slc17a-4

Overview
Nameslc17a-4 (AKN21527.1)
Smed IDSMED30014924
Length (bp)1669
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc17a-4 (SMED30014924) t-SNE clustered cells

Violin plots show distribution of expression levels for slc17a-4 (SMED30014924) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc17a-4 (SMED30014924) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc17a-4 (SMED30014924) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014924

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014924SMESG000061339.1 SmedASXL_013341SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014924SMESG000061339.1 dd_Smed_v6_21295_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
non-ciliated epidermisSMED30014924SMESG000061339.1 dd_Smed_v4_21295_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc17a-4 vs. Ensembl Human
Match: SLC17A6 (solute carrier family 17 member 6 [Source:HGNC Symbol;Acc:HGNC:16703])

HSP 1 Score: 215.312 bits (547), Expect = 6.879e-62
Identity = 135/453 (29.80%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   +      +  K  W DP     +  + F+ Y++    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y + G++W +FW  +  E P     ++ +ER+YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +   +K  + W+    +AA +    +  Y +FAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWADPEETSEE 514          
BLAST of slc17a-4 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 209.149 bits (531), Expect = 9.433e-60
Identity = 134/456 (29.39%), Postives = 239/456 (52.41%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDH--SQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I++ + NS+ H    ++ + +Q     W DP     +  + F+ Y+V    GGF+  K  ++ + G ++  T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   +  G   G ++ +P+   + Q  GW  VFY+Y + G+ W +FW  +  E P    ++S++ER+YI +     +      +  S PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG +ADFL+ +   S T +RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +    K  + W+    +A+ +    +  Y +FAS EKQ WA P+E + E
Sbjct:   61 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQ---FSW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEE 506          
BLAST of slc17a-4 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 206.453 bits (524), Expect = 1.649e-58
Identity = 140/479 (29.23%), Postives = 250/479 (52.19%), Query Frame = 2
Query:  167 YCGPGKKRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPS-QHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILST-VIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQT------VEMEDISPELPLCHK 1576
            +C    KRY+IA++  +G  +  G+R  + + I+  + NS+ +  +  KP  Q  +  W DP     +  + F+ Y++    GGF++ K  ++ + G ++ +T  +N+F+P    +          ++ +R+LQG+ EG   PA  G+   W P  E+S +   S  G   G ++ +P+   + Q  GW  VFYIY   G+IW +FW     E P     +S +E+ YI  +    ++    S  S PWK  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P +  +I VPIGG LAD+L+ +   + T +RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ+WA+P+  +      ++ ++++ E+ L H+
Sbjct:   68 HCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVY--VDGKPEIQTAQFNW-DPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV------HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEEIELNHE 537          
BLAST of slc17a-4 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 198.364 bits (503), Expect = 2.448e-56
Identity = 130/449 (28.95%), Postives = 232/449 (51.67%), Query Frame = 2
Query:  206 LCTIGLTVVIGMRSEM-LGIITNLKNSSDH--SQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +  +G  +  G+R  + + I++ + NS+ H    ++ + +Q     W DP     +  + F+ Y+V    GGF+  K  ++ + G ++  T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   +  G   G ++ +P+   + Q  GW  VFY+Y + G+ W +FW  +  E P    ++S++ER+YI +     +      +  S PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG +ADFL+ +   S T +RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +    K  + W+    +A+ +    +  Y +FAS EKQ WA P+E + E
Sbjct:    1 MSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQ---FSW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEE 439          
BLAST of slc17a-4 vs. Ensembl Human
Match: SLC17A5 (solute carrier family 17 member 5 [Source:HGNC Symbol;Acc:HGNC:10933])

HSP 1 Score: 173.711 bits (439), Expect = 2.767e-47
Identity = 125/461 (27.11%), Postives = 222/461 (48.16%), Query Frame = 2
Query:  182 KKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS-------------DHSQLI--FKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMS-ATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQG-WKIALCMAAGIQLFSMQMYLLFASSEKQKWA 1513
              RY +A+L   G  +V  +R  +   + ++ +S+             +HS  I        +K  W D   + ++  + F+ Y++    GG++  K    +LLG  +  T  + LF P+   LG      +  +I LR L+G+ EG   PA+  +   W P  E+S +L +S  G  +G +I LP+   I     W  VFY +  IG+ W + W  +V + P+  + +S  E++YI  +          S  S+PW  I  S P++AI   + + +WTF      + TY  ++ +  V++  +L S P+L   + + + G  AD L+ K  +S   +R+  + +G     +F +A  F   + S A   L+++    G   +G+++N +D+AP+YAG+++G  N+ +T  G++  VIA  +    + G W+    +AA I +F    + LFA  E Q WA
Sbjct:   37 SARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQW-DAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLG------VGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSS----LRNQLSSQKSVPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWA 486          
BLAST of slc17a-4 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 187.963 bits (476), Expect = 2.179e-52
Identity = 135/483 (27.95%), Postives = 234/483 (48.45%), Query Frame = 2
Query:   95 PNEISDEFDEKLTLFDEDSKTNFV---YCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNL-KNSSDHSQLIFKPSQHRKMPWKDPIMEDF---------VENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQ 1504
            P ++ +E +E       +     +   + G  +KR+L+A+L  +G  +  G+R       T++ KN +D              P+    M +F         +E++ F+ YLV     GFL  K   + L G  + +   +N+ LP    + ++      ++ F+++ QG+ +G   PA+ GV R+W P  E+S +   +  G   G ++GLP+ A +     W   FY+Y   G+IW I W+ +  E+P     +S++E+ +I E++    S +  +  SIPWK I +SKPV+AI     A  WTF +      TY  +   +++  +  L + P L     V +GG LAD+L+     S T +RK     GFG +  F + +++   + +A + L  A+G SG A++G+ VN +D+AP YA ++MGF+N I T  G+    +     +    GW     +A+ I    +  Y ++AS E Q
Sbjct:   14 PQQMQEEGNENPMQMHSNKVLQVMEQTWIGKCRKRWLLAILANMGFMISFGIRCNFGAAKTHMYKNYTD--------------PYGKVHMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDY-----LVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFI-EDAIGHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAHSKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 476          
BLAST of slc17a-4 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 187.963 bits (476), Expect = 2.903e-52
Identity = 135/483 (27.95%), Postives = 234/483 (48.45%), Query Frame = 2
Query:   95 PNEISDEFDEKLTLFDEDSKTNFV---YCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNL-KNSSDHSQLIFKPSQHRKMPWKDPIMEDF---------VENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQ 1504
            P ++ +E +E       +     +   + G  +KR+L+A+L  +G  +  G+R       T++ KN +D              P+    M +F         +E++ F+ YLV     GFL  K   + L G  + +   +N+ LP    + ++      ++ F+++ QG+ +G   PA+ GV R+W P  E+S +   +  G   G ++GLP+ A +     W   FY+Y   G+IW I W+ +  E+P     +S++E+ +I E++    S +  +  SIPWK I +SKPV+AI     A  WTF +      TY  +   +++  +  L + P L     V +GG LAD+L+     S T +RK     GFG +  F + +++   + +A + L  A+G SG A++G+ VN +D+AP YA ++MGF+N I T  G+    +     +    GW     +A+ I    +  Y ++AS E Q
Sbjct:   35 PQQMQEEGNENPMQMHSNKVLQVMEQTWIGKCRKRWLLAILANMGFMISFGIRCNFGAAKTHMYKNYTD--------------PYGKVHMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDY-----LVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFI-EDAIGHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAHSKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 497          
BLAST of slc17a-4 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 155.606 bits (392), Expect = 2.970e-41
Identity = 107/447 (23.94%), Postives = 210/447 (46.98%), Query Frame = 2
Query:  182 KKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKD--PIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQG-WKIALCMAAGIQLFSMQMYLLFASSEKQKWA 1513
            K+R+++A+L  +G   +  MR+ +   I  + + ++    +   + H    +++  P+ +  V ++ F+ Y+V+   GG+L   H +  +       T    L  P    +G        M++F R ++G+ EG   PA+  +   W P  E++ +   +  G   G ++ +P+ A + + +GW ++F+ +  +G+IWC+ W++ V +RPE+D  +S  E   +  +         ++   +PW  I  SKPV+A+   ++A +  F I    +      +    VEK     S P+      +  GG L D+L+    +    +RK    LGF  + +F   +    + +   +  S+++G  G+   G++VN +DLAP YAG +M  +N+ +T  GI   ++   IV   + G W + + +     L    ++  FA +  Q WA
Sbjct:   31 KRRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERK--VNGTTLHVLGDFENWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYG------MLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRD------AVSQNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWA 463          
BLAST of slc17a-4 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 154.836 bits (390), Expect = 5.355e-41
Identity = 107/447 (23.94%), Postives = 210/447 (46.98%), Query Frame = 2
Query:  182 KKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKD--PIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQG-WKIALCMAAGIQLFSMQMYLLFASSEKQKWA 1513
            K+R+++A+L  +G   +  MR+ +   I  + + ++    +   + H    +++  P+ +  V ++ F+ Y+V+   GG+L   H +  +       T    L  P    +G        M++F R ++G+ EG   PA+  +   W P  E++ +   +  G   G ++ +P+ A + + +GW ++F+ +  +G+IWC+ W++ V +RPE+D  +S  E   +  +         ++   +PW  I  SKPV+A+   ++A +  F I    +      +    VEK     S P+      +  GG L D+L+    +    +RK    LGF  + +F   +    + +   +  S+++G  G+   G++VN +DLAP YAG +M  +N+ +T  GI   ++   IV   + G W + + +     L    ++  FA +  Q WA
Sbjct:   36 KRRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERK--VNGTTLHVLGDFENWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYG------MLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRD------AVSQNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWA 468          
BLAST of slc17a-4 vs. Ensembl Celegans
Match: vglu-3 (Potential vesicular glutamate transporter vglu-3 [Source:UniProtKB/Swiss-Prot;Acc:Q10046])

