (Gelsolin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21253])

HSP 1 Score: 47.7506 bits (112), Expect = 1.225e-6
Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 3
Query:  366 GLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGK 524
            GL VWRI KF +  +P+ + G FY GD+YI L    +       +DVHFW+GK
Sbjct:   18 GLLVWRINKFVLEPVPEVDHGVFYIGDAYIALYQKYDG-----CWDVHFWLGK 65          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225])

HSP 1 Score: 65.4698 bits (158), Expect = 2.824e-12
Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  345 AKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            A A   PGL +WRIE F+ +  PK  +GKFY GDS+I+L   + +   +L +DVHFW+G
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLG 122          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225])

HSP 1 Score: 65.4698 bits (158), Expect = 2.824e-12
Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  345 AKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            A A   PGL +WRIE F+ +  PK  +GKFY GDS+I+L   + +   +L +DVHFW+G
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLG 122          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225])

HSP 1 Score: 65.4698 bits (158), Expect = 2.824e-12
Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  345 AKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            A A   PGL +WRIE F+ +  PK  +GKFY GDS+I+L   + +   +L +DVHFW+G
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLG 122          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225])

HSP 1 Score: 65.4698 bits (158), Expect = 2.824e-12
Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  345 AKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            A A   PGL +WRIE F+ +  PK  +GKFY GDS+I+L   + +   +L +DVHFW+G
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLG 122          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225])

HSP 1 Score: 65.4698 bits (158), Expect = 2.986e-12
Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  345 AKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            A A   PGL +WRIE F+ +  PK  +GKFY GDS+I+L   + +   +L +DVHFW+G
Sbjct:   52 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLG 110          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 69.3218 bits (168), Expect = 1.573e-13
Identity = 30/60 (50.00%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKY 527
            +A   PGL VWRIEKF ++++P+  +G FY GD+Y++LK  K+  S  L YD+HFW+G Y
Sbjct:    9 RAGKEPGLQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQT-SGNLQYDLHFWLGDY 67          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 69.3218 bits (168), Expect = 1.849e-13
Identity = 30/60 (50.00%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKY 527
            +A   PGL VWRIEKF ++++P+  +G FY GD+Y++LK  K+  S  L YD+HFW+G Y
Sbjct:    9 RAGKEPGLQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQT-SGNLQYDLHFWLGDY 67          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 69.3218 bits (168), Expect = 1.972e-13
Identity = 30/60 (50.00%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKY 527
            +A   PGL VWRIEKF ++++P+  +G FY GD+Y++LK  K+  S  L YD+HFW+G Y
Sbjct:    9 RAGKEPGLQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQT-SGNLQYDLHFWLGDY 67          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 63.5438 bits (153), Expect = 2.323e-12
Identity = 25/56 (44.64%), Postives = 38/56 (67.86%), Query Frame = 3
Query:  357 TVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGK 524
            T PGL +WR+E  +++  P + FG+F+ GDSY+IL  +K   S    YD+H+W+GK
Sbjct:   16 TTPGLQIWRVENMELVPCPSKTFGQFFEGDSYVILYTHK--TSNNFSYDIHYWLGK 69          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 64.3142 bits (155), Expect = 8.661e-12
Identity = 27/59 (45.76%), Postives = 41/59 (69.49%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGK 524
            KA    GL +WRIEK +++ +P+  +G FY GD+Y++L   K++DS    YD+HFW+GK
Sbjct:   10 KAGKYSGLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSS--FYDLHFWLGK 66          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: gsn (gelsolin [Source:Xenbase;Acc:XB-GENE-489535])

HSP 1 Score: 65.4698 bits (158), Expect = 1.557e-12
Identity = 26/58 (44.83%), Postives = 41/58 (70.69%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            KA   PGL VWR+EKF ++++P+ ++G F+ GD+Y++L   K   S  L YD+H+W+G
Sbjct:   13 KAGKAPGLQVWRVEKFDLVAVPQNQYGSFFTGDAYLVLSTIKTR-SGNLQYDLHYWLG 69          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: avil (advillin [Source:Xenbase;Acc:XB-GENE-489888])

