ADP-ribosylation factor

Overview
NameADP-ribosylation factor
Smed IDSMED30014923
Length (bp)736
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor (SMED30014923) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor (SMED30014923) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor (SMED30014923) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor (SMED30014923) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014923

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014923SMESG000052763.1 dd_Smed_v4_2013_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30014923SMESG000052763.1 dd_Smed_v4_2013_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014923SMESG000052763.1 dd_Smed_v4_2013_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30014923SMESG000052763.1 dd_Smed_v4_2013_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30014923SMESG000052763.1 dd_Smed_v4_2013_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 196.438 bits (498), Expect = 5.289e-63
Identity = 98/175 (56.00%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 196.438 bits (498), Expect = 5.289e-63
Identity = 98/175 (56.00%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 196.438 bits (498), Expect = 5.289e-63
Identity = 98/175 (56.00%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 196.052 bits (497), Expect = 8.357e-63
Identity = 99/176 (56.25%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG +   L K LIG+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFGNLLKSLIGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 196.052 bits (497), Expect = 8.357e-63
Identity = 99/176 (56.25%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG +   L K LIG+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFGNLLKSLIGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-3 (ADP-Ribosylation Factor related; ADP-ribosylation factor related (20.5 kD) (Arf-3) [Source:UniProtKB/TrEMBL;Acc:G5EFK4])

HSP 1 Score: 192.971 bits (489), Expect = 3.543e-62
Identity = 93/173 (53.76%), Postives = 125/173 (72.25%), Query Frame = 1
Query:  118 AVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
             ++S  N+L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ E+R+EL  +   +E+    ++V ANKQDLP+A T +++ DKL L  L R  +W++QA CA  G GLYE +
Sbjct:    4 TISSLFNRLFGK----RQVRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDKERIEESREELHKMLNEDELRDATLLVFANKQDLPNAMTAAELTDKLGLHNL-RSRQWYIQATCATQGHGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 192.2 bits (487), Expect = 8.742e-62
Identity = 97/176 (55.11%), Postives = 125/176 (71.02%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V   L K L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP A   +++ DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFGSLFKGLFGK----REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSL-RNRSWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 192.2 bits (487), Expect = 8.742e-62
Identity = 97/176 (55.11%), Postives = 125/176 (71.02%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V   L K L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP A   +++ DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFGSLFKGLFGK----REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSL-RNRSWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 192.2 bits (487), Expect = 8.742e-62
Identity = 97/176 (55.11%), Postives = 125/176 (71.02%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V   L K L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP A   +++ DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFGSLFKGLFGK----REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSL-RNRSWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-6 (ADP-Ribosylation Factor related [Source:UniProtKB/TrEMBL;Acc:Q9U2S4])

HSP 1 Score: 174.866 bits (442), Expect = 5.246e-55
Identity = 88/168 (52.38%), Postives = 114/168 (67.86%), Query Frame = 1
Query:  133 LNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            + K + +I      R+LMLGLDAAGKTTILYKLKL + V TIPT+GFNVE V   K + F +WDVGGQ+KIRPLW+HY T  QALI+V+D++D  R+ EAR EL  I    EM    ++V ANKQDL  A    +I DKL L ++ R   W++Q  CA +G+GL+E +
Sbjct:    1 MGKFLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRI-RDRNWYVQPSCASTGDGLHEGL 166          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 193.741 bits (491), Expect = 2.549e-62
Identity = 97/175 (55.43%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    +++ ANKQDLP+A   ++I DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSL-RNRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 193.741 bits (491), Expect = 2.549e-62
Identity = 97/175 (55.43%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    +++ ANKQDLP+A   ++I DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSL-RNRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299906)

HSP 1 Score: 193.741 bits (491), Expect = 2.549e-62
Identity = 97/175 (55.43%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    +++ ANKQDLP+A   ++I DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSL-RNRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299907)

HSP 1 Score: 193.741 bits (491), Expect = 2.549e-62
Identity = 97/175 (55.43%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    +++ ANKQDLP+A   ++I DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSL-RNRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078571)

HSP 1 Score: 193.741 bits (491), Expect = 2.549e-62
Identity = 97/175 (55.43%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    +++ ANKQDLP+A   ++I DKL L  L R+  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSL-RNRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 199.134 bits (505), Expect = 2.545e-64
Identity = 97/175 (55.43%), Postives = 127/175 (72.57%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K+ G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFKVFGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf2b (ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5234])

HSP 1 Score: 196.052 bits (497), Expect = 4.565e-63
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHAL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf2b (ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5234])

HSP 1 Score: 196.052 bits (497), Expect = 4.565e-63
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHAL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf2b (ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5234])

HSP 1 Score: 196.052 bits (497), Expect = 4.565e-63
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHAL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf2b (ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5234])

HSP 1 Score: 196.052 bits (497), Expect = 4.565e-63
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHAL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf5 (ADP ribosylation factor 5 [Source:NCBI gene;Acc:394614])