HSP 1 Score: 144.436 bits (363), Expect = 7.152e-37
Identity = 116/454 (25.55%), Postives = 209/454 (46.04%), Query Frame = 2
Query:  182 KKRYLIALLCTIGLTVVIGMRSEMLGIITN--LKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKH--DSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITM-IIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQ 1528
            K R+ IA+L   G  +  G+RS   G+  N  + N +D     +     R+  W    +   +E++ F+ Y  +    G L  K   +   +LG  VA       F+ ++  +  N  P   + ++ ++ +QG+A G L PA+ GV +FW P  E+S +   +  G S+G + GLP  A +   + W   FY++  +G+IW + W  +    PE    +S  E++ + E      +    S  ++PW+ + +S  V+AI        W F +      TY   +  + ++ + ++  FP     I     G L D+L+     S   +RK +   GF ++ +    L+F +D + A   L +A   SG  ++G+ VN  D+AP YA ++MG AN +      +  ++ + +  +   GWK    +A  I +F +  +L+FA  +   WA   E+
Sbjct:   45 KVRWQIAILAHFGFAISFGIRSN-FGVAKNRMVNNFTD----AYGEVHEREFLWTGAEV-GMMESSFFYGYAASQIPAGVLAAKFAPNKIFMLGILVAS------FMNILSAISFNFHPYTDIFVMVVQAVQGLALGVLYPAMHGVWKFWAPPLERSKLATTAFTGSSVGVMTGLPASAYLVSHFSWSTPFYVFGVVGIIWSLIWMYVSSHSPETHGYISDDEKKQVTEK-IGDVAVKNMSLTTLPWRDMMTSSAVWAIIICTFCRSWGFFLLLGNQLTYMKDVLHIDIKNSGFISIFPQFGMCIVTLATGQLCDYLRSSGKMSTEAVRKSVNTFGFTVEAMMLGCLAFVRDPVIAVTCLVIACTGSGSVLSGFNVNHFDIAPRYAPILMGIANGLGAVA-GVGGMVTNTVTYQNPDGWKWVFLLAMAIDIFGVIFFLIFAKGDVLPWAREPEK 484          
BLAST of slc17a-4 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083889)

HSP 1 Score: 202.601 bits (514), Expect = 3.066e-58
Identity = 127/465 (27.31%), Postives = 232/465 (49.89%), Query Frame = 2
Query:  182 KKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVS-KMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCH 1573
            K+RY++ LL   G   V  +R  +   I  +  +          S  +  PW D   +  + ++ F+ Y++   +GG++  K   +++ G  +  T  + L  P+  +        + M +F+R+++G  EG   P +  V   W P  E+S +  ++  G   G ++ +P    +  K+GW  VFY++  IG+IW I W   V   PE DR  SK+E  YI +   +  S   K     PW+ IF+S P YAI  ++ +++W F      + ++        + KT  L + P+LA  I + + G+LAD+L++K  W+ T +R+      F  + +F +  ++  D   + + L++A+G    A +G+AVN +D+AP +A ++MG  N+ +T  GI+S ++  ++V+ + S  W+I   ++AGI L    +Y  + S + Q+WA   EQ  +  +   +L L  
Sbjct:   36 KQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRTVFDADGNVSYQQDFPW-DSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAAS------HSLEMFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTIGYVGSKHVKH----PWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEWAKTPEQKAQEAEEKAQLQLTQ 489          
BLAST of slc17a-4 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083888)

HSP 1 Score: 202.601 bits (514), Expect = 3.066e-58
Identity = 127/465 (27.31%), Postives = 232/465 (49.89%), Query Frame = 2
Query:  182 KKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVS-KMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCH 1573
            K+RY++ LL   G   V  +R  +   I  +  +          S  +  PW D   +  + ++ F+ Y++   +GG++  K   +++ G  +  T  + L  P+  +        + M +F+R+++G  EG   P +  V   W P  E+S +  ++  G   G ++ +P    +  K+GW  VFY++  IG+IW I W   V   PE DR  SK+E  YI +   +  S   K     PW+ IF+S P YAI  ++ +++W F      + ++        + KT  L + P+LA  I + + G+LAD+L++K  W+ T +R+      F  + +F +  ++  D   + + L++A+G    A +G+AVN +D+AP +A ++MG  N+ +T  GI+S ++  ++V+ + S  W+I   ++AGI L    +Y  + S + Q+WA   EQ  +  +   +L L  
Sbjct:   36 KQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRTVFDADGNVSYQQDFPW-DSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAAS------HSLEMFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTIGYVGSKHVKH----PWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEWAKTPEQKAQEAEEKAQLQLTQ 489          
BLAST of slc17a-4 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0307078)

HSP 1 Score: 197.978 bits (502), Expect = 1.849e-55
Identity = 141/452 (31.19%), Postives = 224/452 (49.56%), Query Frame = 2
Query:  188 RYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQG-WKIALCMAAGIQLFSMQMYLLFASSEKQKWANP--KEQTV 1534
            RY IA +  +G  +  GMR  M    +  K   +H+  +F       M W   + E  V+++ F+ YLV    GGF+  K  ++ + G S+  +  ++LF+P   TL +  +     +I +R+LQG+ EG   PA  G+ RFW P  E+S +  L+  G   G ++GLP+   +    G+   FY Y   G+IW +FW  +  E P     +S  E +YI ++    +  +  S  + PW+ +  S PVYAI        W F +  +   ++    +  +VE+  ++ S P L  +  VP GG LAD L+     S T +RK     GFG++G+FF+ ++ +     A   L+  + FSG A++GY VN +D+AP YA ++MG +N I T  GI+       ++     G W     +AA + L     Y +FAS E Q WA P  +EQ V
Sbjct:   95 RYTIATMACVGFMIAFGMRCNM----SAAKLKGEHNGTVF-------MNWTVAV-ESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHV-----VICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKV 529          
BLAST of slc17a-4 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0331202)

HSP 1 Score: 197.978 bits (502), Expect = 1.849e-55
Identity = 141/452 (31.19%), Postives = 224/452 (49.56%), Query Frame = 2
Query:  188 RYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQG-WKIALCMAAGIQLFSMQMYLLFASSEKQKWANP--KEQTV 1534
            RY IA +  +G  +  GMR  M    +  K   +H+  +F       M W   + E  V+++ F+ YLV    GGF+  K  ++ + G S+  +  ++LF+P   TL +  +     +I +R+LQG+ EG   PA  G+ RFW P  E+S +  L+  G   G ++GLP+   +    G+   FY Y   G+IW +FW  +  E P     +S  E +YI ++    +  +  S  + PW+ +  S PVYAI        W F +  +   ++    +  +VE+  ++ S P L  +  VP GG LAD L+     S T +RK     GFG++G+FF+ ++ +     A   L+  + FSG A++GY VN +D+AP YA ++MG +N I T  GI+       ++     G W     +AA + L     Y +FAS E Q WA P  +EQ V
Sbjct:   95 RYTIATMACVGFMIAFGMRCNM----SAAKLKGEHNGTVF-------MNWTVAV-ESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHV-----VICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKV 529          
BLAST of slc17a-4 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0077769)

HSP 1 Score: 197.978 bits (502), Expect = 1.849e-55
Identity = 141/452 (31.19%), Postives = 224/452 (49.56%), Query Frame = 2
Query:  188 RYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQG-WKIALCMAAGIQLFSMQMYLLFASSEKQKWANP--KEQTV 1534
            RY IA +  +G  +  GMR  M    +  K   +H+  +F       M W   + E  V+++ F+ YLV    GGF+  K  ++ + G S+  +  ++LF+P   TL +  +     +I +R+LQG+ EG   PA  G+ RFW P  E+S +  L+  G   G ++GLP+   +    G+   FY Y   G+IW +FW  +  E P     +S  E +YI ++    +  +  S  + PW+ +  S PVYAI        W F +  +   ++    +  +VE+  ++ S P L  +  VP GG LAD L+     S T +RK     GFG++G+FF+ ++ +     A   L+  + FSG A++GY VN +D+AP YA ++MG +N I T  GI+       ++     G W     +AA + L     Y +FAS E Q WA P  +EQ V
Sbjct:   95 RYTIATMACVGFMIAFGMRCNM----SAAKLKGEHNGTVF-------MNWTVAV-ESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHV-----VICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKV 529          
BLAST of slc17a-4 vs. Ensembl Zebrafish
Match: slc17a6a (solute carrier family 17 member 6a [Source:NCBI gene;Acc:494492])

HSP 1 Score: 216.468 bits (550), Expect = 1.687e-62
Identity = 134/454 (29.52%), Postives = 238/454 (52.42%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFEN-XXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I+  + NS+ H        +  K  W DP     +  + F+ Y+V    GG+++ +  ++ + G ++ +T  +N+F+P    +          ++F+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G ++ +P+   + Q  GW  VFYIY + G++W +FW  +  E P +   ++ +ER YI E+                PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG LAD+L+ K   + TT+RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHKGGKIIIKEKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARV------HYGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGILVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERTYIEESIGESAKLLGAMEKYKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVIFYGIFASGEKQPWADPEETSDE 515          
BLAST of slc17a-4 vs. Ensembl Zebrafish
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 209.149 bits (531), Expect = 9.635e-60
Identity = 137/456 (30.04%), Postives = 237/456 (51.97%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDH--SQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I++ + NS+ H   ++I K  +  K  W DP     +  + F+ Y+V    GG+++ +  ++ + G ++ +T  +N+F+P               +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   G+ W +FW  +  E P     ++ +ER YI E+    +           PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG LAD L+ K   S TT+RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +A+ +    +  Y +FAS EKQ WA+P+  + E
Sbjct:   68 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHLNGKIIIK--EKAKFNW-DPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAAR------GHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAEERCYIEESIGESAKLLGPADKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQLADHLRSKNILSTTTVRKIMNCGGFGMEATLLLIVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGIFASGEKQPWADPELTSDE 514          
BLAST of slc17a-4 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 208.379 bits (529), Expect = 1.914e-59
Identity = 139/456 (30.48%), Postives = 235/456 (51.54%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD---HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            KRY+IA+L  +G  +  G+R  +   I  + N++    +   + +P+Q     W DP     +  + F+ Y+V    GGF++ K  ++ + G ++ +T  +N+F+P    +          ++F+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFYIY   G+IW IFW  +    P     +S++ER YI  +    ++    +     PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P +  +I VPIGG LADFL+ +   S TT+RK +   GFG++    + + F+     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K    W+    +A+ +    +  Y +FAS EKQ WA+P+  + E
Sbjct:   74 KRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTAVMQPAQFN---W-DPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARV------HYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDE 519          
BLAST of slc17a-4 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 207.994 bits (528), Expect = 2.397e-59
Identity = 139/456 (30.48%), Postives = 235/456 (51.54%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD---HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            KRY+IA+L  +G  +  G+R  +   I  + N++    +   + +P+Q     W DP     +  + F+ Y+V    GGF++ K  ++ + G ++ +T  +N+F+P    +          ++F+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFYIY   G+IW IFW  +    P     +S++ER YI  +    ++    +     PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P +  +I VPIGG LADFL+ +   S TT+RK +   GFG++    + + F+     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K    W+    +A+ +    +  Y +FAS EKQ WA+P+  + E
Sbjct:   74 KRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTAVMQPAQFN---W-DPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARV------HYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDE 519          
BLAST of slc17a-4 vs. Ensembl Zebrafish
Match: slc17a7b (solute carrier family 17 member 7b [Source:ZFIN;Acc:ZDB-GENE-131125-32])