HSP 1 Score: 64.3142 bits (155), Expect = 4.237e-12
Identity = 28/56 (50.00%), Postives = 37/56 (66.07%), Query Frame = 3
Query:  363 PGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            PGL +WRIEK  ++ +PK+  G FY GD Y++L   K   S  L YD+H+WIGK S
Sbjct:   12 PGLIIWRIEKMDLVLVPKKAEGNFYEGDCYLLLHTKKSGSS--LFYDIHYWIGKES 65          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: vil1 (villin 1 [Source:Xenbase;Acc:XB-GENE-965127])

HSP 1 Score: 60.8474 bits (146), Expect = 5.129e-11
Identity = 22/58 (37.93%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  357 TVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            T PGL +WR+E   ++ +P+  +G F++GD Y++L  +K  ++    YD+HFW+G  S
Sbjct:   15 TTPGLQIWRVESMNLVPVPENSYGNFFDGDCYVLLMTHKTGNN--FTYDIHFWVGNDS 70          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: vil1 (villin 1 [Source:Xenbase;Acc:XB-GENE-965127])

HSP 1 Score: 60.8474 bits (146), Expect = 5.514e-11
Identity = 22/58 (37.93%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  357 TVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            T PGL +WR+E   ++ +P+  +G F++GD Y++L  +K  ++    YD+HFW+G  S
Sbjct:   15 TTPGLQIWRVESMNLVPVPENSYGNFFDGDCYVLLMTHKTGNN--FTYDIHFWVGNDS 70          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: vill (villin-like [Source:Xenbase;Acc:XB-GENE-945607])

HSP 1 Score: 57.7658 bits (138), Expect = 5.017e-10
Identity = 26/57 (45.61%), Postives = 41/57 (71.93%), Query Frame = 3
Query:  363 PGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPE-LLYDVHFWIGKYS 530
            PGL +W +EK K++ +P++ +G F+ GD YI+L  NK+  +P  L+ D+H+WIGK S
Sbjct:   12 PGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILL-YNKQ--TPNGLISDIHYWIGKDS 65          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Vil1 (villin 1 [Source:MGI Symbol;Acc:MGI:98930])

