KIF3A-like protein

Overview
NameKIF3A-like protein (ACZ64526.1)
Smed IDSMED30014919
Length (bp)2208
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of KIF3A-like protein (SMED30014919) t-SNE clustered cells

Violin plots show distribution of expression levels for KIF3A-like protein (SMED30014919) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of KIF3A-like protein (SMED30014919) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for KIF3A-like protein (SMED30014919) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014919

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014919h1SMcG0001884 dd_Smed_v4_4343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014919h1SMcG0001884 dd_Smed_v4_4343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014919h1SMcG0001884 dd_Smed_v4_4343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014919h1SMcG0001884 dd_Smed_v4_4343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014919h1SMcG0001884 dd_Smed_v4_4343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30014919h1SMcG0001884 Contig36153uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014919h1SMcG0001884 Contig36153newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014919h1SMcG0001884 Contig37506newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014919h1SMcG0001884 Contig37506uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30014919h1SMcG0001884 dd_Smed_v6_4343_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014919h1SMcG0001884 dd_Smed_v4_4343_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of KIF3A-like protein vs. Ensembl Human
Match: KIF3A (kinesin family member 3A [Source:HGNC Symbol;Acc:HGNC:6319])

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 395/626 (63.10%), Postives = 493/626 (78.75%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKX-XXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R +PELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++   I         E + E        E+R K+  +   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L ++E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRDQAGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 634          
BLAST of KIF3A-like protein vs. Ensembl Human
Match: KIF3A (kinesin family member 3A [Source:HGNC Symbol;Acc:HGNC:6319])

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 397/625 (63.52%), Postives = 496/625 (79.36%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R +PELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + +   +    E   K+ K+   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L ++E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVG--EDGEKRKKRRGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 631          
BLAST of KIF3A-like protein vs. Ensembl Human
Match: KIF3A (kinesin family member 3A [Source:HGNC Symbol;Acc:HGNC:6319])