HSP 1 Score: 199.904 bits (507), Expect = 2.085e-56
Identity = 136/457 (29.76%), Postives = 234/457 (51.20%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSS---DHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA+L  +G  +  G+R  + + +++ + N +   D    I K     +  W DP     +  + F+ Y+V    GGF+  K  ++ + G +V  T  +N+ +P    +          +I +R+LQG+ EG   PA  G+   W P  E+S +   +  G   G +I +P+   + Q  GW  VFY+Y + G+ W +FW  +  E P     ++ +ER+YI +     +      +  + PW+  F+S PVYAI        WTF +  +    Y+ +++K  + K   L + P L  +I VPIGG LAD+L+     + T +RK +   GFGL+  F + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y LFAS EKQ WA P+  + E
Sbjct:   56 RRYIIAILSGLGFCISFGIRCNLGVAVVSMVNNHTVYRDGKPYIVKA----QFSW-DPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAVVSTSILNMMIPTAARM------HFGCVILVRILQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGVLVQYSGWSSVFYVYGSFGVCWYLFWILVSYESPAAHPTITPEERKYIEDAIGESAGLVNPLTKFNTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFKFEISKVGILSALPHLVMTIVVPIGGQLADYLRTHNLMTTTNVRKLMNCGGFGLEATFLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVIFYGLFASGEKQPWAEPENTSEE 501          
BLAST of slc17a-4 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 215.698 bits (548), Expect = 1.982e-62
Identity = 138/455 (30.33%), Postives = 237/455 (52.09%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS--DHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   H   I K  +  K  W DP +   +  + F+ Y+V    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   GL+W +FW  +  E P     ++ +ER YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ WA+P++ + E
Sbjct:   56 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHHGGKIIK--EKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDE 501          
BLAST of slc17a-4 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 215.312 bits (547), Expect = 3.699e-62
Identity = 138/455 (30.33%), Postives = 237/455 (52.09%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS--DHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   H   I K  +  K  W DP +   +  + F+ Y+V    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   GL+W +FW  +  E P     ++ +ER YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ WA+P++ + E
Sbjct:   43 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHHGGKIIK--EKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDE 488          
BLAST of slc17a-4 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 215.698 bits (548), Expect = 4.163e-62
Identity = 138/455 (30.33%), Postives = 237/455 (52.09%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS--DHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   H   I K  +  K  W DP +   +  + F+ Y+V    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   GL+W +FW  +  E P     ++ +ER YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ WA+P++ + E
Sbjct:   58 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHHGGKIIK--EKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDE 503          
BLAST of slc17a-4 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 215.312 bits (547), Expect = 5.094e-62
Identity = 138/455 (30.33%), Postives = 237/455 (52.09%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS--DHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   H   I K  +  K  W DP +   +  + F+ Y+V    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   GL+W +FW  +  E P     ++ +ER YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ WA+P++ + E
Sbjct:   64 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHHGGKIIK--EKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDE 509          
BLAST of slc17a-4 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 215.312 bits (547), Expect = 5.120e-62
Identity = 138/455 (30.33%), Postives = 237/455 (52.09%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS--DHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   H   I K  +  K  W DP +   +  + F+ Y+V    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   GL+W +FW  +  E P     ++ +ER YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ WA+P++ + E
Sbjct:   57 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHHGGKIIK--EKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDE 502          
BLAST of slc17a-4 vs. Ensembl Mouse
Match: Slc17a6 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [Source:MGI Symbol;Acc:MGI:2156052])

HSP 1 Score: 216.468 bits (550), Expect = 1.987e-62
Identity = 136/453 (30.02%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   +      +  K  W DP     +  + F+ Y++    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y + G++W +FW  +  E P     ++ +ER+YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +   +K  + W+    +AA +    +  Y LFAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWADPEETSEE 514          
BLAST of slc17a-4 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 208.379 bits (529), Expect = 1.106e-59
Identity = 133/456 (29.17%), Postives = 239/456 (52.41%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDH--SQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I++ + NS+ H    ++ + +Q     W DP     +  + F+ Y+V    GGF+  K  ++ + G ++  T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   +  G   G ++ +P+   + Q  GW  VFY+Y + G+ W +FW  +  E P    ++S++ER+YI +     +      +  + PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG +ADFL+ +   S T +RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +    K  + W+    +A+ +    +  Y +FAS EKQ WA P+E + E
Sbjct:   61 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQ---FNW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEE 506          
BLAST of slc17a-4 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 207.608 bits (527), Expect = 5.552e-59
Identity = 140/479 (29.23%), Postives = 248/479 (51.77%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPS-QHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILST-VIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQT------VEMEDISPELPLCHKIVIDAK 1594
            KRY+IA++  +G  +  G+R  + + I+  + NS+ +  +  KP  Q  +  W DP     +  + F+ Y+V    GGF++ K  +S + G ++ +T  +N+F+P    +          ++ +R+LQG+ EG   PA  G+   W P  E+S +   S  G   G ++ +P+   + Q  GW  VFYIY   G+IW +FW     E P     +S  ER YI  +    ++ +  S  + PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P +  +I VPIGG LAD+L+ +   + T +RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ WA+P+  +      ++ ++++ E  L H+  +  +
Sbjct:   87 KRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVY--VDGKPEIQTAQFNW-DPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIPSAARV------HYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEDKCGIIDQDELAEETELNHETFVSPR 556          
BLAST of slc17a-4 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 201.06 bits (510), Expect = 8.180e-57
Identity = 135/478 (28.24%), Postives = 239/478 (50.00%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNS---------------SDHSQLIFKPS---------QHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I++ + NS               S H Q    P+         +  +  W DP     +  + F+ Y+V    GGF+  K  ++ + G ++  T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   +  G   G ++ +P+   + Q  GW  VFY+Y + G+ W +FW  +  E P    ++S++ER+YI +     +      +  + PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG +ADFL+ +   S T +RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +    K  + W+    +A+ +    +  Y +FAS EKQ WA P+E + E
Sbjct:   61 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQTPYRSVHKQEAVTPTLGDIQGGDTEKAQFNW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEE 531          
BLAST of slc17a-4 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 171.4 bits (433), Expect = 3.344e-47
Identity = 110/364 (30.22%), Postives = 190/364 (52.20%), Query Frame = 2
Query:  539 IIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQT------VEMEDISPELPLCHKIVIDAKSDEDF 1609
            ++ +R+LQG+ EG   PA  G+   W P  E+S +   S  G   G ++ +P+   + Q  GW  VFYIY   G+IW +FW     E P     +S  ER YI  +    ++ +  S  + PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P +  +I VPIGG LAD+L+ +   + T +RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y +FAS EKQ WA+P+  +      ++ ++++ E  L H+  +  +    +
Sbjct:   14 VMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEDKCGIIDQDELAEETELNHETFVSPRKKMSY 377          
BLAST of slc17a-4 vs. UniProt/SwissProt
Match: sp|Q5W8I7|VGL2B_DANRE (Vesicular glutamate transporter 2.2 OS=Danio rerio OX=7955 GN=slc17a6a PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.341e-61
Identity = 134/454 (29.52%), Postives = 236/454 (51.98%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFEN-XXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I+  + NS+ H           K  W DP     +  + F+ Y V    GG+++ +  ++ + G ++ +T  +N+F+P    +          ++F+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G ++ +P+   + Q  GW  VFYIY + G++W +FW  +  E P +   ++ +ER YI E+                PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG LAD+L+ K   + TT+RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHKGGKIIIKGKAKFNW-DPETVGMIHGSFFWGYTVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARV------HYGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGILVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERTYIEESIGESAKLLGAMEKYKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVIFYGIFASGEKQPWADPEETSDE 515          
BLAST of slc17a-4 vs. UniProt/SwissProt
Match: sp|Q9JI12|VGLU2_RAT (Vesicular glutamate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc17a6 PE=1 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.590e-61
Identity = 136/453 (30.02%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   +      +  K  W DP     +  + F+ Y++    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y + G++W +FW  +  E P     ++ +ER+YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +   +K  + W+    +AA +    +  Y LFAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWADPEETSEE 514          
BLAST of slc17a-4 vs. UniProt/SwissProt
Match: sp|A6QLI1|VGLU2_BOVIN (Vesicular glutamate transporter 2 OS=Bos taurus OX=9913 GN=SLC17A6 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.304e-61
Identity = 136/453 (30.02%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   +      +  K  W DP     +  + F+ Y++    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y + G+IW +FW  +  E P     ++ +ER+YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +   +K  + W+    +AA +    +  Y +FAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMIWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWADPEETSEE 514          
BLAST of slc17a-4 vs. UniProt/SwissProt
Match: sp|Q9P2U8|VGLU2_HUMAN (Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.304e-61
Identity = 135/453 (29.80%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   +      +  K  W DP     +  + F+ Y++    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y + G++W +FW  +  E P     ++ +ER+YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++  +I  +   +K  + W+    +AA +    +  Y +FAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWADPEETSEE 514          
BLAST of slc17a-4 vs. UniProt/SwissProt
Match: sp|Q8BLE7|VGLU2_MOUSE (Vesicular glutamate transporter 2 OS=Mus musculus OX=10090 GN=Slc17a6 PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.703e-61
Identity = 135/453 (29.80%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVI-ASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  +   I ++ N+S   +      +  K  W DP     +  + F+ Y++    GG++  +  ++ + G ++ +T  +N+ +P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y + G++W +FW  +  E P     ++ +ER+YI E+    ++          PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +ADFL+ K   S TT+RK +   GFG++    + + ++     A   L LA+GFSG A++G+ VN +D+AP YA ++MG ++ + T +G++  +I  +   +K  + W+    +AA +    +  Y LFAS EKQ WA+P+E + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISDGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWADPEETSEE 514          
BLAST of slc17a-4 vs. TrEMBL
Match: A0A0H3YFB1 (Slc17a-4 OS=Schmidtea mediterranea OX=79327 GN=slc17a-4 PE=2 SV=1)