HSP 1 Score: 66.6254 bits (161), Expect = 1.684e-12
Identity = 26/58 (44.83%), Postives = 40/58 (68.97%), Query Frame = 3
Query:  357 TVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            T PG+ +WRIE  +++ +P   FG F++GD Y++L I+K   S  L YD+H+WIG+ S
Sbjct:   15 TTPGIQIWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHK--TSSTLSYDIHYWIGQDS 70          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 60.077 bits (144), Expect = 2.357e-11
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            KA   PGL +WR+EKF ++ +P   +G F+ GD+Y+ILK  +  +   L YD+H+W+G
Sbjct:   21 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLG 77          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 60.4622 bits (145), Expect = 3.489e-11
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            KA   PGL +WR+EKF ++ +P   +G F+ GD+Y+ILK  +  +   L YD+H+W+G
Sbjct:   10 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLG 66          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 60.4622 bits (145), Expect = 3.489e-11
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            KA   PGL +WR+EKF ++ +P   +G F+ GD+Y+ILK  +  +   L YD+H+W+G
Sbjct:   10 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLG 66          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 60.4622 bits (145), Expect = 1.291e-10
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  348 KATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIG 521
            KA   PGL +WR+EKF ++ +P   +G F+ GD+Y+ILK  +  +   L YD+H+W+G
Sbjct:   21 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLG 77          
BLAST of Gelsolin vs. UniProt
Match: sp|Q7JQD3|GELS1_LUMTE (Gelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 6.026e-33
Identity = 67/103 (65.05%), Postives = 73/103 (70.87%), Query Frame = 3
Query:  225 TGMIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINK-EEDSPELLYDVHFWIGKYS 530
            TG+IK K YDWKDSNLALFGSDTEK VKK SA TEPAW+ A      GL +WRI  FKV   P+ + GKFYNGDSYIIL   K +  S EL YDVHFWIG  S
Sbjct:    3 TGLIKAKEYDWKDSNLALFGSDTEKQVKKDSAATEPAWKGAGQKE--GLKIWRIVNFKVTEWPQNQHGKFYNGDSYIILNTYKPDPKSNELAYDVHFWIGSQS 103          
BLAST of Gelsolin vs. UniProt
Match: sp|Q24800|SEVE_ECHGR (Severin OS=Echinococcus granulosus GN=AG8 PE=2 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 8.249e-30
Identity = 52/102 (50.98%), Postives = 68/102 (66.67%), Query Frame = 3
Query:  225 TGMIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
             G++K K+YDWKDSN+ LFGS  ++ VKK SA TE  W      T P L VWR+ +F +  +P +E G FYNGDSY+I K  +     +LLY+VHFWIGK+S
Sbjct:    2 AGLVKAKDYDWKDSNMELFGSSKDRQVKKESAMTEKCWEPVGRATSPFLMVWRVNQFTLEPVPSDEIGNFYNGDSYVICKATRSPGGDKLLYNVHFWIGKHS 103          
BLAST of Gelsolin vs. UniProt
Match: sp|Q8MPM1|GELS2_LUMTE (Gelsolin-like protein 2 OS=Lumbricus terrestris GN=gelsolin PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.518e-26
Identity = 54/102 (52.94%), Postives = 68/102 (66.67%), Query Frame = 3
Query:  225 TGMIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            +G++K K YDWKDSNLA+FGS  +K VKK SA  E AW+        GL +WRI  FKV   P++++G F++GDSYIIL   K +   EL YDVHFWIG  S
Sbjct:    2 SGLVKAKRYDWKDSNLAMFGSALDKSVKKESALKEAAWKGVGEKV--GLKIWRIVNFKVTEWPEKDYGSFFSGDSYIILNTYKLKGREELAYDVHFWIGSKS 101          
BLAST of Gelsolin vs. UniProt
Match: sp|P10733|SEVE_DICDI (Severin OS=Dictyostelium discoideum GN=sevA PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 5.974e-20
Identity = 45/101 (44.55%), Postives = 67/101 (66.34%), Query Frame = 3
Query:  231 MIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWR-VAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            MIK +  D   +N+A  G+D +K  +  +A TE  W+ V +A   PGL +WRIE FKV+ +P+  +GKFY+GDSYIIL   KE +S  L +D+HF++G ++
Sbjct:    1 MIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVGQA---PGLKIWRIENFKVVPVPESSYGKFYDGDSYIILHTFKEGNS--LKHDIHFFLGTFT 96          
BLAST of Gelsolin vs. UniProt
Match: sp|Q10L71|VLN2_ORYSJ (Villin-2 OS=Oryza sativa subsp. japonica GN=VLN2 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.191e-14
Identity = 30/56 (53.57%), Postives = 40/56 (71.43%), Query Frame = 3
Query:  363 PGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            PG  +WRI+ FK + LPK ++GKFYNGDSYI+L+    +     L+D+HFWIGK S
Sbjct:   19 PGTEIWRIQDFKPVPLPKADYGKFYNGDSYIVLQTTCSKGGGAYLFDIHFWIGKDS 74          