HSP 1 Score: 196.823 bits (499), Expect = 3.204e-63
Identity = 99/175 (56.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: dcaf7 (DDB1 and CUL4 associated factor 7 [Source:Xenbase;Acc:XB-GENE-973762])

HSP 1 Score: 196.823 bits (499), Expect = 3.925e-63
Identity = 98/190 (51.58%), Postives = 133/190 (70.00%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIKSK 678
            MG + S L + L+G  G+    R++MLGLDAAGKTT+LYKLK NE + TIPTIGFNVE V+  + ++FT+WDVGGQ +IR LWKHY T+   L++VVDS+D +R  EAR EL  I   EEM GVP +V+ANKQDLP AR   ++A++L L K++  H WH+Q CCA +G+GL E +     +  +F  ++
Sbjct:    1 MGNLFSSLYQILMGFHGTKA--RIIMLGLDAAGKTTVLYKLKFNETITTIPTIGFNVETVEPMRNVSFTVWDVGGQGRIRALWKHYFTNTDGLVFVVDSADCERFQEARLELEAILDAEEMRGVPFVVMANKQDLPGARRPMEVAEELGLPKIQ-GHPWHVQGCCAATGDGLVEGLEVFTNLVKQFQNTR 187          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf3 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:100145191])

HSP 1 Score: 196.052 bits (497), Expect = 7.576e-63
Identity = 99/176 (56.25%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG +   L K LIG+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFGNLLKSLIGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: fibp (fibroblast growth factor (acidic) intracellular binding protein [Source:Xenbase;Acc:XB-GENE-481175])

HSP 1 Score: 195.282 bits (495), Expect = 1.109e-62
Identity = 98/175 (56.00%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:NCBI gene;Acc:595036])

HSP 1 Score: 185.267 bits (469), Expect = 1.007e-58
Identity = 92/173 (53.18%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  118 AVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
             ++S  ++L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K + FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EA +EL  +   +E+    ++V ANKQDLP+A   S++ DKL L+ L R+  W++QA CA  G GLYE +
Sbjct:    4 TISSLFSRLFGK----KQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAVLLVFANKQDLPNAMAISEMTDKLGLQNL-RNRTWYVQATCATQGTGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 196.438 bits (498), Expect = 3.631e-63
Identity = 98/175 (56.00%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 196.438 bits (498), Expect = 3.631e-63
Identity = 98/175 (56.00%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K  G  G     R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFK--GLFGKKE-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf3 (ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:MGI:99432])

HSP 1 Score: 196.052 bits (497), Expect = 5.738e-63
Identity = 99/176 (56.25%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG +   L K LIG+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFGNLLKSLIGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf2 (ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:MGI:99595])

HSP 1 Score: 192.971 bits (489), Expect = 6.653e-62
Identity = 96/175 (54.86%), Postives = 123/175 (70.29%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V  KL K    +      R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V  NKQDLP+A   ++I DKL L  L R   W++QA CA SG+GLYE +
Sbjct:    1 MGNVFEKLFK---SLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSL-RQRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf2 (ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:MGI:99595])

HSP 1 Score: 192.971 bits (489), Expect = 6.653e-62
Identity = 96/175 (54.86%), Postives = 123/175 (70.29%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V  KL K    +      R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V  NKQDLP+A   ++I DKL L  L R   W++QA CA SG+GLYE +
Sbjct:    1 MGNVFEKLFK---SLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSL-RQRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|O48649|ARF1_SALBA (ADP-ribosylation factor 1 OS=Salix bakko OX=72444 GN=ARF1 PE=2 SV=3)

HSP 1 Score: 199.904 bits (507), Expect = 1.055e-63
Identity = 96/168 (57.14%), Postives = 123/168 (73.21%), Query Frame = 1
Query:  133 LNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
              KL+G + S    R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D  R+ EARDEL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L + H W++Q+ CA SGEGLYE +
Sbjct:    5 FTKLLGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|Q06396|ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0813400 PE=2 SV=3)

HSP 1 Score: 197.208 bits (500), Expect = 1.017e-62
Identity = 94/168 (55.95%), Postives = 122/168 (72.62%), Query Frame = 1
Query:  133 LNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
              KL   + +    R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EARDEL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L + H W++Q+ CA SGEGLYE +
Sbjct:    5 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P51823|ARF2_ORYSJ (ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica OX=39947 GN=ARF PE=2 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 1.051e-62
Identity = 94/168 (55.95%), Postives = 122/168 (72.62%), Query Frame = 1
Query:  133 LNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
              KL   + +    R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EARDEL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L + H W++Q+ CA SGEGLYE +
Sbjct:    5 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|O48920|ARF_VIGUN (ADP-ribosylation factor OS=Vigna unguiculata OX=3917 GN=ARF PE=2 SV=3)