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 507/507 (100.00%), Postives = 507/507 (100.00%), Query Frame = 2
Query:   89 MIPNEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCHKIVIDAKSDEDF 1609
            MIPNEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENSSFKSSFSKKSSASIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCLAGLGFGLKGIFFIALSFAKDEMSATILLSLALGFSGLAVAGYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCHKIVIDAKSDEDF
Sbjct:    1 MIPNEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENSSFKSSFSKKSSASIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCLAGLGFGLKGIFFIALSFAKDEMSATILLSLALGFSGLAVAGYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCHKIVIDAKSDEDF 507          
BLAST of slc17a-4 vs. TrEMBL
Match: A0A0H3YF21 (Slc17a-2 OS=Schmidtea mediterranea OX=79327 GN=slc17a-2 PE=2 SV=1)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 326/498 (65.46%), Postives = 393/498 (78.92%), Query Frame = 2
Query:  137 FDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD-----HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKM-SQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWA-NPKEQTVEMEDISPELPLCHKIVIDAKSDEDF 1609
            F  +   NF  CGPGKKRYL+A LCT+GLT+VIGMRSEMLGII+NLKN SD      S LIFKPS+HRK+PW +P+MEDFVENAVFF+Y++ASPIGG+LTV HDSSLL G SVAMTCGINLFLPLVET+  ++  KI MII LR+LQG+AEGCL+PA+FGVLRFW P NE+STI+CLSVIGVS+GPLIGLPVC +IE KWGWGVVFYIYAN+GLIWCIFWWR++DE+P  D +LS  E+ ++ ++       + K    IPWK I  S+P+YAI  TYAADDWTFQISSVCMQ+YY   Y   ++KTI+LLSFPFLARS+FVPIGG LAD + LKT+WSWT IRK L GLGFGLKGIFF+A+ FA+DE +AT+LLSL LGFSGLAVAGYAVNV+++APNYAGL+MG A+ +STFTGI STVIAS +V  + SQGW+IALC+AA  Q FSM MYL F SS+++ WA  P + T+    +         I +D  + ED 
Sbjct:    5 FRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQS-IESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKLLTGLGFGLKGIFFVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVV--------ISVDTNTKEDL 493          
BLAST of slc17a-4 vs. TrEMBL
Match: A0A2H1CTT3 (Transporter, major facilitator family protein OS=Fasciola hepatica OX=6192 GN=D915_01575 PE=4 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 319/517 (61.70%), Postives = 383/517 (74.08%), Query Frame = 2
Query:  149 SKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS-------------DH---------------------------------------------SQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSK----MSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWA 1513
            S ++  +CGPG+KRYLIA LC   LTVVIGMRSEMLGIITNL N++             DH                                             + LIFKPS+HR+MPW   I  D  ENAVFF+YL+ SPIGG+LTV HDSS LLGCSVAMTCG+NLFLPLVET+GNNL  K  M++ LRLLQG+AEGCL+PAVFGVLRFW P+NE+ST++C++VIGVS+GPLIGLPVCAEIE+KWGWGVVFYIYAN+GLIWCIFWWR++DE+P  D  L K+ER Y+  +   +     K    IPW+ IFSS+PV+AIF TYAADDWTFQISSVCMQ++Y Q+YKV VE+TI+ LSFPFL+RS+FVPIGG  ADFL++KT+ S TTIRK  AGLGFGLKGIFF+AL FA  E+ AT+LLSL+LGFSGLAVAGYAVNVIDLAPN++GLVMGFANS+STFTGILST IAS +V K    ++ GW++AL +AA  Q  +M +YL+F SSE+Q WA
Sbjct:  129 SHSDSCFCGPGRKRYLIAFLCCACLTVVIGMRSEMLGIITNLNNTNPSGSILNRLSGPMDHLHGASASKLADDLLDPSGVVGHLPGEEIDALHEIPGLQAEINQPATSLIFKPSEHRQMPWTKTIKNDIAENAVFFAYLITSPIGGYLTVNHDSSFLLGCSVAMTCGMNLFLPLVETIGNNLQAKFIMVVLLRLLQGLAEGCLIPAVFGVLRFWSPENERSTLVCVAVIGVSLGPLIGLPVCAEIEKKWGWGVVFYIYANLGLIWCIFWWRLIDEKPMKDDRLGKRERAYLHRS-IAQRILCAKRQIPIPWQSIFSSRPVFAIFFTYAADDWTFQISSVCMQSFYQQLYKVDVERTIFFLSFPFLSRSMFVPIGGVFADFLRIKTSLSLTTIRKLFAGLGFGLKGIFFVALGFAPSEIYATVLLSLSLGFSGLAVAGYAVNVIDLAPNFSGLVMGFANSVSTFTGILSTFIASIVVHKFGLELTNGWRVALALAALSQFCAMLIYLIFGSSEEQSWA 644          
BLAST of slc17a-4 vs. TrEMBL
Match: A0A504Z222 (Vesicular glutamate transporter OS=Fasciola gigantica OX=46835 GN=FGIG_05083 PE=4 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 318/511 (62.23%), Postives = 380/511 (74.36%), Query Frame = 2
Query:  167 YCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS-------------DH---------------------------------------------SQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSK----MSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWA 1513
            +CGPG+KRYLIA LC   LTVVIGMRSEMLGIITNL N++             DH                                             + LIFKPS+HR+MPW   I  D  ENAVFF+YL+ SPIGG+LTV HDSS LLGCSVAMTCG+NLFLPLVET+GNNL  K  M++ LRLLQG+AEGCL+PAVFGVLRFW P+NE+ST++C++VIGVS+GPLIGLPVCAEIE+KWGWGVVFYIYAN+GLIWCIFWWR++DE+P  D  L K+ER Y+  +   +     K    IPW+ IFSS+PV+AIF TYAADDWTFQISSVCMQ++Y Q+YKV VE+TI+ LSFPFL+RS+FVPIGG  ADFL++KT+ S TTIRK  AGLGFGLKGIFF+AL FA  E+ AT+LLSL+LGFSGLAVAGYAVNVIDLAPN++GLVMGFANS+STFTGILST IAS +V K    ++ GW++AL +AA  Q  +M +YL+F SSE+Q WA
Sbjct:  130 FCGPGRKRYLIAFLCCACLTVVIGMRSEMLGIITNLNNTNPSGSILNRLSGPMDHLHGASANKQADDLLHLSGVVSHLPGEEIDALHEIPGLQAEINQPATSLIFKPSEHRQMPWTKTIKNDIAENAVFFAYLITSPIGGYLTVNHDSSFLLGCSVAMTCGMNLFLPLVETIGNNLQAKFIMVVLLRLLQGLAEGCLIPAVFGVLRFWSPENERSTLVCVAVIGVSLGPLIGLPVCAEIEKKWGWGVVFYIYANLGLIWCIFWWRLIDEKPMKDDRLGKRERAYLHRS-IAQRILCAKRQIPIPWQSIFSSRPVFAIFFTYAADDWTFQISSVCMQSFYQQLYKVDVERTIFFLSFPFLSRSMFVPIGGVFADFLRIKTSLSLTTIRKLFAGLGFGLKGIFFVALGFAPSEIYATVLLSLSLGFSGLAVAGYAVNVIDLAPNFSGLVMGFANSVSTFTGILSTFIASIVVHKFGLELTNGWRVALALAALSQFCAMLIYLIFGSSEEQSWA 639          
BLAST of slc17a-4 vs. TrEMBL
Match: A0A3P6SKB1 (MFS domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS2654 PE=4 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 327/547 (59.78%), Postives = 398/547 (72.76%), Query Frame = 2
Query:   92 IPNEISDEFDEKL-TLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS-------------------------------------------DH-----SQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIV----SKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANP----KEQTVEMEDISPEL 1561
            IP   S++ +E +  L  +    N V CGPGKKRYLI++LC   LTVVIGMRSEMLGIITNL N+                                            DH       LIFKPS HR++PW   I ED VENAVFF+YLVASPIGG+LTV+HDSSL+LGCSVAMTCG+NLFLPL ET+G+N+  K+ MI+ LRLLQG+AEGCL+PAVFGVLR+W P+NE+ST++ L+VIGVS+GPLIGLPVC EIE+KWGWGVVFYIYAN+GLIWCIFWWR++DE+P  DRNLSK ER+Y+  N          ++  IPW  +F+SKPV AIF TYAADDWTFQISSVCMQT+Y Q Y   VEKTI+LLSFPFL+RSIFVPIGGFLAD ++LKT+ S TT+RK  +G+GFGLKGIFF+ L FAKDE+ ATI+LSLALGFSGLAVAGYAVNVI+LAP +AGL+MGFANS+ST TGILSTV+A+ +V    + +  GW  A+C+AAG QLF+   ++ FASS++Q WA      +E ++   DI   L
Sbjct:    3 IPPFESNQAEEIVGKLRKKKPPKNTVCCGPGKKRYLISILCMSCLTVVIGMRSEMLGIITNLNNTHSGKQDSEHIFVDETDNSKYGVAHLPKSLFIQGAVVNFPSVQEVDHIGPEKGSLIFKPSHHRQLPWTATITEDLVENAVFFAYLVASPIGGYLTVRHDSSLILGCSVAMTCGLNLFLPLAETIGSNIDAKLAMIVILRLLQGLAEGCLIPAVFGVLRYWSPQNERSTLVSLTVIGVSLGPLIGLPVCVEIEKKWGWGVVFYIYANLGLIWCIFWWRLIDEKPHKDRNLSKAERRYLRAN-ISPQLLFNTNNIKIPWLAMFTSKPVIAIFFTYAADDWTFQISSVCMQTFYQQRYDAGVEKTIFLLSFPFLSRSIFVPIGGFLADIIRLKTSISCTTLRKIFSGIGFGLKGIFFVVLGFAKDEVHATIILSLALGFSGLAVAGYAVNVIELAPKFAGLIMGFANSLSTLTGILSTVLATVVVHYLNAGVGNGWIFAMCLAAGSQLFAAFFFIAFASSQEQAWAKGGPSIRESSLRSHDIEANL 548          
BLAST of slc17a-4 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 216.468 bits (550), Expect = 1.865e-62
Identity = 135/454 (29.74%), Postives = 239/454 (52.64%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY IA++  +G  +  G+R  + + I+  + NS+ H        +  K  W DP     +  + F+ Y+V    GG+++ +  ++ + G ++ +T  +N+F+P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G ++ +P+   + Q  GW  VFYIY + G++W +FW  +  E P +   ++ +ER YI E+    ++    +     PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG LAD+L+     S TT+RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+E + E
Sbjct:   69 RRYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHKDGKIIIKEKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWADPEETSDE 515          
BLAST of slc17a-4 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 216.468 bits (550), Expect = 1.865e-62
Identity = 135/454 (29.74%), Postives = 239/454 (52.64%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY IA++  +G  +  G+R  + + I+  + NS+ H        +  K  W DP     +  + F+ Y+V    GG+++ +  ++ + G ++ +T  +N+F+P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G ++ +P+   + Q  GW  VFYIY + G++W +FW  +  E P +   ++ +ER YI E+    ++    +     PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG LAD+L+     S TT+RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+E + E
Sbjct:   69 RRYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHKDGKIIIKEKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWADPEETSDE 515          
BLAST of slc17a-4 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 213.001 bits (541), Expect = 1.999e-61
Identity = 134/454 (29.52%), Postives = 236/454 (51.98%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I++ + NS+ H        +  K  W DP     +  + F+ Y+V    GG+++ +  ++ + G ++ +T  +N+F+P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   GL+W +FW  +  E P     ++ +ER YI E+    +           PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +AD+L+ K   S T +RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+  + E
Sbjct:   47 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHENGKIIIKEKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWADPELTSEE 493          
BLAST of slc17a-4 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 213.386 bits (542), Expect = 2.406e-61
Identity = 134/454 (29.52%), Postives = 236/454 (51.98%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I++ + NS+ H        +  K  W DP     +  + F+ Y+V    GG+++ +  ++ + G ++ +T  +N+F+P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFY+Y   GL+W +FW  +  E P     ++ +ER YI E+    +           PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG +AD+L+ K   S T +RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+  + E
Sbjct:   69 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHENGKIIIKEKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWADPELTSEE 515          
BLAST of slc17a-4 vs. Ensembl Cavefish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 201.83 bits (512), Expect = 3.081e-57
Identity = 138/456 (30.26%), Postives = 232/456 (50.88%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD---HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            KRY+IA+L  +G  +  G+R  +   I  + N++    +   + +P+Q     W DP     +  + F+ Y+V    GGF++ K  ++ + G ++ +T  +N+F+P    +          ++F+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFYIY   G+IW  FW  +  + P     +S +E+ YI       +S    +     PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P +  +I VPIGG LADFL+     S TT+RK +   GFG++    + + F+     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K    W+    +A+ +    +  Y +FAS EKQ WA+P+  + E
Sbjct:   58 KRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTPVMQPAQFN---W-DPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSMLNMFIPSAARV------HYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYTFWLLLAYDSPAVHPTISDEEKIYIETTIGEGASLMSATEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIVVPIGGQLADFLRSNKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQNVFVIASMVHYCGVIFYAIFASGEKQDWADPESTSDE 503          
BLAST of slc17a-4 vs. Ensembl Sea Lamprey
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 177.563 bits (449), Expect = 3.397e-49
Identity = 141/458 (30.79%), Postives = 224/458 (48.91%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHS--QLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDS--SLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXX-XIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILST-VIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            KRY+IA++  +G  +  G+R  + + ++  + NSS HS  +LI    Q   + W   +     E   FF + +A+   G + VK  S    L  CS         +LP V       +P   +      L  + +G   PA  G+   W P  E+S +   +  G   G ++ +P+   + Q  GW  VFY+Y + GL W IFW  I  E P     +S +E+ YI E+          +     PWK  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG LADF + K   S TT+RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +AA +    +  Y LFAS EKQ WA+P+E + E
Sbjct:   29 KRYVIAVMSGLGFCISFGIRCNLGVAVVDMVNNSSYHSGDKLIV---QKGSLGWSMDLAMQLHELYNFFLFFLAT-WQGHIVVKSMSREERLHQCSTLPP----HWLP-VHVEERRAVPCACLTSL--SLSSVEQGVTYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYAGWSSVFYVYGSFGLFWYIFWLCIAYESPAKHPTISDEEKTYIEESIGESYGILGSTQKFKTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIISALPHLVMTIVVPIGGQLADFFRSKKIMSTTTVRKMMNCGGFGMEATLLLVVGFSHGKGIAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKGKTREEWQNVFLIAALVHYGGVIFYGLFASGEKQPWADPEETSDE 475          
BLAST of slc17a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010352.1 (pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene:ENSPMAG00000009375.1 transcript:ENSPMAT00000010352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 3.790e-25
Identity = 71/265 (26.79%), Postives = 133/265 (50.19%), Query Frame = 2
Query:  749 ANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAK-DEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMS-QGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
               GL+W I W+    + PE    +S +ER++I ++   +   +  +S  IPW+ +++  P++AI        W F +    + TY   +    +++   L + P+LA  +F   GG  AD L+++   S T IRK    LG  +  +  +A  F   + + A   L+L++ F     AG  +N +D+AP YAG+++G +N+ +   G L+  +  ++    + + W +   ++A I +F    YL+F S ++Q WA  +E  +E
Sbjct:    1 GGTGLLWSIVWFLFAFDSPERHPRISAEEREFILKSLQAERQANHGTS--IPWRHVWTCMPLWAINVAMFCSGWGFYVLLTSLPTYMSTVLHYEMQQNGLLSALPYLAGWVFTVAGGMAADALRIRGLLSITAIRKVATTLGLAVPSLCLVASGFVGCNHLLAVSFLTLSVAFGAFTTAGCGINQLDIAPQYAGVLLGISNTFNNLPGFLAPTLTGYLTEHDTLKEWHMVFFISAAINMFGALFYLVFGSGKQQSWA--REGGLE 261          
BLAST of slc17a-4 vs. Ensembl Nematostella
Match: EDO45514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS9])