HSP 2 Score: 44.2838 bits (103), Expect = 2.457e-4
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 3
Query:  369 LFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            L V+ +      +LPKEE GKFY+GD YI+L      D  E  Y + +WIGK S
Sbjct:  397 LEVYCVNGSAKTALPKEELGKFYSGDCYIVLYTYHSGDKREEFY-LTYWIGKDS 449          
BLAST of Gelsolin vs. TrEMBL
Match: tr|V3ZUV4|V3ZUV4_LOTGI (Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_214936 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.707e-39
Identity = 74/102 (72.55%), Postives = 81/102 (79.41%), Query Frame = 3
Query:  225 TGMIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            +G+IKQK YDWKDSNLALFGSD EK VKK SAETEPAW+   A  + G+ VWRI KFKV   PKEE+GKFYNGDSYIIL   KE DS EL YDVHFWIGK+S
Sbjct:    2 SGLIKQKEYDWKDSNLALFGSDVEKNVKKESAETEPAWK--NAGQMVGVQVWRIVKFKVTQWPKEEYGKFYNGDSYIILNTYKEADSNELQYDVHFWIGKHS 101          
BLAST of Gelsolin vs. TrEMBL
Match: tr|Q703I5|Q703I5_SUBFI (Gelsolin OS=Suberites ficus GN=gelS PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.910e-36
Identity = 71/102 (69.61%), Postives = 78/102 (76.47%), Query Frame = 3
Query:  225 TGMIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            +G +K K YDWKDSNLALFGSDTEK VKK SAETEPAW+ A      GL +WRI KFKV   P +E+G FYNGDSYIIL   KE+DS  LLYDVHFWIGKYS
Sbjct:    2 SGFVKPKKYDWKDSNLALFGSDTEKQVKKDSAETEPAWKGAGQEV--GLQIWRIVKFKVKHWPADEYGSFYNGDSYIILNTYKEKDSDALLYDVHFWIGKYS 101          
BLAST of Gelsolin vs. TrEMBL
Match: tr|K1PCV0|K1PCV0_CRAGI (Severin OS=Crassostrea gigas GN=CGI_10003628 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 9.839e-36
Identity = 70/100 (70.00%), Postives = 78/100 (78.00%), Query Frame = 3
Query:  231 MIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            MIKQK YDWKDSNLALFGSDTE+ VKK SAE E AW+  KA    GL +WRI KFKV   PKE++GKF++GDSYIIL   K+E S  LLYDVHFWIGKYS
Sbjct:    1 MIKQKQYDWKDSNLALFGSDTERQVKKDSAEQEKAWK--KAGQKCGLQIWRIVKFKVTEWPKEDYGKFFDGDSYIILNTYKDEGSEALLYDVHFWIGKYS 98          
BLAST of Gelsolin vs. TrEMBL
Match: tr|A0A1I8JE74|A0A1I8JE74_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.126e-35
Identity = 65/101 (64.36%), Postives = 78/101 (77.23%), Query Frame = 3
Query:  228 GMIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
             M K + YDWKDSNLALFGS TEK VKK ++E E AW+  K  T   LFVWRIEKFKV + PKE++GKF++GDSYI+L + K+ D  ELLYDVHFWIGK+S
Sbjct:   12 AMQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVYKDPDGDELLYDVHFWIGKHS 112          
BLAST of Gelsolin vs. TrEMBL
Match: tr|V3ZFQ9|V3ZFQ9_LOTGI (Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_192582 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.613e-35
Identity = 69/100 (69.00%), Postives = 77/100 (77.00%), Query Frame = 3
Query:  231 MIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS 530
            M+K K YDWKDSNLALFGSDTEK VKK SAE+EPAW+ A A   PGL +WRI KFKV   PKE++GKFY+GDSYI+L   KE  S  L YDVHFWIGK S
Sbjct:    1 MMKAKKYDWKDSNLALFGSDTEKQVKKESAESEPAWQGAGAE--PGLQIWRIVKFKVTHWPKEDYGKFYSGDSYIVLNTFKEGSSETLCYDVHFWIGKES 98          
The following BLAST results are available for this feature:
BLAST of Gelsolin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
VIL11.907e-1442.11villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
VIL11.305e-1350.00villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
VIL13.984e-1350.00villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
GSN4.642e-1143.10gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
GSN4.877e-1143.10gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
back to top
BLAST of Gelsolin vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 1
Match NameE-valueIdentityDescription
gsnl-11.225e-645.28Gelsolin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Gelsolin vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Gel2.824e-1247.46Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225... [more]
Gel2.824e-1247.46Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225... [more]
Gel2.824e-1247.46Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225... [more]
Gel2.824e-1247.46Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225... [more]
Gel2.986e-1247.46Gelsolin [Source:FlyBase gene name;Acc:FBgn0010225... [more]
back to top
BLAST of Gelsolin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
gsna1.573e-1350.00gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
gsna1.849e-1350.00gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
gsna1.972e-1350.00gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
vil12.323e-1244.64villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
scin8.661e-1245.76scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
back to top
BLAST of Gelsolin vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
gsn1.557e-1244.83gelsolin [Source:Xenbase;Acc:XB-GENE-489535][more]
avil4.237e-1250.00advillin [Source:Xenbase;Acc:XB-GENE-489888][more]
vil15.129e-1137.93villin 1 [Source:Xenbase;Acc:XB-GENE-965127][more]
vil15.514e-1137.93villin 1 [Source:Xenbase;Acc:XB-GENE-965127][more]
vill5.017e-1045.61villin-like [Source:Xenbase;Acc:XB-GENE-945607][more]
back to top
BLAST of Gelsolin vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Vil11.684e-1244.83villin 1 [Source:MGI Symbol;Acc:MGI:98930][more]
Gsn2.357e-1143.10gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn3.489e-1143.10gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn3.489e-1143.10gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn1.291e-1043.10gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
back to top
BLAST of Gelsolin vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7JQD3|GELS1_LUMTE6.026e-3365.05Gelsolin-like protein 1 OS=Lumbricus terrestris GN... [more]
sp|Q24800|SEVE_ECHGR8.249e-3050.98Severin OS=Echinococcus granulosus GN=AG8 PE=2 SV=... [more]
sp|Q8MPM1|GELS2_LUMTE4.518e-2652.94Gelsolin-like protein 2 OS=Lumbricus terrestris GN... [more]
sp|P10733|SEVE_DICDI5.974e-2044.55Severin OS=Dictyostelium discoideum GN=sevA PE=1 S... [more]
sp|Q10L71|VLN2_ORYSJ6.191e-1453.57Villin-2 OS=Oryza sativa subsp. japonica GN=VLN2 P... [more]
back to top
BLAST of Gelsolin vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|V3ZUV4|V3ZUV4_LOTGI5.707e-3972.55Uncharacterized protein OS=Lottia gigantea GN=LOTG... [more]
tr|Q703I5|Q703I5_SUBFI1.910e-3669.61Gelsolin OS=Suberites ficus GN=gelS PE=2 SV=1[more]
tr|K1PCV0|K1PCV0_CRAGI9.839e-3670.00Severin OS=Crassostrea gigas GN=CGI_10003628 PE=4 ... [more]
tr|A0A1I8JE74|A0A1I8JE74_9PLAT2.126e-3564.36Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|V3ZFQ9|V3ZFQ9_LOTGI2.613e-3569.00Uncharacterized protein OS=Lottia gigantea GN=LOTG... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029006ADF-H/Gelsolin-like domainGENE3DG3DSA:3.40.20.10coord: 56..123
e-value: 2.6E-12
score: 45.8
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 66..123
NoneNo IPR availableTMHMMTMhelixcoord: 7..26