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 397/650 (61.08%), Postives = 496/650 (76.31%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKK-------------------------PKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R +PELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + +   +      + KK                         P +   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L ++E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGSSSSSSSDSTCSVIEKPLDKFLPNQAGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 658          
BLAST of KIF3A-like protein vs. Ensembl Human
Match: KIF3A (kinesin family member 3A [Source:HGNC Symbol;Acc:HGNC:6319])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 272/356 (76.40%), Postives = 308/356 (86.52%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQ 1158
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R +PELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+Q
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQ 364          
BLAST of KIF3A-like protein vs. Ensembl Human
Match: KIF3B (kinesin family member 3B [Source:HGNC Symbol;Acc:HGNC:6320])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 301/622 (48.39%), Postives = 425/622 (68.33%), Query Frame = 1
Query:   97 SDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQ---QMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGN 1953
            S++V+VV+RCRP+N KE          V+   G +++ NPK +  + PK FTFD V+  N+KQ ++Y++  RP+VDSVL G+NGTIFAYGQTGTGKT+TMEG R  PE RG+IPNSF H+F  I++++ N  +LVR SYLEIY EE+RDLL KDQT RLE+KERPD GVYVKDL+SFV     E++ +M  GN+NR  GATNMNEHSSRSHAI+ +T+E SE   DGE   R GKL+LVDLAGSERQ KTGA G RL+EA KINLSL+ LGNVISALVDGKSTH+PYR+SKLTRLLQDSLGGN+KT+M+AN+GPA YN +E++++LRYANRAKNI+NK  +NEDPKDALLR++Q+E+ RL+ QL+   I       +              E   ++ ++   +K    R  E +  +E  +R + +   + +EEK R+   L EKE K+   R+E+   +ML  ++  ++ K++VGG+N+++   EQ+++LE+  +E+   K+ E  ++++++ ++EE + ++  Y+SLQ+E   K KK+KKL +  Q  KAE+ DL++E  +E + L +    L R+L    L+I+  IP E +  I   A ++E+   W+L  +    N
Sbjct:    7 SESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQ-NQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEEGDDKDDYWR--EQQEKLEIEKRAIVEDHSLVAEEKMRL---LKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKNIVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKSKIMNRAFFDEEEDHWKLHPITRLEN 622          
BLAST of KIF3A-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 340/668 (50.90%), Postives = 462/668 (69.16%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKD--MESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQLFQNRSKTT 2088
            E ++ VKVV+RCRP++  E  QG  IA   N+   ++ I +   S +DPP+ F FD VF PN+ Q+ VYN  ARPIV++VL GYNGTIFAYGQTGTGKTFTM G  +  E+RGIIPNSFAH+F  IAK + +  FLVRVSYLEIYNEE+RDLL KD    LE+KERPD+GVYV++L++  V  A +M  LM +G+KNR  GAT MN  SSRSHA++TVT+   E+  +G  T  QGKL LVDLAGSERQ KTGA G RL+EA KINLSL+TLGNVIS+LVDGKSTH+PYRNSKLTRLLQDSLGGNSKT+MIAN+GPA YN+DE++S+LRYANRAKNI+N A INEDPKDA LR++Q E+E L + L +    D                                E+  + ++ E E  +E+ R+ LE++ +  +  EE +R+ ++++E E +L KAR E + LR+++  +++K+IVGGENLLEK EEQ +LLE + KELE+ K  E  +R +L+E+   ++ IE +Y+SLQEEA  K KK+KK++N  +  +AEL DL+++ QR++E +L++IR L ++L  ++ +ID  IP E  +LI +   W+E+ G+WQLK +AYTGNNMR      + E    +N+  +P+ Y +Y  D      ++R +T+
Sbjct:    2 EGAEKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKS--LSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTI---ESCRNGLVT--QGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDEENPGDDE----------------------------NQEEAWEAKMQEREVEMEKKRKILEERVNSAVNDEETHRLVKEMMENEAELKKARSEHEKLRSKLEKIEKKLIVGGENLLEKVEEQAKLLEVNNKELEQSKFQEAHLRTQLEERTAVKVEIEERYSSLQEEAFVKSKKIKKVSNELKDARAELKDLEEDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKE--FSNNNQTVPM-YYSYRADLGASTAEHRPRTS 631          
BLAST of KIF3A-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 340/668 (50.90%), Postives = 462/668 (69.16%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKD--MESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQLFQNRSKTT 2088
            E ++ VKVV+RCRP++  E  QG  IA   N+   ++ I +   S +DPP+ F FD VF PN+ Q+ VYN  ARPIV++VL GYNGTIFAYGQTGTGKTFTM G  +  E+RGIIPNSFAH+F  IAK + +  FLVRVSYLEIYNEE+RDLL KD    LE+KERPD+GVYV++L++  V  A +M  LM +G+KNR  GAT MN  SSRSHA++TVT+   E+  +G  T  QGKL LVDLAGSERQ KTGA G RL+EA KINLSL+TLGNVIS+LVDGKSTH+PYRNSKLTRLLQDSLGGNSKT+MIAN+GPA YN+DE++S+LRYANRAKNI+N A INEDPKDA LR++Q E+E L + L +    D                                E+  + ++ E E  +E+ R+ LE++ +  +  EE +R+ ++++E E +L KAR E + LR+++  +++K+IVGGENLLEK EEQ +LLE + KELE+ K  E  +R +L+E+   ++ IE +Y+SLQEEA  K KK+KK++N  +  +AEL DL+++ QR++E +L++IR L ++L  ++ +ID  IP E  +LI +   W+E+ G+WQLK +AYTGNNMR      + E    +N+  +P+ Y +Y  D      ++R +T+
Sbjct:    2 EGAEKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKS--LSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTI---ESCRNGLVT--QGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDEENPGDDE----------------------------NQEEAWEAKMQEREVEMEKKRKILEERVNSAVNDEETHRLVKEMMENEAELKKARSEHEKLRSKLEKIEKKLIVGGENLLEKVEEQAKLLEVNNKELEQSKFQEAHLRTQLEERTAVKVEIEERYSSLQEEAFVKSKKIKKVSNELKDARAELKDLEEDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKE--FSNNNQTVPM-YYSYRADLGASTAEHRPRTS 631          
BLAST of KIF3A-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 340/668 (50.90%), Postives = 462/668 (69.16%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKD--MESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQLFQNRSKTT 2088
            E ++ VKVV+RCRP++  E  QG  IA   N+   ++ I +   S +DPP+ F FD VF PN+ Q+ VYN  ARPIV++VL GYNGTIFAYGQTGTGKTFTM G  +  E+RGIIPNSFAH+F  IAK + +  FLVRVSYLEIYNEE+RDLL KD    LE+KERPD+GVYV++L++  V  A +M  LM +G+KNR  GAT MN  SSRSHA++TVT+   E+  +G  T  QGKL LVDLAGSERQ KTGA G RL+EA KINLSL+TLGNVIS+LVDGKSTH+PYRNSKLTRLLQDSLGGNSKT+MIAN+GPA YN+DE++S+LRYANRAKNI+N A INEDPKDA LR++Q E+E L + L +    D                                E+  + ++ E E  +E+ R+ LE++ +  +  EE +R+ ++++E E +L KAR E + LR+++  +++K+IVGGENLLEK EEQ +LLE + KELE+ K  E  +R +L+E+   ++ IE +Y+SLQEEA  K KK+KK++N  +  +AEL DL+++ QR++E +L++IR L ++L  ++ +ID  IP E  +LI +   W+E+ G+WQLK +AYTGNNMR      + E    +N+  +P+ Y +Y  D      ++R +T+
Sbjct:    2 EGAEKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKS--LSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTI---ESCRNGLVT--QGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDEENPGDDE----------------------------NQEEAWEAKMQEREVEMEKKRKILEERVNSAVNDEETHRLVKEMMENEAELKKARSEHEKLRSKLEKIEKKLIVGGENLLEKVEEQAKLLEVNNKELEQSKFQEAHLRTQLEERTAVKVEIEERYSSLQEEAFVKSKKIKKVSNELKDARAELKDLEEDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKE--FSNNNQTVPM-YYSYRADLGASTAEHRPRTS 631          
BLAST of KIF3A-like protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 505.753 bits (1301), Expect = 4.742e-169
Identity = 282/623 (45.26%), Postives = 393/623 (63.08%), Query Frame = 1
Query:  100 DNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERS-IEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGE---NLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNN 1956
            + VKV++RCRPL+ +E+         +    G I + NPK   D+P K FTFD ++  NS Q D+Y +  R +VDSVL+GYN TIFAYGQTGTGKT TMEGK   PE RG+I     H+F  +A A  N  +LVR SYLEIY EE+RDLL  +   +LE+KERPD GVYVKDL S +     E+ ++M  GN +R  G TNMNEHSSRSHAI+ +TVE S    DGE     G+L+LVDLAGSERQ KTGATG R +EA KINLSL+ LGNVISALVD KS H+PYR+SKLTRLLQDSLGGNSKT+M+A IGPA YNF+E++ +LRYANRAKNI+N+  INEDPKDALLR++Q+E+E L +QLK                                 +K RS   + Q   + ER+ +E++   +++   +   EK+R+ +++ EK + L K R EQ  +  R+ ++Q ++IVG E    L  + +EQ   LEK  +EL   K+ E  M + L+ +EE+ ++++  ++ L+ E   K KK+KK+    +  + E+ D+      E + L + I  ++++L   +L+++  IP++  + I+E A+WNED+ EW +     T +N
Sbjct:   12 ETVKVIVRCRPLSSQEIANNYSKIVHMRPQRGQIELKNPKEQ-DEPSKDFTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMA-ASHNQEYLVRASYLEIYQEELRDLLEAESNKKLEIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVECSRIGEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKINEDPKDALLREFQEEIEMLREQLKQ--------------------------------RKTRSRDGATQSFYDAERAKLEDDIEAIQKDDSLIKHEKDRLIREIQEKHDLLEKERIEQARVAERIANIQSRLIVGSEEDGRLESRTKEQHAQLEKKRRELAEQKRREREMVEALERQEEDTVDLKQTFSDLRTEVEAKTKKLKKMLIKLRQARNEIRDVSGAYSDERQDLDQTIAEVSKELKLKLLIVENFIPRDVSERIKERAEWNEDSFEWNVNAFQSTSSN 600          
BLAST of KIF3A-like protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 418.313 bits (1074), Expect = 3.564e-136
Identity = 208/366 (56.83%), Postives = 265/366 (72.40%), Query Frame = 1
Query:   97 SDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEG-SETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLK 1191
            +++V+V +RCRP N++E      +   +    G + +  P    D   K FTFD  +  +S    +YN +  P+V++V+ GYNGT+FAYGQTG+GKTF+M+G   +P  RG+IP +F H+F A A  E NV FLV  SYLEIYNEEVRDLLG D   +LE+KE+PD GVYV  L+  V H      +LMT G  NR  GAT MN+ SSRSH+I+TV VEG +ET      + R GKL+LVDLAGSERQ KTGATG RL+EA KINLSL+ LGNVISALVDGKS H+PYR+SKLTRLLQDSLGGN+KT+MIA + P+  N+DE++S+LRYANRAKNI+NK  INEDPKDALLR+YQ+E+ RL+  ++
Sbjct:    2 AESVRVAVRCRPFNQREKDLNTTLCVGMTPNVGQVNLNAP----DGAAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTE-NVKFLVHCSYLEIYNEEVRDLLGADNKQKLEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEGMTET-----GSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQEEIARLKSMVQ 357          
BLAST of KIF3A-like protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 345/664 (51.96%), Postives = 466/664 (70.18%), Query Frame = 1
Query:  100 DNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQLFQNRSKTTR 2091
            +NV+VV+R RP+++ EL  G + A  V+++N +IT+  P A+ ++PPK + FD VF   S Q+D+Y   ARPIVD VL GYNGTI AYGQTGTGKT+TM G  D P+ +GIIPN+FAH+FG IAKA+ N  FLVRVSY+EIYNEEVRDLLGKD    LEVKERPDIGV+VKDL+ +VVH AD+++ +M  GNKNR  GAT MN+ SSRSHAI+++TVE SE      +  R GKL LVDLAGSERQ KT A+G RL+EA KINLSL+ LGNVISALVDGKSTH+PYRNSKLTRLLQDSLGGNSKT+M A I PAD N+ E++S+LRYA+RAKNI+N+  INE+PKDALLR +Q+E+ RL +QL++G   +    S  E E     +          P +I  E  + Q       ++E+  +K  ++ D E EE  + +    E + ++  A+ EQ+ LRN++  L+ KI+VGGENLLEKA+ QE LLE+S  ELE+H+++E ++++ LQ+K  ER++IE +Y++LQ+ +    KK+ ++  +    K+EL D +QE QRE EG+ ENIRSL+R+L    L++++ +PKE+Q +I +   WNED GEWQLKCVAYTGNNMR+     +      D  ++L   Y +Y+ DG     +++S   R
Sbjct:   19 ENVRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGKDVGKSLEVKERPDIGVFVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVERSELGEGDVQHVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNIQNRMHINEEPKDALLRHFQEEIARLRKQLEEGDSLEEEPPSSEEEEDTADDELEA-------PLEIELESSTIQ-------AVEKKPKKKREKTDAEKEELAKRKN---EHQKEIEHAKTEQETLRNKLVSLEGKILVGGENLLEKAQTQELLLEQSIAELEQHEKSEEALKQTLQQKATERIDIEERYSTLQDASTGITKKIHRVMQMLMGVKSELADQQQEHQREKEGIYENIRSLSRELALCELVLNSYVPKEYQSMINQYTHWNEDIGEWQLKCVAYTGNNMRKHISAHKTSGKEPDF-LDLSHVYLSYNTDGVSNPMRSKSARPR 664          
BLAST of KIF3A-like protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0332129)