HSP 1 Score: 196.823 bits (499), Expect = 1.716e-62
Identity = 94/168 (55.95%), Postives = 121/168 (72.02%), Query Frame = 1
Query:  133 LNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
              KL   + +    R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D  R+ EARDEL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L + H W++Q+ CA SGEGLYE +
Sbjct:    5 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P36397|ARF1_ARATH (ADP-ribosylation factor 1 OS=Arabidopsis thaliana OX=3702 GN=ARF1 PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 2.229e-62
Identity = 94/168 (55.95%), Postives = 121/168 (72.02%), Query Frame = 1
Query:  133 LNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
              KL   + +    R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D  R+ EARDEL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L + H W++Q+ CA SGEGLYE +
Sbjct:    5 FGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A1S3I8S2 (ADP-ribosylation factor OS=Lingula unguis OX=7574 GN=LOC106161789 PE=3 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.398e-76
Identity = 114/189 (60.32%), Postives = 144/189 (76.19%), Query Frame = 1
Query:  112 MGAVASKLNKLIG--EIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIK 672
            MG + SK+ + +   E+    P R+LMLGLDAAGKTTILYK+KLNE V+TIPTIGFNVE V   KGL+FT+WDVGGQ+KIRPLW+HY  + + LIYVVDSSD +RL E+ +ELF I    EM GVPV+VIANKQDLP A + +Q+ DKL+LRKL R +KWH+QA CA + +G+YEAM  + R+  +F K
Sbjct:    1 MGLLLSKIAQALQGFEMFKDDPARILMLGLDAAGKTTILYKVKLNENVSTIPTIGFNVETVSPCKGLSFTVWDVGGQDKIRPLWRHYYQNTEGLIYVVDSSDRERLAESSEELFGIMESPEMKGVPVVVIANKQDLPGALSAAQVIDKLQLRKLPRENKWHVQAACATTADGIYEAMDELARLVKDFKK 189          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: K1RG92 (ADP-ribosylation factor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10015931 PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 3.219e-75
Identity = 110/187 (58.82%), Postives = 140/187 (74.87%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIK 672
            MG   S L  L     S  P R++MLGLDAAGKTTILYK+KLNE V+TIPTIGFNVE V   KG+TFT+WD+GGQ+KIRPLWKHY  + + L+YVVDS+D +R+ E+R+ELF I   +EM GVPV+VIANKQDLP+A +TS++AD + L KL    KW++QA CA +GEG++EAM  +  M  E+ K
Sbjct:    1 MGLFFSSLKDLFETFSSGSPARIVMLGLDAAGKTTILYKIKLNEIVSTIPTIGFNVETVSPVKGVTFTVWDIGGQDKIRPLWKHYFNNTEGLVYVVDSNDRERILESREELFGILNSDEMRGVPVVVIANKQDLPNALSTSKVADLMSLHKLT-SRKWYIQAACATTGEGIFEAMKELSSMVKEYKK 186          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A210QTV1 (ADP-ribosylation factor 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10271 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 5.454e-73
Identity = 106/184 (57.61%), Postives = 142/184 (77.17%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTE 663
            MG + +KL  ++    S    R+LMLGLDAAGKTT+LYK+KLNE V+TIPTIGFNVEEV   KG++FT+WDVGGQ+KIRPLW+HY  D + L+YVVDS+D +R++EAR+ELF I   +EM GVPV+V+ANKQDLPHA  T+++AD++ L KL    KW +Q  CA++G+G+YE M  + R++ E
Sbjct:    1 MGLLFAKLADVMQSFSSGSTTRILMLGLDAAGKTTVLYKIKLNENVSTIPTIGFNVEEVSPCKGVSFTVWDVGGQDKIRPLWRHYFQDTEGLVYVVDSNDRERISEAREELFGILENDEMRGVPVVVLANKQDLPHAMNTAEVADRMCLMKLT-GRKWFVQGACAMNGDGIYEGMKEMARLTKE 183          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A2C9JMI3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106060154 PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.603e-72
Identity = 106/188 (56.38%), Postives = 142/188 (75.53%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIKS 675
            MG + +KL + +    +  P RVLMLGLDAAGKTTILYK+KLNE V TIPTIGFNVE V   KG+TFT+WDVGGQEKIR LW+HY  + Q L+++VDS+D  R  EA++ELF +   +EM GVPV+V+ANKQDLP A +T+++AD+L LR++ +  KW +Q  CA++G+G+YEAM  +  +  +FIKS
Sbjct:    1 MGLLLAKLYEAVQMFQTGTPTRVLMLGLDAAGKTTILYKVKLNENVCTIPTIGFNVETVSPIKGVTFTVWDVGGQEKIRALWRHYYVNTQGLLFIVDSADVSRFPEAKEELFNVIEADEMRGVPVVVVANKQDLPGAASTAEVADRLGLREM-KDRKWFVQGACAVNGDGIYEAMHEMANLVKQFIKS 187          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A1S3I7L6 (ADP-ribosylation factor-like OS=Lingula unguis OX=7574 GN=LOC106161787 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.138e-72
Identity = 110/187 (58.82%), Postives = 140/187 (74.87%), Query Frame = 1
Query:  112 MGAVASKLNKLIG--EIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEF 666
            MG + SKL + +   E+    P ++LMLGLDAAGKTTILY++KL++ + T+PTIGFNVE V   KGLTFT+WDVGGQEK R LWKHY  + Q LIYVVDSSD +RL EAR+ELF I    EM GVPV+VIANKQDLP A +T+Q+ + L+LR L R +KWH+QA CA + +GLYEA+  + R+  +F
Sbjct:    1 MGFLLSKLAEALQGFEMFKDDPAKILMLGLDAAGKTTILYRVKLSDSITTLPTIGFNVETVSPCKGLTFTVWDVGGQEKFRHLWKHYYQNTQGLIYVVDSSDRERLDEAREELFGIMESPEMKGVPVVVIANKQDLPGALSTAQMIESLQLRMLPRENKWHVQAACAPTAQGLYEALDEMARLVKKF 187          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103038497])