HSP 1 Score: 162.54 bits (410), Expect = 6.360e-44
Identity = 125/472 (26.48%), Postives = 218/472 (46.19%), Query Frame = 2
Query:  182 KKRYLIALLCTIGLTVVIGMR------------SEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLP----VCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRK--CXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQ--GWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            + RY +ALL  +G  VV G+R            S   GI  N  +            ++    W D   +  +  + F+ Y+     GG+L  +     L G  V  T    L  P     G      I M+I LR+L+G+ EG   PA+  +   W P  E+S +L LS  G  +G +I +P    +CA  E   GW  VFYI+ ++G++W + W  +V E+P +   +S+ ER YI  +             + PW  I+SS  V+AI   +  ++W F      + +Y+ ++    +    +L + P+  + +F+ I G +AD+L  +   S + +RK  C+         +   + +       +  L S ALGF+G  ++G+ VN +D+AP YAG++MG  NS  T  GI +  +A +I +K      W+I   ++AG+ +     ++  +   +++W  P++  ++
Sbjct:   23 RVRYTLALLACLGFCVVYGLRVNLSVALVAMVNSTYDGIDGNTNSECPGGNTPDTTYKNGDFNW-DQKTQGLILGSFFYGYICTQLPGGWLASQFGGKHLFGFGVLCTSIFTLLTPWAAHQG------IPMLIALRILEGLGEGVTFPAMHAIWSSWAPPLERSKLLTLSYAGCQLGNIIFMPLAGVLCAS-EIAGGWPSVFYIFGSLGILWFVVWTLMVTEKPADHPTISEAERDYIISSIGTSQDRKTTKQNT-PWSAIWSSPAVWAIIIAHFCNNWGFYTFLTLLPSYFKEVLNFSILTNGFLSAVPYSTQWLFIVIAGQIADWLLRRRISSVSDVRKVFCVTAFIIPACLLVATSYTGCTTTTLSVCLFSTALGFTGFNLSGFNVNHLDIAPRYAGILMGITNSFGTVPGIAAPYVAGWITNKKPDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRWNIPEKDMIQ 485          
BLAST of slc17a-4 vs. Ensembl Nematostella
Match: EDO48671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA9])

HSP 1 Score: 159.458 bits (402), Expect = 3.798e-43
Identity = 117/462 (25.32%), Postives = 222/462 (48.05%), Query Frame = 2
Query:  188 RYLIALLCTIGLTVVIGMR---SEMLGIITNLKNSSDHSQLIFKP--------SQHRKM-----PWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQ---KWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIV-SKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWA 1513
            RY++A++  +G+ V   +R   S  +G + N    +++   I K          +H+K+      W    ++  +  A ++ Y+     GG+L  +   + + G  + +   + +  PL           +  +I LR+++G+  G L P    +   W P +E++ +  ++V G  +G ++ +P+   + +     GW  VFY +  +GL+W   W   +   P     +S++E+ YI        +       SIPWK I +S PV+AI       DW      +C+  Y++++ K  + KT +L + P++ ++   P GG + D+L +K   S    R+C+  +G  +  IF +A  +A     A  LL++ +G +G+  AGYAVN++D+AP YAG++MG  N      G +S  I   I  +K ++ W++   +   + +  + ++ L  S +KQKWA
Sbjct:    1 RYIVAIMVFLGICVQYALRVNLSVAIGAMCNPHTVTENGFTIKKVLVVYCVTVRRHQKVLPAEFDWSSK-LQGTILGAFYYGYMTMQLPGGWLGQRFGGTRVFGICLGIASVLTMLTPLAART------SVVALITLRVIEGLTLGALFPCNHAIWSKWAPPSERTRLFTITVAGCPVGTILSMPLSGLMSKYGFDGGWASVFYCFGAVGLLWFFVWQLSIHATPSEHPTISEEEKVYI----ETAIADQPGVKLSIPWKSILTSGPVWAIIIANFTADWGMYTILICLPKYFIEVLKFDLAKTGFLAALPYVLKAFVGPTGGVIVDWL-IKNKLSVKNTRRCVFTVGCTVASIFVLATGYANQPYLAVGLLTIGVGITGINAAGYAVNILDIAPKYAGVIMGVTNVFGAAPGFISPQIVGIITPNKTAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKWA 450          
BLAST of slc17a-4 vs. Ensembl Nematostella
Match: EDO31704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX52])