HSP 1 Score: 415.231 bits (1066), Expect = 5.501e-134
Identity = 247/612 (40.36%), Postives = 383/612 (62.58%), Query Frame = 1
Query:  106 VKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVA 1941
            V+VV+RCRP++ +E  +       V    G + + N      +  K FT+D  +  ++ Q  +Y++V  P+V SVL G+NG IFAYGQTGTGKTFTMEG R   EL GIIP +F  ++  I + E N  FLV VSYLEIY EE+RDLL K  +  LEV+ER   GVYV +L +      ++M K+M  GNKNR  G TNMNEHSSRSHAI+ + +E  +T  +   T + GKL+L+DLAGSERQ KTGA+  RL+EA+KINL+L++LGNVISAL +  S HVPYR+SKLTRLLQDSLGGNSKT+MIANIGP++YN++E++++LRYA+RAK+I+N+ I NEDP+DA L++YQ+E+ERL++ +     +    +  ++ +      +  V + +    ++ +          IE+ +E++       +  ESE     + ++ +   +L + R E   L  ++ +L+ +++ GG+NLL+   E++  LEK   E+   K+ E+ ++++L+ +EE  + I  +  SL++E   KK+K+ K    Y   + EL+D K +  +++  L      L ++L   +L+ID  +P E ++ +   A+++E+  EW+   ++
Sbjct:   20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHINRTE-NFQFLVDVSYLEIYMEELRDLL-KPNSKHLEVRERGS-GVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETN---TIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAES-SPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKEYQEEIERLKRLIGPQQQQRSEKQVTAKKQRVKKPKKETVTKEMSDSLQVST----------IEQPVEDD----SDPEGAESESDKENEAEVAKSNEELERERVENSKLAAKLAELEGQLVRGGKNLLDTYSERQIELEKKLVEIAERKKREIEIQQQLELQEETTLEIRERNVSLEQEVELKKRKLSKCYAKYLALQQELNDCKSDHNQDLRELEMAQNELVKELKRQLLIIDNFVPIEVKQRLYTQAKYDEEQEEWKFSSMS 610          
BLAST of KIF3A-like protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0076030)

HSP 1 Score: 415.231 bits (1066), Expect = 5.501e-134
Identity = 247/612 (40.36%), Postives = 383/612 (62.58%), Query Frame = 1
Query:  106 VKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVA 1941
            V+VV+RCRP++ +E  +       V    G + + N      +  K FT+D  +  ++ Q  +Y++V  P+V SVL G+NG IFAYGQTGTGKTFTMEG R   EL GIIP +F  ++  I + E N  FLV VSYLEIY EE+RDLL K  +  LEV+ER   GVYV +L +      ++M K+M  GNKNR  G TNMNEHSSRSHAI+ + +E  +T  +   T + GKL+L+DLAGSERQ KTGA+  RL+EA+KINL+L++LGNVISAL +  S HVPYR+SKLTRLLQDSLGGNSKT+MIANIGP++YN++E++++LRYA+RAK+I+N+ I NEDP+DA L++YQ+E+ERL++ +     +    +  ++ +      +  V + +    ++ +          IE+ +E++       +  ESE     + ++ +   +L + R E   L  ++ +L+ +++ GG+NLL+   E++  LEK   E+   K+ E+ ++++L+ +EE  + I  +  SL++E   KK+K+ K    Y   + EL+D K +  +++  L      L ++L   +L+ID  +P E ++ +   A+++E+  EW+   ++
Sbjct:   20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHINRTE-NFQFLVDVSYLEIYMEELRDLL-KPNSKHLEVRERGS-GVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETN---TIKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAES-SPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKEYQEEIERLKRLIGPQQQQRSEKQVTAKKQRVKKPKKETVTKEMSDSLQVST----------IEQPVEDD----SDPEGAESESDKENEAEVAKSNEELERERVENSKLAAKLAELEGQLVRGGKNLLDTYSERQIELEKKLVEIAERKKREIEIQQQLELQEETTLEIRERNVSLEQEVELKKRKLSKCYAKYLALQQELNDCKSDHNQDLRELEMAQNELVKELKRQLLIIDNFVPIEVKQRLYTQAKYDEEQEEWKFSSMS 610          
BLAST of KIF3A-like protein vs. Ensembl Fly
Match: Kif3C (gene:FBgn0039925 transcript:FBtr0089196)

HSP 1 Score: 400.979 bits (1029), Expect = 4.157e-130
Identity = 251/627 (40.03%), Postives = 378/627 (60.29%), Query Frame = 1
Query:   97 SDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARL---EVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHD-GEKTF---RQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKEN-KLAKARQEQQM-LRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFH--VLLIDTCIPKEFQK-----LIRENAQWNEDTGEWQL 1929
            S+N+KVV+RCRP+N+ E ++ C    ++NE   ++++TNP A +    K+F FD V+   +    +Y+++   +V+S + GYNGTIFAYGQTG GKT TM+G  +     GIIP  F H+F  I+   TNV +L  V+YLEIYNE +RDLL K++   +    +KE P IGV V  L +  V  A++    + +GNKNRVT AT MN++SSRSH I+T+T+E S  L+  G   F    +GKL LVDLAGSERQ KTGA G RL+EA++INLSL+ LGNVIS+LVDGK+ HVP+R+SKLTRLLQDSLGGN+KTLMI+ I P D ++DE++S+LRYA+RAKNI NK  INEDPKDA LRQYQ E+  L++ L+                 +I+   N   + +K P KI         +     +  +N + ++  ++ ++  K      ++ K N  L ++++E Q+  R+R+ DL ++ ++GGE + +   +++ +  K A   +RH         ++  K E+R  ++  Y ++ +E   K   ++K     +  + E+ DL  E Q + E  L+ IR+L R + FH  + L  +  P +F +      I +N+ WN+D   W++
Sbjct:    2 SENIKVVVRCRPMNQTEKERNCQNIVEINEF--AVSVTNPSARISQQ-KKFIFDSVYNMKTDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERISMT-TNVRYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQYQNEILYLKRMLQ--------------ESQQIINKNNDPNKIIKSPLKI---------IQHTNMNSTKNVQIIDLGRNCKASFK--TNNSILTKPNFPLIQSKEEVQLQARSRI-DLIKRSLIGGERIHDFELKEKHMARKYAA--QRHLSAIAIALSRV--KCEDRDLLQGHYATITQEIDIKNDYIRKCKEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRQVKFHQQLFLKFSSNPGKFDRNWTPDTILQNSLWNDDLKMWRI 594          
BLAST of KIF3A-like protein vs. Ensembl Fly
Match: Klp61F (gene:FBgn0004378 transcript:FBtr0072733)

HSP 1 Score: 301.212 bits (770), Expect = 1.183e-88
Identity = 167/380 (43.95%), Postives = 240/380 (63.16%), Query Frame = 1
Query:   88 KEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELR---------GIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDI--GVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTG-ATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINED-PKDALLRQYQKELERLEQQL 1188
            K+ + N++V +R RPLN +E    C+ +A+V ++ G   +           K+FTFD  FGP SKQ DVY+ V  P+++ VL+GYN T+FAYGQTGTGKT TM G  +  EL+         GIIP + +H+F  +   E  V + +R+SYLE+YNEE+ DLL  D T ++ + +       V ++ L    VH  D++ KL+  G + R T  T MN  SSRSH ++++ V   E   +GE   + GKL+LVDLAGSE   K G   GIR++E   IN SL TLG VI+ALVD ++ HVPYR SKLTRLLQ+SLGG +KT +IA I P   + +E++S+L YA+RAKNI+NK  +N+   K  +L++Y +E+++L++ L
Sbjct:   14 KKSNQNIQVYVRVRPLNSRE---RCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGN-ETAELKSSWEDDSDIGIIPRALSHLFDELRMME--VEYTMRISYLELYNEELCDLLSTDDTTKIRIFDDSTKKGSVIIQGLEEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENGIEGEDMLKIGKLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVD-RAPHVPYRESKLTRLLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTKKTVLKEYTEEIDKLKRDL 386          
BLAST of KIF3A-like protein vs. Ensembl Zebrafish
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 397/625 (63.52%), Postives = 494/625 (79.04%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E SDNVKVV+RCRPLNEKE   G   +  V+E+ G+IT+     S  +PPK FTFD VFGP+SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S S+   E  + +       ++ K+   +K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++++IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   14 EVSDNVKVVVRCRPLNEKEKIMGHKQSVTVDEIRGTITVNKLDIS-SEPPKTFTFDTVFGPDSKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDGSGSDDMDEDDVGDG----GERRRKRRGRKKVSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKRVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 633          
BLAST of KIF3A-like protein vs. Ensembl Zebrafish
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 397/625 (63.52%), Postives = 494/625 (79.04%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E SDNVKVV+RCRPLNEKE   G   +  V+E+ G+IT+     S  +PPK FTFD VFGP+SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S S+   E  + +       ++ K+   +K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++++IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   14 EVSDNVKVVVRCRPLNEKEKIMGHKQSVTVDEIRGTITVNKLDIS-SEPPKTFTFDTVFGPDSKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDGSGSDDMDEDDVGDG----GERRRKRRGRKKVSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKRVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 633          
BLAST of KIF3A-like protein vs. Ensembl Zebrafish
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 397/625 (63.52%), Postives = 494/625 (79.04%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E SDNVKVV+RCRPLNEKE   G   +  V+E+ G+IT+     S  +PPK FTFD VFGP+SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S S+   E  + +       ++ K+   +K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++++IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   13 EVSDNVKVVVRCRPLNEKEKIMGHKQSVTVDEIRGTITVNKLDIS-SEPPKTFTFDTVFGPDSKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDGSGSDDMDEDDVGDG----GERRRKRRGRKKVSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKRVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 632          
BLAST of KIF3A-like protein vs. Ensembl Zebrafish
Match: kif3b (kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE-050119-3])