HSP 1 Score: 197.978 bits (502), Expect = 5.446e-64
Identity = 97/175 (55.43%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG + + L K  G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFANLFKAFGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2a (ADP-ribosylation factor 1-like [Source:NCBI gene;Acc:103045652])

HSP 1 Score: 195.282 bits (495), Expect = 8.475e-63
Identity = 92/154 (59.74%), Postives = 118/154 (76.62%), Query Frame = 1
Query:  175 RVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 194.897 bits (494), Expect = 9.146e-63
Identity = 96/175 (54.86%), Postives = 125/175 (71.43%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG V + L K    +      R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    +++ ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNVFANLFK---SLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHAL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 194.126 bits (492), Expect = 1.532e-62
Identity = 93/165 (56.36%), Postives = 121/165 (73.33%), Query Frame = 1
Query:  142 LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            L G +      R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    +++ ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 LGGSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHAL-RHRNWYIQATCATSGDGLYEGL 163          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf3a (ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GENE-040801-176])

HSP 1 Score: 194.897 bits (494), Expect = 4.307e-62
Identity = 99/176 (56.25%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG +   L K LIG+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:   48 MGNIFGNLLKSLIGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 217          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 199.134 bits (505), Expect = 4.189e-65
Identity = 97/175 (55.43%), Postives = 127/175 (72.57%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG++ S    L+G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGSLFSVFKDLLGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 194.512 bits (493), Expect = 3.605e-63
Identity = 96/176 (54.55%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKL-NKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG   ++L + L+G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L R   W++QA CA SG+GLYE +
Sbjct:    1 MGGFFTRLFDTLVGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRNAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 184.496 bits (467), Expect = 2.258e-59
Identity = 89/154 (57.79%), Postives = 116/154 (75.32%), Query Frame = 1
Query:  175 RVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA   + G+GLYE +
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATPPV-GDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: ARL4A (ADP ribosylation factor like GTPase 4A [Source:HGNC Symbol;Acc:HGNC:695])