HSP 1 Score: 155.221 bits (391), Expect = 3.361e-41
Identity = 125/458 (27.29%), Postives = 215/458 (46.94%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQ---KWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIV-SKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMED 1546
            KRY++  +  +G   +  MR  +   I  + N    S+      +  +  W D  ++  V  + F+ Y V    G +L ++   + + G  V +T  + L  P+           +  ++ +R+ QG+  G   P    +   W P  E+ST++ +S+ G   G ++ +P+   + +     GW  VFY +   G+IW   W  +V E P     +SK+ER+ I ENS   S    +    +PW  I   K V+AI   +    W +      M TY+  +    +E+T +L + P+L +++  P+GG LAD+L         T+R     +G  L G+F +A S+A       I L L +GFSGL   GYAVN +D+AP YAG++MG  N+ ++  G +S  I   +   K  + W+I   +   + + ++  Y    S  +Q WA  ++Q VE+ +
Sbjct:   38 KRYVLLAMTWLGFINIYSMRVNLNVAIVGMVNDQTISKGRLHFIKKAEFNW-DSALQGLVLGSFFYGYWVLQIPGAWLAMRIGGTRVFGYGVFVTSLLALLTPVATRY------SVWGLVGVRIFQGLFLGVTFPCNHAIWSKWAPPFERSTLITISIAGCPFGNIVAIPLTGLLSKYGFDGGWPSVFYCFGTSGIIWYCCWELVVHESPATHPTISKEERELI-ENSIASSDNKAQFEG-LPWHHILRCKAVWAIVIGHFGACWGYYTLFTGMPTYFKDVLDFDIEQTGFLAACPYLFKALLAPLGGILADYLIKHNILRIGTVRVIFYAVGCLLAGVFIVATSYATTRHMCVIFLVLGVGFSGLNAIGYAVNHLDIAPQYAGVLMGLTNTFASTPGFISPQITGIVTKHKKQEEWRIVFWITMIVYVVAVIGYSALCSGYRQPWAGGRDQ-VELSE 485          
BLAST of slc17a-4 vs. Ensembl Nematostella
Match: EDO46366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH0])

HSP 1 Score: 153.68 bits (387), Expect = 7.930e-41
Identity = 123/464 (26.51%), Postives = 212/464 (45.69%), Query Frame = 2
Query:  188 RYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEI-EQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQG------WKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPE 1558
            RY++A+L   GLTV   +R  +   +  + NS+   Q      +     W D      +  + F+ Y+V    GG+L  ++     +G  V ++  ++L  PL             M+I LR+L+G+A+G + P+V  +L  W P  E+S +L ++  G   G +IGL V   +   ++ W  VFY++   G++W +FW  +V + P     +S +E++YI   +   S          PW+ I +S+ V AI  ++   +W F      + TY+ ++    +     L + P+  +       GFLAD+L      + T +RK      F L     +AL F    + A  LL +   F  +   G+ ++ ++ AP Y GL+   ANSI T TGI     A F+V  ++ G      W+    + AGI +F    +    +S++Q W  P E+ +   D+  E
Sbjct:   11 RYILAVLGCFGLTVTFSLRVNLSVALVAMVNSTQTGQ-----PKEDYFSW-DQQTRGIILGSFFYGYIVMLIPGGWLAERNGGKHFVGLGVLISSVLSLLTPLAARY------SYKMLIVLRILEGLAQGVIYPSVNVLLSCWAPPEERSKMLVITWTGCQAGNIIGLVVSGLLCASRFQWPSVFYLFGASGIVWYLFWCFLVYDSPSVHPRISLEEKEYIV-TAIGASQDKVVKKHPTPWRQILTSRAVLAISISFFCSNWGFCTFLTSLPTYFQEVLHFNITTNGLLSALPYFCQYFTSLPAGFLADWLIHSHIITVTEVRK-----IFTLASCIMVALGFTNQPVVAVTLLCVLFMFQTIDTCGHWISPMEFAPRYCGLLFAIANSIGTSTGI----AAPFVVGYLTNGQPTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPWNTPPEENLVPVDLPHE 452          
BLAST of slc17a-4 vs. Ensembl Nematostella
Match: EDO31712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX51])

HSP 1 Score: 131.339 bits (329), Expect = 2.060e-33
Identity = 103/393 (26.21%), Postives = 191/393 (48.60%), Query Frame = 2
Query:  350 MEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIF--LRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEI-EQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILS-TVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWAN 1516
            M+  V  + ++ Y V     G+  +K     + G  + +   + L  P         I K + I+F  LR+ QG++ G +  A   +   W P  E++++L ++  G  +G ++ +PV   + +   GW + FY   ++G++W I W   + E P++   +++ E ++I        +  + + + +PW  I  S PV+A   T    DW F    +C+  +  Q+    + +T ++ + PF+  +I  P+ G  AD L+ +   S   IRK     G      F +A+ +      +  LL+L +G  GL  AG   N+IDL+P YAGL+MGF+N++ + +G L+  V+    V    + W++   + A + L  + +Y+ F S +KQ WA+
Sbjct:   40 MQGLVLGSFYYGYAVLQIPAGWAVLKIGGKPIFGFGILVASVLALVTPP--------IVKQSFIVFICLRIAQGLSLGLIASAHHCIWATWSPIFERASLLTIAGSGTLVGTIVTMPVTGLLCDSPKGWPLAFYFIGSLGVLWFIAWQYFMYETPQDHPTITQAEIEFI----GVPWNIDEATKSVVPWASILCSTPVWAANFTMFISDWCFYSMLICIPLFMKQVLHFSLSETGFVSALPFVLMTIVSPVSGMYADRLRARGVLSTGAIRKIFQCAGLAASSCFVVAVGYESKPFLSLALLTLGIGSFGLIAAGVGPNLIDLSPKYAGLLMGFSNTMGSLSGFLAPGVVGVLTVHGTLEEWRLVFWLTAVLSLAGILVYVAFGSGKKQSWAD 420          
BLAST of slc17a-4 vs. Ensembl Medaka
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:101175075])

HSP 1 Score: 218.009 bits (554), Expect = 4.104e-63
Identity = 135/454 (29.74%), Postives = 238/454 (52.42%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA+L  +G  +  G+R  + + I++ + NS+ H        +  K  W DP     +  + F+ Y+V    GG+++ +  ++ + G ++ +T  +N+F+P      +        +IF+R+LQG+ EG   PA  G+   W P  E+S +  LS  G   G +I +P+   + Q  GW  VFY+Y + G+ W +FW  +  E P     ++++ER+YI E+    +           PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VP+GG LAD+L+     S T +RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+E   E
Sbjct:   69 RRYIIAILSGLGFCISFGIRCNLGVAIVSMVNNSTIHQNGKIIVKEKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIP------SAARSHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATLSFCGSYAGAVIAMPLAGVLVQYTGWSSVFYVYGSFGIFWYMFWILVSYESPAEHPTITEEERRYIEESIGESAQLMGPSEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPLGGQLADYLRSHNIMSTTMVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADPEETKEE 515          
BLAST of slc17a-4 vs. Ensembl Medaka
Match: SLC17A6 (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:101166288])

HSP 1 Score: 213.001 bits (541), Expect = 2.583e-61
Identity = 136/454 (29.96%), Postives = 237/454 (52.20%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEM-LGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXX-XXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVE 1537
            +RY+IA++  +G  +  G+R  + + I+  + NS+ H        +  K  W DP     +  + F+ Y+V    GG++  +  ++ + G ++ +T  +N+F+P    +          +IF+R+LQG+ EG   PA  G+   W P  E+S +  +S  G   G +I +P+   + Q  GW  VFY+Y  +G+ W IFW  +  E P +   ++ +ER YI E+    +  S        PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P L  +I VPIGG LAD L+ K   + TT+RK +   GFG++    + + ++  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K  + W+    +A+ +    +  Y +FAS EKQ WA+P+  + E
Sbjct:   65 RRYIIAIMSGMGFCISFGIRCNLGVAIVGMVNNSTIHQNGKIIIKEKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYICSRLAANRVFGAAIVLTSTLNMFIPSAARV------HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATISFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGCVGIFWYIFWILVSYESPADHPTITDEERCYIEESIGESARLSGPGEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQLADHLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADPELTSEE 511          
BLAST of slc17a-4 vs. Ensembl Medaka
Match: ENSORLT00000010015.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 204.912 bits (520), Expect = 9.534e-59
Identity = 138/469 (29.42%), Postives = 241/469 (51.39%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSS----DHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILST-VIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCHK 1576
            +RY+IA+L  IG  +  G+R  +   + ++ NS      + ++I K     +  W DP     +  + F+ Y+V    GGF+  K  ++ + G ++  T  +N+ +P    +          +I +R+ QG+ EG   PA  G+   W P  E+S +   +  G   G +I +P+   + Q  GW  VFY+Y + G++W  FW  +  E P     ++++ER+YI E S  +S+    +  + PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG +AD+L+     + T +RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +A+ +    +  Y LFAS EKQ WA P+E +VE   I  E  L ++
Sbjct:   13 RRYIIAILSGIGFCISFGIRCNLGVAVVSMVNSHKVLRGNKEVIVKA----QFEW-DPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAAARM------HFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYI-EESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQGVFLIASLVHYGGVIFYGLFASGEKQTWAEPEELSVEKCGILDEDELANE 469          
BLAST of slc17a-4 vs. Ensembl Medaka
Match: ENSORLT00000010014.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 204.527 bits (519), Expect = 2.967e-58
Identity = 138/469 (29.42%), Postives = 241/469 (51.39%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD----HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCHK 1576
            +RY+IA+L  IG  +  G+R  +   + ++ NS      + ++I K     +  W DP     +  + F+ Y+V    GGF+  K  ++ + G ++  T  +N+ +P    +          +I +R+ QG+ EG   PA  G+   W P  E+S +   +  G   G +I +P+   + Q  GW  VFY+Y + G++W  FW  +  E P     ++++ER+YI E S  +S+    +  + PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   + + P L  +I VPIGG +AD+L+     + T +RK +   GFG++    + + F+  +  A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +    K  + W+    +A+ +    +  Y LFAS EKQ WA P+E +VE   I  E  L ++
Sbjct:   58 RRYIIAILSGIGFCISFGIRCNLGVAVVSMVNSHKVLRGNKEVIVKA----QFEW-DPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAAARM------HFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYI-EESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQGVFLIASLVHYGGVIFYGLFASGEKQTWAEPEELSVEKCGILDEDELANE 514          
BLAST of slc17a-4 vs. Ensembl Medaka
Match: slc17a8 (vesicular glutamate transporter 3 [Source:NCBI gene;Acc:101165727])