HSP 1 Score: 530.02 bits (1364), Expect = 8.937e-179
Identity = 292/620 (47.10%), Postives = 412/620 (66.45%), Query Frame = 1
Query:  121 RCRPLNEKELKQGCVIAAQVNELNGSITITNPK-ASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQK-------DMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNN 1956
            RCRP+NEKE          V+   G + + NP+ AS  + PK FTFD V+  NSKQ+++Y++  RP+VDSVL G+NGTIFAYGQTGTGKT+TMEG R+ PE RG+IPNSF H+F  I++++ N  +LVR SYLEIY EE+RDLL KDQ  RLE+KERPD GVYVKDL+SFV     E++ +M  GN+NR  GATNMNEHSSRSHAI+ +T+E SE   DGE   R GKL+LVDLAGSERQ KTGA G RL+EA KINLSL+ LGNVISALVDG+STH+PYR+SKLTRLLQDSLGGN++T+M+ANIGPA YN +E++++LRYANRAKNI+NK  +NEDPKDALLR++Q+E+ RL++QL+                      E+G +           E+        I     E + KLE+++        + +EEK R+ ++   K   L K ++  +ML  ++  ++ K++VGG+N+++   EQ+++LE   +E+   K+ E  M+++++ ++EE + ++  Y+SLQ+E   K KK+KKL +  Q+ K+E+ D + E  +  + L +    L R+L    L+I+  IP E +  I   A ++E+   W++  +    N+
Sbjct:   15 RCRPMNEKERVANFNRVVSVDVKLGQVAVCNPRGASSHEHPKVFTFDSVYDWNSKQMELYDETFRPLVDSVLFGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHISRSQ-NQQYLVRASYLEIYQEEIRDLLSKDQARRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGPDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKEQLEKRSGRKRRRRRRRRVGEGGEEFEDGEDEEDDD-DDDEDEEEGVDADKNIADYWHEQQEKLEKERRAIMEDHSLVAEEKQRLLKEKERKMTDLHKEKEASEMLTAKVKAMESKLLVGGKNIVDHTNEQQKVLELKRQEIAEQKRREREMKQEMECRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQSVKSEIQDAQDEHVKYRQELEQTQNELTRELKLKHLIIENFIPMEEKNKIVTRATFDEEDDLWKMTPITRIQNS 632          
BLAST of KIF3A-like protein vs. Ensembl Zebrafish
Match: kif3b (kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE-050119-3])

HSP 1 Score: 530.02 bits (1364), Expect = 2.541e-178
Identity = 292/620 (47.10%), Postives = 412/620 (66.45%), Query Frame = 1
Query:  121 RCRPLNEKELKQGCVIAAQVNELNGSITITNPK-ASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQK-------DMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNN 1956
            RCRP+NEKE          V+   G + + NP+ AS  + PK FTFD V+  NSKQ+++Y++  RP+VDSVL G+NGTIFAYGQTGTGKT+TMEG R+ PE RG+IPNSF H+F  I++++ N  +LVR SYLEIY EE+RDLL KDQ  RLE+KERPD GVYVKDL+SFV     E++ +M  GN+NR  GATNMNEHSSRSHAI+ +T+E SE   DGE   R GKL+LVDLAGSERQ KTGA G RL+EA KINLSL+ LGNVISALVDG+STH+PYR+SKLTRLLQDSLGGN++T+M+ANIGPA YN +E++++LRYANRAKNI+NK  +NEDPKDALLR++Q+E+ RL++QL+                      E+G +           E+        I     E + KLE+++        + +EEK R+ ++   K   L K ++  +ML  ++  ++ K++VGG+N+++   EQ+++LE   +E+   K+ E  M+++++ ++EE + ++  Y+SLQ+E   K KK+KKL +  Q+ K+E+ D + E  +  + L +    L R+L    L+I+  IP E +  I   A ++E+   W++  +    N+
Sbjct:   15 RCRPMNEKERVANFNRVVSVDVKLGQVAVCNPRGASSHEHPKVFTFDSVYDWNSKQMELYDETFRPLVDSVLFGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHISRSQ-NQQYLVRASYLEIYQEEIRDLLSKDQARRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGPDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKEQLEKRSGRKRRRRRRRRVGEGGEEFEDGEDEEDDD-DDDEDEEEGVDADKNIADYWHEQQEKLEKERRAIMEDHSLVAEEKQRLLKEKERKMTDLHKEKEASEMLTAKVKAMESKLLVGGKNIVDHTNEQQKVLELKRQEIAEQKRREREMKQEMECRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQSVKSEIQDAQDEHVKYRQELEQTQNELTRELKLKHLIIENFIPMEEKNKIVTRATFDEEDDLWKMTPITRIQNS 632          
BLAST of KIF3A-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 398/632 (62.97%), Postives = 497/632 (78.64%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRS-------EKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E      +A  V+E+ G+IT+ +   S+++PPK FTFD VFGP+S Q+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ+ RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S +S +E + +   +      + KK + I S       +K S  ++AE++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE   L  +++ L++K+IVGG +LL KAEEQERLLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   + +ID+ IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   11 ESCDNVKVVVRCRPLNERERAMNSKMAVGVDEMRGTITV-HKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLEEGEDVSGSDDSGTEDDDDEDGEIGEDGEKKKKRRGINSYLYLTGKKKGSPDKMAEMQARIDEERKALEAKLDMEEEERNKARAELERREKDLFKAQQEHHSLLEKLSALEKKVIVGGVDLLAKAEEQERLLEESNFELEERRKRAEKLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMNIIDSFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 641          
BLAST of KIF3A-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 398/632 (62.97%), Postives = 497/632 (78.64%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRS-------EKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E      +A  V+E+ G+IT+ +   S+++PPK FTFD VFGP+S Q+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ+ RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S +S +E + +   +      + KK + I S       +K S  ++AE++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE   L  +++ L++K+IVGG +LL KAEEQERLLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   + +ID+ IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   15 ESCDNVKVVVRCRPLNERERAMNSKMAVGVDEMRGTITV-HKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLEEGEDVSGSDDSGTEDDDDEDGEIGEDGEKKKKRRGINSYLYLTGKKKGSPDKMAEMQARIDEERKALEAKLDMEEEERNKARAELERREKDLFKAQQEHHSLLEKLSALEKKVIVGGVDLLAKAEEQERLLEESNFELEERRKRAEKLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMNIIDSFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 645          
BLAST of KIF3A-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 398/625 (63.68%), Postives = 496/625 (79.36%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E      +A  V+E+ G+IT+ +   S+++PPK FTFD VFGP+S Q+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ+ RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S +S +E + +   +    E   KK K+   +K S  ++AE++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE   L  +++ L++K+IVGG +LL KAEEQERLLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   + +ID+ IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   12 ESCDNVKVVVRCRPLNERERAMNSKMAVGVDEMRGTITV-HKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLEEGEDVSGSDDSGTEDDDDEDGEIG--EDGEKKKKRRGKKKGSPDKMAEMQARIDEERKALEAKLDMEEEERNKARAELERREKDLFKAQQEHHSLLEKLSALEKKVIVGGVDLLAKAEEQERLLEESNFELEERRKRAEKLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMNIIDSFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 633          
BLAST of KIF3A-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 398/625 (63.68%), Postives = 496/625 (79.36%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E      +A  V+E+ G+IT+ +   S+++PPK FTFD VFGP+S Q+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ+ RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S +S +E + +   +    E   KK K+   +K S  ++AE++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE   L  +++ L++K+IVGG +LL KAEEQERLLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   + +ID+ IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   15 ESCDNVKVVVRCRPLNERERAMNSKMAVGVDEMRGTITV-HKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLEEGEDVSGSDDSGTEDDDDEDGEIG--EDGEKKKKRRGKKKGSPDKMAEMQARIDEERKALEAKLDMEEEERNKARAELERREKDLFKAQQEHHSLLEKLSALEKKVIVGGVDLLAKAEEQERLLEESNFELEERRKRAEKLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMNIIDSFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 636          
BLAST of KIF3A-like protein vs. Ensembl Xenopus
Match: cbll1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-6458353])