HSP 1 Score: 182.956 bits (463), Expect = 1.685e-58
Identity = 89/185 (48.11%), Postives = 123/185 (66.49%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVG----KGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRM 654
            MGA  S  +  + ++ +     ++MLGLD+AGKTT+LY+LK NE VNT+PTIGFN+E+V+ G    +G++F  WDVGGQE++RPLW+ Y      +++VVDS D++RL EAR EL  +A   E  GVPV+V+ANKQDLP A   +++   L L +L     WHLQ  CAI GEGL E +  +  M
Sbjct:    1 MGASQSGGSSPLAKLATLRSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNMEKVRPGAGGARGVSFQFWDVGGQERLRPLWRSYTRRTDGVVFVVDSVDAERLEEARTELHRVARTPECQGVPVLVVANKQDLPAALAPAEVERLLALAELGPAALWHLQPACAIIGEGLPEGLDKLYEM 185          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011118.1 (pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 gene:ENSPMAG00000010091.1 transcript:ENSPMAT00000011118.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 6.167e-55
Identity = 86/168 (51.19%), Postives = 113/168 (67.26%), Query Frame = 1
Query:  133 LNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            + K + ++  +   R+LMLGLDAAGKTTILYKLKL + V TIPT+GFNVE V   K + F +WDVGGQ+KIRPLW+HY T  Q LI+VVD +D  R+ EAR EL  I    EM    ++V ANKQDL  A    ++ +KL L ++ R   W++Q  CA +G+GLYE +
Sbjct:    2 MGKFLSKMFGNKEMRILMLGLDAAGKTTILYKLKLGQPVTTIPTVGFNVETVTY-KNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRVDEARQELHRIINDREMRDAIILVFANKQDLTDAMRPHEVQEKLGLTRV-RDRNWYVQPACASTGDGLYEGL 167          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 178.718 bits (452), Expect = 3.502e-57
Identity = 87/175 (49.71%), Postives = 120/175 (68.57%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG  ASKL      +  +   R+LM+GLD AGKTT+LYKLKL E + TIPTIGFNVE V+  K ++FT+WDVGGQ++IR LW+HY  + + +I+VVDS+D  R+ EAR+ +  +   +E+     +V ANKQDLP A + ++I +KL L  + R+  W +QA CA SGEGLYE +
Sbjct:    1 MGLFASKL---FSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQY-KNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSI-RNRPWFIQATCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 176.022 bits (445), Expect = 4.085e-56
Identity = 85/175 (48.57%), Postives = 120/175 (68.57%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG  ASKL      +  +   R+LM+GLD AGKTT+LYKLKL E + TIPTIGFNVE V+  K ++FT+WDVGGQ++IR LW+HY  + + +I+V+DS+D  R+ EAR+ +  +   +E+     +V ANKQDLP A + ++I +KL L  + R+  W +Q+ CA SGEGLYE +
Sbjct:    1 MGLYASKL---FSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQY-KNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSI-RNRPWFIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 171.785 bits (434), Expect = 1.485e-54
Identity = 82/175 (46.86%), Postives = 120/175 (68.57%), Query Frame = 1
Query:  121 VASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHV 645
            + + ++K++G++  S   ++LMLGLD AGKTTILYKLKLN+   + PT+GFNVE V   K + F MWDVGGQ+++RPLW+HY     ALI+V+DSS   R+ EA++EL++I G +EM  V ++V ANKQDL  A    +++D LEL K  ++  W +    A+SG+GL E +  +
Sbjct:    1 MGNSISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTY-KNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWI 174          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 148.288 bits (373), Expect = 2.373e-45
Identity = 74/160 (46.25%), Postives = 103/160 (64.38%), Query Frame = 1
Query:  157 GSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            GS+   R+L+LGLD AGKTTILY+L++ E V T PTIGFNVE +   K L   +WD+GGQ  IRP W+ Y  D  A+I+VVDS+D  R++ A  EL  +   EE+    ++V ANKQD P A + S+++ +L L +L +   W + A  AI GEG+ E +
Sbjct:   14 GSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSY-KNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVEL-KDRSWSIVASSAIKGEGITEGL 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARL3 (ARF-like small GTPase of the RAS superfamily; required for recruitment of Arl1p, a GTPase that regulates membrane traffic, to the Golgi apparatus; NatC-catalyzed N-terminal acetylation regulates Golgi membrane association mediated by interaction with membrane receptor, Sys1p; similar to ADP-ribosylation factor and orthologous to mammalian ARFRP1 [Source:SGD;Acc:S000005972])

HSP 1 Score: 102.834 bits (255), Expect = 1.472e-27
Identity = 59/162 (36.42%), Postives = 84/162 (51.85%), Query Frame = 1
Query:  178 VLMLGLDAAGKTTIL------YKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERH---HKWHLQACCAISGEGLYEAM 636
            +L+LGLD AGKTT L      Y L         PT+G NV  + V        WDVGGQE +R +W  Y + C  +I++VDSSD +RL E    L ++   EE+ GVP++++ANKQD         I  K    K+  H       +    A++GEG+ +A+
Sbjct:   20 ILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDI--KEVFNKIAEHISARDSRVLPISALTGEGVKDAI 179          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 192.971 bits (489), Expect = 2.014e-62
Identity = 93/166 (56.02%), Postives = 122/166 (73.49%), Query Frame = 1
Query:  139 KLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            KL   +      R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L R+ +W++QA CA SG+GLYE +
Sbjct:    7 KLFAGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RNRQWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD9])

HSP 1 Score: 190.274 bits (482), Expect = 2.813e-61
Identity = 92/173 (53.18%), Postives = 126/173 (72.83%), Query Frame = 1
Query:  118 AVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
             ++S   +L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LIYVVDS+D +R+ E+++EL  +   +E+    V+V+ANKQDLP+A + S+I +KL L+ + R  +W++QA CA  G GLYE +
Sbjct:    4 TISSLFTRLFGK----KQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSI-RDRQWYIQAACATQGTGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJE1])

HSP 1 Score: 189.504 bits (480), Expect = 9.995e-61
Identity = 96/187 (51.34%), Postives = 131/187 (70.05%), Query Frame = 1
Query:  118 AVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIKSK 678
             ++S   +L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LIYVVDS+D +R+ E+++EL  +   +E+    V+V+ANKQDLP+A + S+I +KL L+ + R  +W++QA CA  G GLYE +     +S E  K K
Sbjct:    4 TISSLFTRLFGK----KQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSI-RDRQWYIQAACATQGTGLYEGLDW---LSNELSKEK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO38139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDV1])

HSP 1 Score: 186.037 bits (471), Expect = 1.405e-59
Identity = 91/185 (49.19%), Postives = 126/185 (68.11%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEF 666
            MG V S++ KL      +   R+LMLGLDAAGKTTILYKLKL E VNT+PT+ FNVE +   K +TF++WD+GGQ+KIR LW+HY    + +I+VVDS+D +R+ E R+EL  +    E+ GVPV+V+ANKQDL  A    ++A++L L K    + W +Q  CA +G+GLYEAM  + +M   +
Sbjct:    1 MGLVLSRILKLFS---GNQKVRILMLGLDAAGKTTILYKLKLKETVNTVPTVAFNVETISPCKNITFSVWDIGGQDKIRRLWRHYFQGAEGIIFVVDSADKERIFEVREELTRVLQHSELNGVPVVVVANKQDLLGAIGPDKMAEELSLYK-HTKNPWRIQGTCATAGDGLYEAMEALAKMVKAY 181          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO36373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW3])