HSP 1 Score: 203.371 bits (516), Expect = 9.277e-58
Identity = 136/452 (30.09%), Postives = 232/452 (51.33%), Query Frame = 2
Query:  170 CGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGIL-STVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPK 1522
            CG   KRY+IA+L  +G  +  G+R  +   I  + N++          Q  +  W DP     +  + F+ Y+V    GGF+  K  ++ + G ++ +T  +N+F+P    +          ++F+R+LQG+ EG   PA  G+   W P  E+S +   S  G   G +I +P+   + Q  GW  VFYIY   G++W + W  +    P +   ++++ER YI   ++   + ++ S    PW+  F+S PVYAI        WTF +  +    Y+ +++   + K   L + P +  +I VPIGG LADFL+ K   S T +RK +   GFG++    + + F+     A   L LA+GFSG A++G+ VN +D+AP YA ++MG +N + T +G++   ++ +   +K    W+    +A+ +    +  Y +FAS E+Q WANP+
Sbjct:   67 CGGLPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTPVLQRAQFNW-DPETVGLIHGSFFWGYIVTQIPGGFIANKLSANRVFGAAIFLTSVLNMFIPSAARV------HYGCVLFVRILQGLVEGVTYPACHGLWAKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQYVGWPSVFYIYGVFGIMWYVMWLLLAYGSPADHPTITEEERLYI--EAAIGETVNQLSKFRTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIVVPIGGQLADFLRSKKIMSTTNVRKLMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKNKTRLEWQHVFVIASMVHYSGVIFYAIFASGEQQDWANPE 509          
BLAST of slc17a-4 vs. Planmine SMEST
Match: SMESG000061339.1 (SMESG000061339.1)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 506/507 (99.80%), Postives = 506/507 (99.80%), Query Frame = 2
Query:   89 MIPNEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCHKIVIDAKSDEDF 1609
            MIPNEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENSSFKSSFSKKSSASIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCLAGLGFGLKGIFFIALSFAKDEMSATILLSLALGFSGLAVAGYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPEL LCHKIVIDAKSDEDF
Sbjct:    1 MIPNEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENSSFKSSFSKKSSASIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCLAGLGFGLKGIFFIALSFAKDEMSATILLSLALGFSGLAVAGYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELHLCHKIVIDAKSDEDF 507          
BLAST of slc17a-4 vs. Planmine SMEST
Match: SMESG000012683.1 (SMESG000012683.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 304/482 (63.07%), Postives = 367/482 (76.14%), Query Frame = 2
Query:   98 NEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD-------HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQ-GWKIALCMAAGIQLFSMQMYLLFASSEKQKWANP 1519
            NE   EFD K     ++       CGPG+KR+LI LLCT  LT+VIGMRSEMLGII+N+K++S           LIFKPS+HR +PW D ++EDF+ENAVFF+ ++ SPIGG+LTV HD SLLLG SVAMTCG NLFLPLV T+G+N   KITM+I +R+ QG+AEGCL+PA+FGVLRFW P NE+S+I+C SVIGVS+GPLIGLP+CA IE+KWGWGVVFYIYAN+GL+WCIFWWR+VDERP   +++S QER Y+              +  IPWK IF SK +YAI  TYAADDWTFQI+SVCMQ+YY   Y   +E TI LL +PFLARSIFVP GG +AD L   TT SWT IRK L  +GFGLKGIFFIA++FAKDE +AT++LSL LGFSG+AVAGYAVNVI++APNYAGL+MG A+ +STFTGI STVIAS +V  M Q GW IALC A  IQLFS+ MYL F S +++ WA P
Sbjct:   23 NEFKTEFDNK----PKNKSRKIFCCGPGRKRHLIPLLCTTALTIVIGMRSEMLGIISNIKSNSSFDSKNSIDDNLIFKPSKHRNLPWTDNLLEDFIENAVFFANMIGSPIGGYLTVNHDPSLLLGSSVAMTCGFNLFLPLVATIGSNDTIKITMVIIMRIFQGLAEGCLIPAIFGVLRFWAPVNERSSIICFSVIGVSLGPLIGLPLCAAIEKKWGWGVVFYIYANLGLVWCIFWWRLVDERPSRSKSISAQERDYLLA-CIDSKVEKANRNLPIPWKEIFRSKSIYAILFTYAADDWTFQITSVCMQSYYEFKYHSDIENTITLLVYPFLARSIFVPAGGAVADILGFTTTLSWTAIRKILTSIGFGLKGIFFIAMAFAKDEKTATVMLSLCLGFSGIAVAGYAVNVIEIAPNYAGLIMGMASGLSTFTGIGSTVIASVMVQSMKQYGWMIALCSAGAIQLFSLSMYLWFGSCKEEPWAFP 499          
BLAST of slc17a-4 vs. Planmine SMEST
Match: SMESG000032477.1 (SMESG000032477.1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 290/416 (69.71%), Postives = 345/416 (82.93%), Query Frame = 2
Query:  137 FDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD-----HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTG 1369
            F  +   NF  CGPGKKRYL+A LCT+GLT+VIGMRSEMLGII+NLKN SD      S LIFKPS+HRK+PW +P+MEDFVENAVFF+Y++ASPIGG+LTV HDSSLL G SVAMTCGINLFLPLVET+  ++  KI MII LR+LQG+AEGCL+PA+FGVLRFW P NE+STI+CLSVIGVS+GPLIGLPVC +IE KWGWGVVFYIYAN+GLIWCIFWWR++DE+P  D +LS  E+ ++ ++       + K    IPWK I  S+P+YAI  TYAADDWTFQISSVCMQ+YY   Y   ++KTI+LLSFPFLARS+FVPIGG LAD + LKT+WSWT IRK L GLGFGLKGIFF+A+ FA+DE +AT+LLSL LGFSGLAVAGYAVNV+++APNYAGL+MG A+ +STFTG
Sbjct:    5 FRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQS-IESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKLLTGLGFGLKGIFFVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTG 419          
BLAST of slc17a-4 vs. Planmine SMEST
Match: SMESG000019933.1 (SMESG000019933.1)

HSP 1 Score: 199.134 bits (505), Expect = 3.619e-57
Identity = 142/459 (30.94%), Postives = 244/459 (53.16%), Query Frame = 2
Query:  179 GKKRYLIALLCTIGLTVVIGMRSEMLGI----ITNLKN----SSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMS--QGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKE 1525
            G KRYL+A+L   GL + +GMR E +GI    +T L +    + +++   FK  Q R++ W +  +   +E + +  Y + S  GGFL+    ++ + G +V  +   N  +PL+       +     +  LR+ QGM+EGCL P+V    R+W PK E+S ++ +S  G+++GP+IG P+   + +++ W   FY +    + W + W  +  + P  D  +S+ E+ YI +N    +S    +++ +PW  I +S PV+AI       +WT+Q S   + ++  + +        + +S P++  +I  P  G +AD + +K  +S   +RK    +GFG+ G+ F+ L F      AT  LS+ LG  G+ ++G+ VN +D+A  YAG++MG +N I T  GIL+ ++A  I +K S   GW I   ++  I L ++  Y +FAS E Q WA   E
Sbjct:   14 GNKRYLLAILACFGLLIPLGMRCE-IGIAIIKLTELHDMVVPAGNNNISEFKVIQVREVAWSNTKV-SLIEASFYIGYTLFSIPGGFLSTIFPANKVFGFAVFTSAFFNFAIPLLVIYQCGFVS----VFVLRIFQGMSEGCLYPSVHSFWRYWAPKQERSKLVTISFFGMALGPIIGYPISGILTKRYDWPANFYFWGTAAMSWAVIWLAVSRKCPSQDSFISEAEKTYIEQN----TSQMAITASQVPWISILTSVPVWAIIIANIGRNWTYQFSFSGLPSFLRKKFNDSSINLGFHMSIPYIVMAILTPSCGIVADCM-IKRKFSVAFVRKFFNSVGFGIAGLMFLFLGFIPYLWLATTTLSIGLGSFGIGISGFGVNHLDIADIYAGVLMGISNGIGTLAGILAPIVAMEITNKFSVNDGWLIFFIISGIIHLITVTFYAIFASGENQSWAVHTE 461          
BLAST of slc17a-4 vs. Planmine SMEST
Match: SMESG000075620.1 (SMESG000075620.1)