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 400/649 (61.63%), Postives = 498/649 (76.73%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNG----------------------VERRVKK--PKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E      +A  V+E+ G+IT+ +   S+++PPK FTFD VFGP+S Q+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAHVFG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ+ RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S +S +E + +   +                         +ER V K  P K   +K S  ++AE++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE   L  +++ L++K+IVGG +LL KAEEQERLLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   + +ID+ IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNERERAMNSKMAVGVDEMRGTITV-HKVDSMNEPPKTFTFDTVFGPDSNQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQSQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGADGNIHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLEEGEDVSGSDDSGTEDDDDEDGEIGEDGEKKKKRRGSSSSSSTSDSTVIERPVDKYLPSK---KKGSPDKMAEMQARIDEERKALEAKLDMEEEERNKARAELERREKDLFKAQQEHHSLLEKLSALEKKVIVGGVDLLAKAEEQERLLEESNFELEERRKRAEKLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMNIIDSFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 654          
BLAST of KIF3A-like protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 397/625 (63.52%), Postives = 494/625 (79.04%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VP LRG+IPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + E        E++ K+  +   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEVSGSDISGSEEDDEEGELGEDGEKKKKRRDQAGKKKVSPDKMVEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPQDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 633          
BLAST of KIF3A-like protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 398/625 (63.68%), Postives = 491/625 (78.56%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VP LRG+IPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + E        E+     KK R ++  K  + E++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEVSGSDISGSEEDDEEGELGEDGEK-----KKKRRDQADK--MVEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPQDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 626          
BLAST of KIF3A-like protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 398/649 (61.33%), Postives = 495/649 (76.27%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKK------------------------PKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VP LRG+IPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + E        E++ K+                        P +   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEVSGSDISGSEEDDEEGELGEDGEKKKKRRGSSSSSSSDSTCSVIEKPLDEFLPHQAGKKKVSPDKMVEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPQDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 657          
BLAST of KIF3A-like protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 398/625 (63.68%), Postives = 492/625 (78.72%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VP LRG+IPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + E            KK K+   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEVSGSDISGSEEDDEEGELGE---DGEKKKKRRGKKKVSPDKMVEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPQDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 630          
BLAST of KIF3A-like protein vs. Ensembl Mouse
Match: Kif3b (kinesin family member 3B [Source:MGI Symbol;Acc:MGI:107688])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 299/622 (48.07%), Postives = 424/622 (68.17%), Query Frame = 1
Query:   97 SDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQ---QMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGN 1953
            S++V+VV+RCRP+N KE          V+   G +++ NPK +  + PK FTFD V+  N+KQ ++Y++  RP+VDSVL G+NGTIFAYGQTGTGKT+TMEG R  PE RG+IPNSF H+F  I++++ N  +LVR SYLEIY EE+RDLL KDQT RLE+KERPD GVYVKDL+SFV     E++ +M  GN+NR  GATNMNEHSSRSHAI+ +T+E SE   DGE   R GKL+LVDLAGSERQ KTGA G RL+EA KINLSL+ LGNVISALVDGKSTH+PYR+SKLTRLLQDSLGGN+KT+M+AN+GPA YN +E++++LRYANRAKNI+NK  +NEDPKDALLR++Q+E+ RL+ QL+   I       +              E   ++ ++   +K    R  E +  +E  +R + +   + +EEK R+   L EKE K+   R+E+   +ML  ++  ++ K++VGG+N+++   EQ+++LE+  +E+   K+ E  ++++++ ++EE + ++  Y SLQ+E   K KK+KKL +  Q  KAE+ DL++E  +E + L +    L R+L    L+I+  IP E +  I   + ++++   W+L  +    N
Sbjct:    7 SESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTSHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGVRGDPEKRGVIPNSFDHIFTHISRSQ-NQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEDGDDKDDYWR--EQQEKLEIEKRAIVEDHSLVAEEKMRL---LKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKNIVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYTSLQQEVDIKTKKLKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKNKIMNRSFFDDEEDHWKLHPITRLEN 622          
BLAST of KIF3A-like protein vs. UniProt/SwissProt
Match: sp|Q4R628|KIF3A_MACFA (Kinesin-like protein KIF3A OS=Macaca fascicularis OX=9541 GN=KIF3A PE=2 SV=1)

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 396/626 (63.26%), Postives = 493/626 (78.75%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKX-XXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++   I         E + E        E+R K+  +   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L ++E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRDQAGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 634          
BLAST of KIF3A-like protein vs. UniProt/SwissProt
Match: sp|Q5R4H3|KIF3A_PONAB (Kinesin-like protein KIF3A OS=Pongo abelii OX=9601 GN=KIF3A PE=2 SV=1)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 394/626 (62.94%), Postives = 492/626 (78.59%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKX-XXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R +PELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++   I         E + E        E+R K+  +   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L ++E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE Q E+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEIGEDGEKRKKRRDQAGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQGEIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 634          
BLAST of KIF3A-like protein vs. UniProt/SwissProt
Match: sp|Q9Y496|KIF3A_HUMAN (Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4)