HSP 1 Score: 181.8 bits (460), Expect = 5.005e-58
Identity = 89/174 (51.15%), Postives = 126/174 (72.41%), Query Frame = 1
Query:  115 GAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
             +V S   +L+G+       R+LM+GLDAAGKTTILY LKL+E VNTIPTIGFNVE V+  K + FT+WD+GGQ+KIR LW+ Y  + Q LI+VVDS+D  R+ EA++ELF +   EE+    ++V+ANKQDLP + +T+++++KL L  L R   W++QA CA+ G+G+YE +
Sbjct:    3 NSVLSLFRRLLGK----DELRLLMVGLDAAGKTTILYHLKLDEPVNTIPTIGFNVEVVEY-KNIKFTVWDIGGQDKIRLLWRLYFQETQGLIFVVDSNDRDRIQEAKEELFKLLKEEELKRAALLVLANKQDLPDSMSTTELSEKLSLHTL-RSRNWYIQATCALKGQGVYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000030860.1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101167961])

HSP 1 Score: 196.052 bits (497), Expect = 4.197e-63
Identity = 97/175 (55.43%), Postives = 125/175 (71.43%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG  AS    L G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EA++EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNFASLFRGLFGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEF-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAKEELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLCLHSL-RHRNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000042909.1 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 196.052 bits (497), Expect = 4.478e-63
Identity = 99/176 (56.25%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG +   L K LIG+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFGNLLKSLIGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: arf3b (ADP-ribosylation factor 3 [Source:NCBI gene;Acc:101174416])

HSP 1 Score: 196.052 bits (497), Expect = 4.478e-63
Identity = 99/176 (56.25%), Postives = 127/176 (72.16%), Query Frame = 1
Query:  112 MGAVASKLNK-LIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            MG +   L K LIG+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:    1 MGNIFGNLLKSLIGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000022012.2 (ADP ribosylation factor 1 [Source:NCBI gene;Acc:101175109])

HSP 1 Score: 195.667 bits (496), Expect = 6.465e-63
Identity = 99/192 (51.56%), Postives = 133/192 (69.27%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHV-GRMSTEFIKSKGK 684
            MG V + L K+ G+       R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R  EAR+EL  +   +E+    ++V ANKQDLP+A   +++ DKL L  L R+  W++QA CA +G+GLYE +  +  ++ T  I  K K
Sbjct:    1 MGNVFAGLFKMFGK----KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERCGEAREELLRMLAEDELRDAVLLVFANKQDLPNAMNAAELTDKLNLHSL-RNRNWYIQATCATTGDGLYEGLDWLSNQLKTNLIPQKKK 186          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000009599.2 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 194.512 bits (493), Expect = 2.650e-61
Identity = 92/154 (59.74%), Postives = 118/154 (76.62%), Query Frame = 1
Query:  175 RVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAM 636
            R+LM+GLDAAGKTTILYKLKL E V TIPTIGFNVE V+  K ++FT+WDVGGQ+KIRPLW+HY  + Q LI+VVDS+D +R+ EAR+EL  +   +E+    ++V ANKQDLP+A   ++I DKL L  L RH  W++QA CA SG+GLYE +
Sbjct:  113 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RHRNWYIQATCATSGDGLYEGL 264          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052763.1 (SMESG000052763.1)

HSP 1 Score: 394.815 bits (1013), Expect = 1.383e-141
Identity = 189/191 (98.95%), Postives = 191/191 (100.00%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIKSKGK 684
            MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVI+IANKQDLPHARTTSQIADKLELRKLER+HKWHLQACCAISGEGLYEAMGHVGRMSTEFIKSKGK
Sbjct:    1 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIIIANKQDLPHARTTSQIADKLELRKLERNHKWHLQACCAISGEGLYEAMGHVGRMSTEFIKSKGK 191          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052739.1 (SMESG000052739.1)

HSP 1 Score: 274.248 bits (700), Expect = 5.653e-94
Identity = 126/187 (67.38%), Postives = 155/187 (82.89%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIK 672
            MG + S+L KL+ E+  S P+R+LMLGLDAAGKTTILYKLKLNE V TIPTIGFNVEEV +GKGL FT+WDVGGQEKIR LWKHY T+C  LIYVVDS+D++RL E+RDELF IA  +EM  VP++VIANKQDLP+A + S+I + LEL KL+  HKWH+QACCA+SG+GLYEA+   G++S E++K
Sbjct:    1 MGILLSRLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKLSAEYLK 187          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052741.1 (SMESG000052741.1)