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029006ADF-H/Gelsolin-like_dom
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000002Stage 2
PLANA:0000004Stage 4
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000029primitive ectoderm
PLANA:0000058embryonic digestive system
PLANA:0000211primitive ectoderm cell
PLANA:0000023temporary embryonic pharynx
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014940 ID=SMED30014940|Name=Gelsolin|organism=Schmidtea mediterranea sexual|type=transcript|length=530bp
CAAATAAATTTTCGTTTCGTAATTATTTAAATTTCACATGTTTTTTATTT
AACTATAAATTCTGGAAAATAAATTAATTTTACATTCAATTAATTCAAAC
AATGAAATTAGATTTTAAAAGTAAATCATTTCTAGAATTTTTTGTTTTTT
AAACTTTCTAAAAAGGAAACAACTACGGAGCAGTCGAAGAAGTTCTTGTC
ACCGGACACAGAAAGTCTGACAAAACCGGAATGATAAAACAAAAAAACTA
CGATTGGAAAGATTCCAATTTGGCTTTGTTTGGATCAGACACGGAAAAAT
TAGTAAAAAAAACTTCCGCTGAAACCGAACCAGCATGGAGAGTTGCTAAG
GCAACTACGGTTCCAGGTTTATTTGTTTGGAGAATAGAAAAATTCAAAGT
CATCAGTTTACCAAAGGAAGAATTCGGAAAATTTTACAATGGAGATTCTT
ACATTATTTTGAAAATCAATAAAGAAGAAGACAGTCCGGAGTTGCTATAC
GATGTGCATTTTTGGATTGGAAAATATTCT
back to top

protein sequence of SMED30014940-orf-1

>SMED30014940-orf-1 ID=SMED30014940-orf-1|Name=SMED30014940-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVW
RIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKYS
back to top
Aliases
The feature 'Gelsolin' has the following synonyms
Synonym
gelsolin-like