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 397/625 (63.52%), Postives = 496/625 (79.36%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R +PELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + +   +    E   K+ K+   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L ++E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +R++L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVG--EDGEKRKKRRGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 631          
BLAST of KIF3A-like protein vs. UniProt/SwissProt
Match: sp|P28741|KIF3A_MOUSE (Kinesin-like protein KIF3A OS=Mus musculus OX=10090 GN=Kif3a PE=1 SV=2)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 397/625 (63.52%), Postives = 494/625 (79.04%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E  DNVKVV+RCRPLNE+E       A  V+E+ G+IT+    +S ++PPK FTFD VFGP SKQ+DVYN  ARPI+DSVL GYNGTIFAYGQTGTGKTFTMEG R VP LRG+IPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQT RLEVKERPD+GVY+KDL+++VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G     S  S SE + E        E++ K+  +   +K+S  ++ E++  I+E R+ LE + DME EE+N+ + +L  +E  L KA+QE Q L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE QRE+EGLLENIR L+R+L   +L+ID  IP+++Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   10 ESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSS-NEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEVSGSDISGSEEDDEEGELGEDGEKKKKRRDQAGKKKVSPDKMVEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPQDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 633          
BLAST of KIF3A-like protein vs. UniProt/SwissProt
Match: sp|P46872|KRP85_STRPU (Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 384/651 (58.99%), Postives = 503/651 (77.27%), Query Frame = 1
Query:  100 DNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDG 2052
            DNV+VV+RCRPLN KE  QG     +++E+ G++ +TNP A   +PPK FTFD VF P +KQ DVYN+ ARPIVD+++ GYNGTIFAYGQTGTGKTFTMEG R  PELRGIIPNSFAH+FG IAK + NV FLVRVSYLEIYNEEV+DLLGKDQ  RLEVKERPD+GVYVKDL++FVV+ AD+MD++MT GNKNR  GATNMNE SSRSHAI+T+T+E S+   D E+  R GKLH+VDLAGSERQ KTGATG RL+EA KINLSL+TLGNVIS+LVDGKSTH+PYRNSKLTRLLQDSLGGN+KT+M ANIGPA+YN+DE++S+LRYANRAKNI+NKA INEDPKDALLR++QKE+E L++Q+ + G      E     ES           + K+  K    K+S + +A +++ I+E ++ LE++KDM  E++N V ++L  +E++L KA+ +Q++L  ++N +Q+K+IVGG +LL K+EEQE+LLE+SA E++     + SMRK ++E+E+ERM+IE +Y+SLQ+EA  K KK+KK+  +    K+E+ D++ E QREME LLEN+R L+R+L   +L+ID+ IP+EFQ++I +   WNED GEWQLKCVAYTGNNMR+       +  +   + +L   + TY+L+G
Sbjct:    9 DNVRVVVRCRPLNSKETGQGFKSVVKMDEMRGTVQVTNPNAPSGEPPKSFTFDTVFAPGAKQTDVYNQTARPIVDAIIEGYNGTIFAYGQTGTGKTFTMEGVRSQPELRGIIPNSFAHIFGHIAKEQENVRFLVRVSYLEIYNEEVKDLLGKDQQHRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGNKNRSVGATNMNESSSRSHAIFTITLERSDMGLDKEQHVRVGKLHMVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNAKTVMCANIGPAEYNYDETISTLRYANRAKNIKNKAKINEDPKDALLREFQKEIEELKKQISESGEGLDDDEESGSEESGDEEAGE-GGVKKKRKGKNPKRKLSPEIMAAMQKKIDEEKKALEEKKDMVEEDRNTVHRELQRRESELHKAQDDQKILNEKLNAIQKKLIVGGVDLLAKSEEQEQLLEQSALEMKERMAKQESMRKMMEEREQERMDIEEKYSSLQDEAHGKTKKLKKVWTMLMQAKSEVADMQAEHQREMEALLENVRELSRELRLSMLIIDSFIPQEFQEMIEQYVHWNEDIGEWQLKCVAYTGNNMRKQTPVADKDKSLAYGEADLSNVFLTYNLEG 658          
BLAST of KIF3A-like protein vs. TrEMBL
Match: A0A219MDK0 (Kinesin-like protein OS=Schmidtea mediterranea OX=79327 GN=kif3a PE=2 SV=1)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 643/657 (97.87%), Postives = 645/657 (98.17%), Query Frame = 1
Query:   82 MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPY-RTYSLD 2049
            MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADKKKKVKKLNNIYQTTKAELDDLKQEQQREMEG LENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENV QD       P  RT S++
Sbjct:    1 MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADKKKKVKKLNNIYQTTKAELDDLKQEQQREMEGPLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVKQDTTWNCRFPIERTVSME 657          

HSP 2 Score: 67.781 bits (164), Expect = 7.661e-8
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query: 2006 TTWNCRFPIERTVSMESSNYSRTGVKRLEI 2095
            TTWNCRFPIERTVSMESSNYSRTGVKRLEI
Sbjct:  642 TTWNCRFPIERTVSMESSNYSRTGVKRLEI 671          
BLAST of KIF3A-like protein vs. TrEMBL
Match: D2ILT5 (Kinesin-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 486/486 (100.00%), Postives = 486/486 (100.00%), Query Frame = 1
Query:  238 PKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAAD 1695
            PKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAAD
Sbjct:    1 PKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAAD 486          
BLAST of KIF3A-like protein vs. TrEMBL
Match: A0A4S2L6T5 (Kinesin-like protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009476 PE=3 SV=1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 424/628 (67.52%), Postives = 509/628 (81.05%), Query Frame = 1
Query:   82 MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            M  +DSDNVKV +RCRPLN+KEL  GC     ++EL GS+ ++    S D+P KQFTFD+VF   SKQ D+YNKVARPIV+ VL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FGAIAKA+ N  FLVRVSYLEIYNEEVRDLLG+DQTA L+VKERPDIGV+VKDL+SFVVH  +EMDKLM++GN+NRVT ATNMNEHSSRSHAIYTVT+E S+ +  G+   RQGKLHLVDLAGSERQ KTGATG RLQEANKINLSL TLGNVISALVDGKSTH+PYRNSKLTRLLQDSLGGNSKT MIANI P+DYN++ES+S+LRYANRAKNIRNKA INEDPKDA+LRQ+QKE+E L +QL++G       +S  +S +++   +    R  KK +     KISKQ++AEI+R IE ++R+LE+QKD+  EE+N++Q  L  KE +L KA++ Q  L  RM  LQ +IIVGGENLLEKAE QE+LLE+SA ELER ++    + +KL+EKEEER+NIE +YNSLQEEAA K++K++KL+ +Y   KAELDD++ E  REMEGLL+NIR L R+L  H +LID  IPK +Q+LI +N QWNED GEWQL+CVAYTGNNMR+
Sbjct:    1 MHPDDSDNVKVAVRCRPLNQKELAAGCKSVTMIDELTGSVVLSKMTQSSDEPQKQFTFDFVFDIQSKQADLYNKVARPIVEKVLEGYNGTIFAYGQTGTGKTFTMEGIRSVPELRGIIPNSFAHIFGAIAKADHNTRFLVRVSYLEIYNEEVRDLLGRDQTANLDVKERPDIGVFVKDLSSFVVHSPNEMDKLMSFGNRNRVTAATNMNEHSSRSHAIYTVTLECSQLMEGGKTLLRQGKLHLVDLAGSERQSKTGATGKRLQEANKINLSLTTLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTAMIANIAPSDYNYEESLSTLRYANRAKNIRNKAKINEDPKDAMLRQFQKEIEMLRKQLEEGMGPSAGVDSGDDSGADVDDHQRTAARGTKKERP----KISKQKMAEIQRMIEADKRQLEEQKDLAVEERNKIQTHLEHKEAELRKAKEAQSNLMRRMEALQSRIIVGGENLLEKAEAQEKLLEQSAVELERQQRRAEQLHQKLKEKEEERINIEEKYNSLQEEAAGKRRKLRKLSTMYLQAKAELDDVRSEHVREMEGLLDNIRQLGRELALHTMLIDHFIPKPYQELIEQNVQWNEDIGEWQLRCVAYTGNNMRK 624          
BLAST of KIF3A-like protein vs. TrEMBL
Match: A0A4E0RLP8 (Kinesin-like protein OS=Fasciola hepatica OX=6192 GN=D915_007155 PE=3 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 433/654 (66.21%), Postives = 522/654 (79.82%), Query Frame = 1
Query:   94 DSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGV-----ERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTY 2040
            +SDNV+V +RCRPLN+KE+  GC     +NEL G++T+     + ++P KQFTFD VF   SKQ DVYNKVARPIV+ VL GYNGTIFAYGQTGTGKT+TMEG R VPELRGIIPNSFAH+FGAIAKA+ N  FLVRVSYLEIYNEEVRDLLGKDQ+ RL+VKERPDIGVYVKDL+SFVVH  +EMDKLM+YGN+NRVTGATNMNEHSSRSHAIYTVT+E SE +   +   RQGKLHLVDLAGSERQ KTGATG RLQEANKINLSL TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+MIANI P+DYN++ES+S+LRYANRAKNI+N A INEDPKDA+LRQ+QKELE+L +QL++G           E       D N V     ER++K+PK+ ++ KISKQ++AEI+R IE +R+KLE+QKDM  EE+N++Q  L  KE +L KA++    L+ RM  LQ +IIVGGENLLEKAE QERLLE+SA ELE+ +Q    + +KL+EKEEER+NIE +YN+LQEEAA K++K++KL+ +Y   KAEL+D++ E  REMEGLLENIR L R++ F+ LLID  IPK +Q LI +N QWNED GEWQL+CVAYTGNNMR++   D+D     ++ ++L   Y TY
Sbjct:    2 ESDNVRVAVRCRPLNQKEISLGCKSVTIINELEGNVTLQKVNLNNEEPYKQFTFDLVFDTQSKQFDVYNKVARPIVEKVLEGYNGTIFAYGQTGTGKTYTMEGVRSVPELRGIIPNSFAHIFGAIAKADKNTRFLVRVSYLEIYNEEVRDLLGKDQSVRLDVKERPDIGVYVKDLSSFVVHSPNEMDKLMSYGNRNRVTGATNMNEHSSRSHAIYTVTLECSENVEHEKPLLRQGKLHLVDLAGSERQAKTGATGKRLQEANKINLSLTTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTVMIANIAPSDYNYEESLSTLRYANRAKNIKNNAKINEDPKDAMLRQFQKELEQLRKQLEEGTEPSEGLAGGDEESDGEFSDTNDVAEGDKERKMKRPKRGKA-KISKQKMAEIQRMIEADRKKLEEQKDMALEERNKIQAHLENKETELRKAQEAHANLKKRMEALQSRIIVGGENLLEKAEVQERLLEQSALELEKQQQRAEQLHQKLKEKEEERINIEEKYNTLQEEAAGKRRKLRKLSTMYLQAKAELEDVRGEHVREMEGLLENIRQLGREMSFYTLLIDHFIPKPYQSLIEQNVQWNEDIGEWQLRCVAYTGNNMRKL---DRDR---PESPLDLSQVYLTY 648          
BLAST of KIF3A-like protein vs. TrEMBL
Match: A0A3Q0KLZ5 (Kinesin-like protein OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 425/630 (67.46%), Postives = 504/630 (80.00%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLK-----XXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E++DNVKV +RCRP+++KE+   C     V+EL+G +T+    +S DDPPKQFTFD VFG  SKQ D+YN VARPIVD VL GYNGTIFAYGQTGTGKTFTMEG R  PELRGIIPNSFAH+FGAIAKA+ N  FLVRVSYLEIYNEEVRDLLGKDQ ARL+VKERPDIGVYVK+L+SFVVH  +EMDKLM++GNKNRVTGATNMNEHSSRSHAIYT+T+E SE     +   RQGKLHLVDLAGSERQ KTGATG RLQEANKINLSL TLGNVISALVDGKSTH+PYRNSKLTRLLQDSLGGNSKT MIANI PADYNFDES+S+LRYANRAKNI+NKA INEDPKDA+LRQ+QKE+E+L +QL+               S+ ++     ID+N  E R+KK K   + K+SKQ++AEI+R IE +RRKLE++KDM  EE+NR+Q+ L  KEN+L +    +  L  RM  LQ +IIVGGENLLEKAE QE+LLEKSA EL++ +     + +KL+EKEEER+NIE +YN+LQEEAA K+KK++KL+ IY   K+EL+D+K E  REMEGL++NI  L R+L  + L+ID  IP+ +Q LI EN QWNED GEWQLKCVAYTGNNMR+
Sbjct:    5 EETDNVKVAVRCRPMDKKEIAMNCKSVISVSELDGCVTLKRT-SSCDDPPKQFTFDIVFGCGSKQTDIYNMVARPIVDKVLEGYNGTIFAYGQTGTGKTFTMEGIRSEPELRGIIPNSFAHIFGAIAKADANTRFLVRVSYLEIYNEEVRDLLGKDQFARLDVKERPDIGVYVKNLSSFVVHSPNEMDKLMSFGNKNRVTGATNMNEHSSRSHAIYTITIECSEHSEKNKTLLRQGKLHLVDLAGSERQAKTGATGKRLQEANKINLSLTTLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTAMIANISPADYNFDESLSTLRYANRAKNIKNKAKINEDPKDAMLRQFQKEIEQLRKQLEEGGIPSNPTNAEEQGSDDDNYENGTIDQNDQENRLKKSKG-NTVKLSKQKMAEIQRMIEADRRKLEEEKDMAIEERNRIQKHLETKENELRQVEVTRYNLTKRMEALQSRIIVGGENLLEKAEIQEKLLEKSAIELQKQQLRAEQLHQKLKEKEEERINIEEKYNNLQEEAAGKRKKLRKLSTIYLQAKSELEDMKNEHVREMEGLVDNIHQLERELTRYTLIIDRFIPQPYQALIEENVQWNEDIGEWQLKCVAYTGNNMRK 632          
BLAST of KIF3A-like protein vs. Ensembl Cavefish
Match: kif3a (kinesin family member 3A [Source:NCBI gene;Acc:103027986])