HSP 1 Score: 273.092 bits (697), Expect = 1.669e-93
Identity = 125/187 (66.84%), Postives = 155/187 (82.89%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIK 672
            MG + S+L KL+ E+  S P+R+LMLGLDAAGKTTILYKLKLNE V TIPTIGFNVEEV +GKGL FT+WDVGGQEKIR LWKHY T+C  LIYVVDS+D++RL E+RDELF IA  +EM  VP++VIANKQDLP+A + S+I + LEL KL+  HKWH+QACCA+SG+GLY+A+   G++S E++K
Sbjct:    1 MGILLSRLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYKALESAGKLSAEYLK 187          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052759.1 (SMESG000052759.1)

HSP 1 Score: 271.937 bits (694), Expect = 5.040e-93
Identity = 124/188 (65.96%), Postives = 155/188 (82.45%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIKS 675
            MG + S+L KL+ E+  S P+R+LMLGLDAAGKTTILYKLKLNE V TIPTIGFNVEEV +GKGL FT+WDVGGQEKIR LWKHY T+C  LIYVVDS+D++RL E+RDELF IA  +EM  VP++VIANKQDLP+A +  +I + LEL KL+  HKW++QACCA+SG+GLYEA+   G++S E++K+
Sbjct:    1 MGILLSRLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKN 188          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052764.1 (SMESG000052764.1)

HSP 1 Score: 271.166 bits (692), Expect = 1.236e-92
Identity = 124/187 (66.31%), Postives = 154/187 (82.35%), Query Frame = 1
Query:  112 MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIPTIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSDSQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELRKLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIK 672
            MG + S+L KL+ E+  S P+R+LMLGLDAAGKTTILYKLKLNE V TIPTIGFNVEEV +GKGL FT+WDVGGQEKIR LWKHY T+C  LIYVVDS+D++RL E+RDELF IA  +EM  VP++VIANKQDLP+A +  +I + LEL KL+  HKW++QACCA+SG+GLYEA+   G++S E++K
Sbjct:    1 MGILLSRLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLK 187          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARF15.289e-6356.00ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF15.289e-6356.00ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF15.289e-6356.00ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF38.357e-6356.25ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF38.357e-6356.25ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf-33.543e-6253.76ADP-Ribosylation Factor related; ADP-ribosylation ... [more]
arf-1.28.742e-6255.11ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.28.742e-6255.11ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.28.742e-6255.11ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-65.246e-5552.38ADP-Ribosylation Factor related [Source:UniProtKB... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf79F2.549e-6255.43gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F2.549e-6255.43gene:FBgn0010348 transcript:FBtr0078573[more]
Arf79F2.549e-6255.43gene:FBgn0010348 transcript:FBtr0299906[more]
Arf79F2.549e-6255.43gene:FBgn0010348 transcript:FBtr0299907[more]
Arf79F2.549e-6255.43gene:FBgn0010348 transcript:FBtr0078571[more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf12.545e-6455.43ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf2b4.565e-6356.57ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GE... [more]
arf2b4.565e-6356.57ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GE... [more]
arf2b4.565e-6356.57ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GE... [more]
arf2b4.565e-6356.57ADP-ribosylation factor 2b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf53.204e-6356.57ADP ribosylation factor 5 [Source:NCBI gene;Acc:39... [more]
dcaf73.925e-6351.58DDB1 and CUL4 associated factor 7 [Source:Xenbase;... [more]
arf37.576e-6356.25ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
fibp1.109e-6256.00fibroblast growth factor (acidic) intracellular bi... [more]
arf41.007e-5853.18ADP ribosylation factor 4 [Source:NCBI gene;Acc:59... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf13.631e-6356.00ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf13.631e-6356.00ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf35.738e-6356.25ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:M... [more]
Arf26.653e-6254.86ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:M... [more]
Arf26.653e-6254.86ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O48649|ARF1_SALBA1.055e-6357.14ADP-ribosylation factor 1 OS=Salix bakko OX=72444 ... [more]
sp|Q06396|ARF1_ORYSJ1.017e-6255.95ADP-ribosylation factor 1 OS=Oryza sativa subsp. j... [more]
sp|P51823|ARF2_ORYSJ1.051e-6255.95ADP-ribosylation factor 2 OS=Oryza sativa subsp. j... [more]
sp|O48920|ARF_VIGUN1.716e-6255.95ADP-ribosylation factor OS=Vigna unguiculata OX=39... [more]
sp|P36397|ARF1_ARATH2.229e-6255.95ADP-ribosylation factor 1 OS=Arabidopsis thaliana ... [more]
back to top
BLAST of ADP-ribosylation factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I8S22.398e-7660.32ADP-ribosylation factor OS=Lingula unguis OX=7574 ... [more]
K1RG923.219e-7558.82ADP-ribosylation factor 1 OS=Crassostrea gigas OX=... [more]
A0A210QTV15.454e-7357.61ADP-ribosylation factor 3 OS=Mizuhopecten yessoens... [more]
A0A2C9JMI33.603e-7256.38Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3I7L69.138e-7258.82ADP-ribosylation factor-like OS=Lingula unguis OX=... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf15.446e-6455.43ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2a8.475e-6359.74ADP-ribosylation factor 1-like [Source:NCBI gene;A... [more]
arf2b9.146e-6354.86ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2b1.532e-6256.36ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf3a4.307e-6256.25ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf14.189e-6555.43ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf2a3.605e-6354.55ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2a2.258e-5957.79ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
ARL4A1.685e-5848.11ADP ribosylation factor like GTPase 4A [Source:HGN... [more]
ENSPMAT00000011118.16.167e-5551.19pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF13.502e-5749.71ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF24.085e-5648.57ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF31.485e-5446.86Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARL12.373e-4546.25Soluble GTPase with a role in regulation of membra... [more]
ARL31.472e-2736.42ARF-like small GTPase of the RAS superfamily; requ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421562.014e-6256.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483592.813e-6153.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483609.995e-6151.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381391.405e-5949.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363735.005e-5851.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000030860.14.197e-6355.43ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000042909.14.478e-6356.25ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf3b4.478e-6356.25ADP-ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000022012.26.465e-6351.56ADP ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000009599.22.650e-6159.74ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052763.11.383e-14198.95SMESG000052763.1[more]
SMESG000052739.15.653e-9467.38SMESG000052739.1[more]
SMESG000052741.11.669e-9366.84SMESG000052741.1[more]
SMESG000052759.15.040e-9365.96SMESG000052759.1[more]
SMESG000052764.11.236e-9266.31SMESG000052764.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014923 ID=SMED30014923|Name=ADP-ribosylation factor|organism=Schmidtea mediterranea sexual|type=transcript|length=736bp
TGTTTGAATGCGACTGTTGTTGCTTCCACAAATCAAATATATTTGCAATT
ACAATAGCTACATAAATTTAATTGCATCAGAAACATTTTCAGTTGATAAT
TATTCAATTTCATGGGAGCTGTGGCTTCAAAATTAAACAAACTAATCGGC
GAAATTGGATCATCTCACCCTCGACGGGTGCTGATGTTAGGCCTGGATGC
AGCTGGTAAAACTACAATTCTTTACAAATTAAAACTCAACGAGTGCGTCA
ACACGATTCCAACGATCGGATTTAACGTTGAAGAAGTCAAAGTTGGAAAA
GGTTTAACGTTCACTATGTGGGATGTTGGAGGACAAGAAAAAATCCGGCC
ACTTTGGAAACATTACATGACAGATTGTCAAGCTTTGATTTACGTTGTTG
ACAGTAGCGATTCACAGAGATTAACCGAAGCGAGAGACGAATTGTTTACA
ATTGCCGGATTAGAGGAAATGATGGGAGTCCCGGTTATTGTTATTGCCAA
TAAACAAGATCTTCCTCATGCTAGGACCACTTCTCAAATCGCCGATAAAT
TAGAACTTAGGAAATTAGAACGTCATCACAAATGGCATTTGCAAGCGTGC
TGTGCAATATCTGGGGAAGGATTGTACGAAGCAATGGGACATGTTGGTCG
AATGTCGACAGAATTCATAAAGTCAAAAGGGAAATGAGCTGATTCTATGA
GTTATTGTAATATAAAAATATCTTTGAAATTTTGTG
back to top