HSP 1 Score: 150.984 bits (380), Expect = 1.727e-39
Identity = 117/457 (25.60%), Postives = 218/457 (47.70%), Query Frame = 2
Query:  185 KRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSDHSQLIFKPS--QHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENXXXXXXXXXXXXXXIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCXXXXXXXXXXXXXXXXSFAKDEMSATIXXXXXXXXXXXXXXXYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMS-QGWKIALCMAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMED 1546
            +R+++  LC  GL +V  MR  +   +  + ++  HS++  + +     K+ W    M   + +  +  +++    GG+++ K  S+ L    + ++C +N+ LP+     N          F+RL QG++EG + PA++ ++  W P             G+  GP+IG P+   I   W W  VFY+++  G+IW I  + +  E P    ++S+ E  Y+  +              IPW  IFSS  V+AI        W F I  +  +  YL  +K  + +     + P + + I   + G+L + L      S T +RK    LGFG++ +    L FA   + A + L + +GFSGLAV+G+ +N +D+AP ++G++ G + +  TF GILS ++   I    +   W+ +  +   +  F + ++ +F   ++  W N +E+ + +E 
Sbjct:   45 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSK-MIGILHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNAN-----YCFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMF-ILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW-NSEEEIILLEK 487          
The following BLAST results are available for this feature:
BLAST of slc17a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A66.879e-6229.80solute carrier family 17 member 6 [Source:HGNC Sym... [more]
SLC17A79.433e-6029.39solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A81.649e-5829.23solute carrier family 17 member 8 [Source:HGNC Sym... [more]
SLC17A72.448e-5628.95solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A52.767e-4727.11solute carrier family 17 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-42.179e-5227.95Probable vesicular glutamate transporter eat-4 [S... [more]
eat-42.903e-5227.95Probable vesicular glutamate transporter eat-4 [S... [more]
slc-17.12.970e-4123.94SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-17.15.355e-4123.94SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
vglu-37.152e-3725.55Potential vesicular glutamate transporter vglu-3 ... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFS93.066e-5827.31gene:FBgn0038799 transcript:FBtr0083889[more]
MFS93.066e-5827.31gene:FBgn0038799 transcript:FBtr0083888[more]
VGlut1.849e-5531.19gene:FBgn0031424 transcript:FBtr0307078[more]
VGlut1.849e-5531.19gene:FBgn0031424 transcript:FBtr0331202[more]
VGlut1.849e-5531.19gene:FBgn0031424 transcript:FBtr0077769[more]
back to top
BLAST of slc17a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a6a1.687e-6229.52solute carrier family 17 member 6a [Source:NCBI ge... [more]
slc17a6b9.635e-6030.04solute carrier family 17 member 6b [Source:NCBI ge... [more]
slc17a81.914e-5930.48solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a82.397e-5930.48solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a7b2.085e-5629.76solute carrier family 17 member 7b [Source:ZFIN;Ac... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrpap11.982e-6230.33LDL receptor related protein associated protein 1 ... [more]
lrpap13.699e-6230.33LDL receptor related protein associated protein 1 ... [more]
lrpap14.163e-6230.33LDL receptor related protein associated protein 1 ... [more]
lrpap15.094e-6230.33LDL receptor related protein associated protein 1 ... [more]
lrpap15.120e-6230.33LDL receptor related protein associated protein 1 ... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc17a61.987e-6230.02solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a71.106e-5929.17solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a85.552e-5929.23solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a78.180e-5728.24solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a83.344e-4730.22solute carrier family 17 (sodium-dependent inorgan... [more]
back to top
BLAST of slc17a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5W8I7|VGL2B_DANRE1.341e-6129.52Vesicular glutamate transporter 2.2 OS=Danio rerio... [more]
sp|Q9JI12|VGLU2_RAT1.590e-6130.02Vesicular glutamate transporter 2 OS=Rattus norveg... [more]
sp|A6QLI1|VGLU2_BOVIN2.304e-6130.02Vesicular glutamate transporter 2 OS=Bos taurus OX... [more]
sp|Q9P2U8|VGLU2_HUMAN3.304e-6129.80Vesicular glutamate transporter 2 OS=Homo sapiens ... [more]
sp|Q8BLE7|VGLU2_MOUSE5.703e-6129.80Vesicular glutamate transporter 2 OS=Mus musculus ... [more]
back to top
BLAST of slc17a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFB10.000e+0100.00Slc17a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YF210.000e+065.46Slc17a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A2H1CTT30.000e+061.70Transporter, major facilitator family protein OS=F... [more]
A0A504Z2220.000e+062.23Vesicular glutamate transporter OS=Fasciola gigant... [more]
A0A3P6SKB10.000e+059.78MFS domain-containing protein OS=Dibothriocephalus... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a6a1.865e-6229.74solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a6a1.865e-6229.74solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a6b1.999e-6129.52vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6b2.406e-6129.52vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a83.081e-5730.26solute carrier family 17 member 8 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc17a6b3.397e-4930.79solute carrier family 17 member 6b [Source:NCBI ge... [more]
ENSPMAT00000010352.13.790e-2526.79pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc17a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455146.360e-4426.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486713.798e-4325.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317043.361e-4127.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463667.930e-4126.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317122.060e-3326.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc17a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a6a4.104e-6329.74solute carrier family 17 member 6 [Source:NCBI gen... [more]
SLC17A62.583e-6129.96vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
ENSORLT00000010015.29.534e-5929.42vesicular glutamate transporter 1-like [Source:NCB... [more]
ENSORLT00000010014.22.967e-5829.42vesicular glutamate transporter 1-like [Source:NCB... [more]
slc17a89.277e-5830.09vesicular glutamate transporter 3 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061339.10.000e+099.80SMESG000061339.1[more]
SMESG000012683.10.000e+063.07SMESG000012683.1[more]
SMESG000032477.10.000e+069.71SMESG000032477.1[more]
SMESG000019933.13.619e-5730.94SMESG000019933.1[more]
SMESG000075620.11.727e-3925.60SMESG000075620.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014924
GenBankAKN21527.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014924 ID=SMED30014924|Name=slc17a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1669bp
CGCTGAGATTGGGATTTTTCCTATAGATGCCACATATAGTCTGCAATGGG
AGAATACAGTTCATTGAAAGGATAATTTGATAAGATAAATGATTCCAAAT
GAGATTTCCGATGAATTCGACGAAAAGCTGACTTTATTCGATGAGGACTC
GAAAACGAATTTCGTTTATTGTGGGCCAGGAAAAAAAAGGTATTTGATTG
CACTGCTGTGCACAATAGGGTTGACTGTTGTTATTGGGATGAGATCGGAA
ATGTTGGGAATTATTACGAATTTGAAAAATAGTTCAGATCATTCCCAGTT
GATCTTTAAGCCGTCACAGCATCGAAAAATGCCATGGAAAGATCCGATTA
TGGAGGATTTTGTTGAGAATGCAGTGTTTTTTTCATATCTCGTTGCCAGC
CCGATTGGTGGGTTTTTGACAGTGAAACACGATTCTTCACTGCTTCTTGG
ATGCTCAGTTGCTATGACATGTGGAATAAATTTATTTCTGCCATTGGTTG
AAACGTTAGGCAATAATCTTATCCCGAAAATAACGATGATAATTTTCCTT
CGCCTGTTGCAAGGAATGGCGGAAGGCTGTTTGGTACCGGCTGTTTTTGG
AGTTTTGCGATTTTGGTGTCCGAAAAATGAAAAGTCTACAATTCTATGTT
TATCTGTTATTGGCGTATCAATGGGACCGTTAATCGGTCTACCGGTTTGC
GCTGAAATCGAACAGAAATGGGGATGGGGTGTCGTTTTTTATATCTATGC
AAATATCGGTTTGATTTGGTGTATTTTCTGGTGGAGAATTGTTGACGAAA
GACCCGAAAATGACAGAAATCTGTCAAAACAGGAACGTCAATACATATTT
GAAAATTCGAGTTTCAAGTCTTCGTTTTCAAAGAAATCCAGCGCTTCGAT
TCCATGGAAATTAATATTTTCTTCCAAGCCAGTTTATGCTATATTTTGTA
CATATGCTGCAGACGACTGGACATTTCAGATATCATCGGTTTGCATGCAG
ACATATTATCTACAAATGTACAAAGTTAGGGTTGAAAAGACTATTTATTT
ATTGTCATTCCCATTTCTAGCTAGATCTATATTTGTGCCAATCGGAGGTT
TTTTGGCTGATTTCCTAAAATTGAAGACCACTTGGTCATGGACAACGATT
CGCAAATGTTTGGCTGGACTAGGATTCGGATTGAAAGGCATATTTTTCAT
TGCATTGAGTTTTGCAAAGGATGAAATGTCAGCTACGATTTTACTCTCTT
TAGCTCTCGGTTTCTCAGGATTAGCTGTGGCCGGCTATGCTGTTAATGTT
ATAGACTTGGCCCCTAATTATGCTGGATTAGTGATGGGATTTGCAAATAG
TATTAGTACATTCACAGGAATCCTTTCAACGGTTATTGCATCCTTTATTG
TTAGTAAAATGTCTCAAGGATGGAAAATTGCTTTATGCATGGCAGCTGGA
ATTCAGCTATTTTCAATGCAAATGTATCTGCTTTTTGCATCGTCAGAGAA
ACAAAAGTGGGCAAATCCTAAGGAACAGACTGTAGAAATGGAAGACATTA
GTCCGGAATTGCCTCTCTGTCATAAAATTGTAATCGATGCTAAAAGTGAT
GAAGATTTTATAAATCTTGTGAACGTCCAATAAAAACAAATTATTATTAT
TGTGGAATATTAATCGGAG
back to top

protein sequence of SMED30014924-orf-1

>SMED30014924-orf-1 ID=SMED30014924-orf-1|Name=SMED30014924-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=515bp
MIPNEISDEFDEKLTLFDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIG
MRSEMLGIITNLKNSSDHSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSY
LVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITM
IIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIG
LPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQER
QYIFENSSFKSSFSKKSSASIPWKLIFSSKPVYAIFCTYAADDWTFQISS
VCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWS
WTTIRKCLAGLGFGLKGIFFIALSFAKDEMSATILLSLALGFSGLAVAGY
AVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKMSQGWKIALC
MAAGIQLFSMQMYLLFASSEKQKWANPKEQTVEMEDISPELPLCHKIVID
AKSDEDFINLVNVQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 31..245
e-value: 4.0E-23
score: 83.8
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 268..482
e-value: 1.9E-19
score: 71.8
NoneNo IPR availablePANTHERPTHR11662:SF418VESICULAR GLUTAMATE TRANSPORTER, ISOFORM Acoord: 32..484
NoneNo IPR availablePANTHERPTHR11662SODIUM-DEPENDENT PHOSPHATE TRANSPORTERScoord: 32..484
NoneNo IPR availableCDDcd17318MFS_SLC17coord: 38..467
e-value: 7.83968E-67
score: 218.642
NoneNo IPR availableTMHMMTMhelixcoord: 415..437
NoneNo IPR availableTMHMMTMhelixcoord: 383..405
NoneNo IPR availableTMHMMTMhelixcoord: 117..136
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 357..376
NoneNo IPR availableTMHMMTMhelixcoord: 151..173
NoneNo IPR availableTMHMMTMhelixcoord: 91..110
NoneNo IPR availableTMHMMTMhelixcoord: 185..203
NoneNo IPR availableTMHMMTMhelixcoord: 444..466
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
NoneNo IPR availableTMHMMTMhelixcoord: 320..342
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 95..430
e-value: 1.5E-32
score: 112.9
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 38..471
score: 11.058
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 31..476