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 401/625 (64.16%), Postives = 494/625 (79.04%), Query Frame = 1
Query:   94 DSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVER-RVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            DSDNVKVV+RCRPLN+KE   G   +  V+E+ G+IT+ N   +  +PPK FTFD VF P+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G I    G    E +        G ER R ++ KK    K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:    4 DSDNVKVVVRCRPLNQKEKMMGHKQSVTVDEMRGTITV-NKTETPHEPPKTFTFDTVFSPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKRKLEEGEISGSEGSGSEEMDEGEDEAGIGGERPRNRRGKK----KMSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 623          
BLAST of KIF3A-like protein vs. Ensembl Cavefish
Match: kif3a (kinesin family member 3A [Source:NCBI gene;Acc:103027986])

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 401/626 (64.06%), Postives = 494/626 (78.91%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVER-RVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E SDNVKVV+RCRPLN+KE   G   +  V+E+ G+IT+ N   +  +PPK FTFD VF P+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G I    G    E +        G ER R ++ KK    K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   13 EVSDNVKVVVRCRPLNQKEKMMGHKQSVTVDEMRGTITV-NKTETPHEPPKTFTFDTVFSPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKRKLEEGEISGSEGSGSEEMDEGEDEAGIGGERPRNRRGKK----KMSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 633          
BLAST of KIF3A-like protein vs. Ensembl Cavefish
Match: kif3a (kinesin family member 3A [Source:NCBI gene;Acc:103027986])

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 401/630 (63.65%), Postives = 496/630 (78.73%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVER-RVKKPKKIRSE----KISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E SDNVKVV+RCRPLN+KE   G   +  V+E+ G+IT+ N   +  +PPK FTFD VF P+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G I    G    E +        G ER R ++  KI+ +    K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   13 EVSDNVKVVVRCRPLNQKEKMMGHKQSVTVDEMRGTITV-NKTETPHEPPKTFTFDTVFSPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKRKLEEGEISGSEGSGSEEMDEGEDEAGIGGERPRNRRDPKIQDQRGKKKMSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 641          
BLAST of KIF3A-like protein vs. Ensembl Cavefish
Match: kif3a (kinesin family member 3A [Source:NCBI gene;Acc:103027986])

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 400/646 (61.92%), Postives = 494/646 (76.47%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVER---------------------RVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E SDNVKVV+RCRPLN+KE   G   +  V+E+ G+IT+ N   +  +PPK FTFD VF P+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G I    G    E +        G ER                     R +   + R +K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   13 EVSDNVKVVVRCRPLNQKEKMMGHKQSVTVDEMRGTITV-NKTETPHEPPKTFTFDTVFSPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKRKLEEGEISGSEGSGSEEMDEGEDEAGIGGERPRNRRDSGSSSNSGSVCSVAQRSEGETQTRKKKMSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 657          
BLAST of KIF3A-like protein vs. Ensembl Cavefish
Match: kif3a (kinesin family member 3A [Source:NCBI gene;Acc:103027986])