protein sequence of SMED30014923-orf-1

>SMED30014923-orf-1 ID=SMED30014923-orf-1|Name=SMED30014923-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=192bp
MGAVASKLNKLIGEIGSSHPRRVLMLGLDAAGKTTILYKLKLNECVNTIP
TIGFNVEEVKVGKGLTFTMWDVGGQEKIRPLWKHYMTDCQALIYVVDSSD
SQRLTEARDELFTIAGLEEMMGVPVIVIANKQDLPHARTTSQIADKLELR
KLERHHKWHLQACCAISGEGLYEAMGHVGRMSTEFIKSKGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006689Small GTPase superfamily, ARF/SAR typePRINTSPR00328SAR1GTPBPcoord: 123..144
score: 36.36
coord: 22..45
score: 53.68
coord: 78..103
score: 35.52
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 18..177
e-value: 2.9E-63
score: 212.5
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..189
e-value: 4.1E-66
score: 235.6
NoneNo IPR availableSMARTSM00178sar_sub_1coord: 5..182
e-value: 1.3E-15
score: 67.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 21..180
e-value: 1.4E-60
score: 205.6
NoneNo IPR availablePANTHERPTHR11711:SF363coord: 1..188
NoneNo IPR availablePANTHERPTHR11711ADP RIBOSYLATION FACTOR-RELATEDcoord: 1..188
NoneNo IPR availablePROSITEPS51417ARFcoord: 14..186
score: 21.132
NoneNo IPR availableCDDcd00878Arf_Arlcoord: 22..174
e-value: 1.48886E-84
score: 244.793
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 20..148
e-value: 2.0E-24
score: 84.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 19..181