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 400/654 (61.16%), Postives = 494/654 (75.54%), Query Frame = 1
Query:   91 EDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVER-------------------------RVKKPKKIRSE----KISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            E SDNVKVV+RCRPLN+KE   G   +  V+E+ G+IT+ N   +  +PPK FTFD VF P+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPD+GVY+KDL+ +VV+ AD+MD++MT G+KNR  GATNMNEHSSRSHAI+T+T+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L++G I    G    E +        G ER                           +   KI+ +    K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE  +L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   +L+ID  IP+E+Q++I     WNED GEWQLKCVAYTGNNMR+
Sbjct:   13 EVSDNVKVVVRCRPLNQKEKMMGHKQSVTVDEMRGTITV-NKTETPHEPPKTFTFDTVFSPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKRKLEEGEISGSEGSGSEEMDEGEDEAGIGGERPRNRRDSGSSSNSGSVCSVAQRSEGETQTNPKIQDQRGKKKMSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHHLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK 665          
BLAST of KIF3A-like protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 392/654 (59.94%), Postives = 483/654 (73.85%), Query Frame = 1
Query:   85 DKEDS--DNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL-KXXXXXXXXXXXXXXXXXXXXXXXNGVERRVK-----------------------KPKKI-RSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRR 1965
            +K DS  DNVKVV+RCRP+N KE   G  +A  V+E+ G I +  P  + D+PPK FTFD VFG  SKQVDVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEV+DLLGKDQT RLEVKERPD+GVYVKDL++FVV+ AD+MD++MT G+KNR  G+TNMNEHSSRSHAI+T+T+E SE   DG    R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L+++L +   +         + E E     +G E+R K                       KP    R +KI  ++LAE++  IEE R+ LE Q DME EE+++ + +L  +EN L KA+QE Q L+ ++  L++K+IVGG +LL KAEEQERLLE+S  ELE  ++    +R++L+EKE+ER++IE +YNSLQEEAA K KK+K++  +    K+E  DL ++  + +  LL  +  + R L    L+    + + + ++I    QWNED GEWQLKCVAYTGNNMR+
Sbjct:    7 EKSDSGGDNVKVVVRCRPINGKETGAGHRMAVLVDEMRGQIAVQRPDCN-DEPPKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLLGKDQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLAEGEEVSGSEFSGSDDDEKEGTEGGDGNEKRRKRRGSTSSSSSDSSTCSVKEKPMDKPYSCGRKKKIPVEKLAEMQAKIEEERKVLEAQLDMEEEERDKARAELERRENDLLKAQQEHQALQEKLAALEKKVIVGGVDLLAKAEEQERLLEESNMELEERRKRAEKLRRELEEKEQERLDIEEKYNSLQEEAAGKTKKLKRVWTMLMAAKSEDPDLGRDHLKNVR-LLHQLYLMPRFLENMQLISSNSLARHYWEMIENYVQWNEDIGEWQLKCVAYTGNNMRK 658          
BLAST of KIF3A-like protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 520.776 bits (1340), Expect = 4.550e-178
Identity = 271/562 (48.22%), Postives = 386/562 (68.68%), Query Frame = 1
Query:   97 SDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQRE 1782
            ++ V+VV+RCRP+N +E          ++   G + I NP+A+ D P + FTFD V+G ++KQ+D+Y +  RP+VDSVL G+NGTIFAYGQTGTGKT+TMEG R  PE RG+IPNSF H+F  I++++   +  VR SYLEIY EE+RDLL +DQ+ RLE++ERPD G++VKDL+SFV   A E++ +M  GN+NR  GATNMNEHSSRSHAI+ +TVE SE   DGE   R GKL+LVDLAGSERQ KTGA G RL+EA KINLSL+ LGNVISALVDGKSTHVPYR+SKLTRLLQDSLGGN++T+M+AN+GPA YN+DES+++LRYANRAKNIRN+  +NEDPKDALLR++Q+E+ RL++QL+  G     G               G     +  +     +       E+   +E  R+ +   + + + E+ R+ +D   K + L   +  +  L  ++  ++ K++VGG+N++++  EQ+++LE+  +E+    + E  +++K++ ++EE + +   + +LQ+E   K KK+KKL    Q  K+E+ DL+ E  +E
Sbjct:   17 AETVRVVVRCRPMNPRESAASYESVITIDVRAGQVAIRNPRANAD-PARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGADGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRPRVNEDPKDALLREFQEEIARLKEQLEKRGDVGGGGGGVGVGGGGGKKKRRGGR--KRPGEGPDDGEEEDDDDDEVAEQLERERQSILDDQSLLAGERERLIRDTELKMDDLKHQQDARDSLATKIKAMESKLLVGGKNIVDRTNEQQKVLEQRRQEIAEQSRREREIQQKMEARDEETLELRETFTTLQQEVEMKTKKLKKLFAKLQAIKSEITDLQDEHSKE 575          
BLAST of KIF3A-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010617.1 (pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 gene:ENSPMAG00000009612.1 transcript:ENSPMAT00000010617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 379.022 bits (972), Expect = 5.083e-119
Identity = 182/288 (63.19%), Postives = 226/288 (78.47%), Query Frame = 1
Query:  328 VLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLK 1191
            V+ GYNGT+FAYGQTG GK+FTM+G  +    RG+IP +F H+F +I  AE N  FL R SYLEIYNEE+RDLLGKD   RLE+KE P+ GVYV+DL+   VH   E +++M  G  NR TGAT MN+ SSRSH+I+++ +E   T   GE   R GKL+LVDLAGSERQ KTGA G RL+EA KINLSL+ LGNVISALVDG+S HVPYR+SKLTRLLQDSLGGN+KTLM+A I PAD N++ES+S+LRYANRAK+IRN+  +NEDPKDA+LR+Y++E+ RL+  L+
Sbjct:    3 VVEGYNGTVFAYGQTGCGKSFTMQGVSEPSAQRGVIPRAFEHIFESIQCAE-NTKFLFRASYLEIYNEEIRDLLGKDTKQRLELKEHPERGVYVRDLSMHTVHSVAECERIMQAGWSNRATGATLMNKDSSRSHSIFSIHLEMCTTDDQGEDHIRAGKLNLVDLAGSERQSKTGAQGDRLKEATKINLSLSALGNVISALVDGRSKHVPYRDSKLTRLLQDSLGGNTKTLMVACISPADNNYEESLSTLRYANRAKSIRNRPRVNEDPKDAMLREYREEITRLKALLQ 289          
BLAST of KIF3A-like protein vs. Ensembl Sea Lamprey
Match: kif11 (kinesin family member 11 [Source:ZFIN;Acc:ZDB-GENE-020426-1])

HSP 1 Score: 308.531 bits (789), Expect = 1.461e-92
Identity = 168/376 (44.68%), Postives = 239/376 (63.56%), Query Frame = 1
Query:  103 NVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITI-TNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPE--------LRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGK--DQTARLEVKERPDI--GVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINED-PKDALLRQYQKELERLEQQL 1188
            +++V +RCRPLN  E K       + ++    +++  N         K +T+D VFGP +KQ+++Y  V  PI+D V+ GYN T+FAYGQTGTGKTFTMEG+R   +        L G+IP +   +F  +      V F V+VS LEIYNEE+ DLL    D   RL++ + P     V +K L    VH  DE+  ++ +G   R T +T MN +SSRSH+++++T+   ET+ DGE+  + GKL++VDLAGSE   ++GA   R +EA  IN SL TLG VI+ALV+ ++ H+PYR SKLTRLLQDSLGG +KT +IA I PA  N +E++S+L YA RAKNI NK  +N+   K AL+++Y  E+ERL+++L
Sbjct:   21 HIQVFVRCRPLNGIERKANSYSIVECDQARKELSVKLNVPLGEKSSKKTYTYDMVFGPAAKQIEIYKSVVYPILDEVILGYNCTVFAYGQTGTGKTFTMEGERSPNDEFTWEEDPLAGVIPRTLHQIFEKLTSL--GVEFSVKVSLLEIYNEELFDLLSSSPDIGERLQMFDDPRSKGAVLIKGLEEVTVHNKDEVYHILEHGAAKRRTASTLMNAYSSRSHSVFSITIHMKETMMDGEELVKIGKLNMVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVE-RTPHIPYRESKLTRLLQDSLGGRTKTSIIATISPAAVNIEETLSTLEYAARAKNIMNKPEVNQKLTKKALIKEYTDEIERLKKEL 393          
BLAST of KIF3A-like protein vs. Ensembl Sea Lamprey
Match: KIF27 (kinesin family member 27 [Source:HGNC Symbol;Acc:HGNC:18632])

HSP 1 Score: 298.516 bits (763), Expect = 4.082e-87
Identity = 172/382 (45.03%), Postives = 232/382 (60.73%), Query Frame = 1
Query:   94 DSDNVKVVMRCRPLNEKEL---KQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGK---RDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTAR-LEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVE-----GSETLHDG---EKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGK--STHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL 1188
            D   V+V +R RPL   E+   +Q CV   +V   N  I +   +A        FTFD+VFG    Q +VY    +P+V S + GYN T+FAYGQTG+GKTFT+ G      + + RGIIP + A +F A+ K   N  F V VSY+E+Y EE+RDLL  +  ++ + ++E       +      VV   DE+  L+  GN  R TG T MNEHSSRSH I+T+TV      GS    D    E      K H VDLAGSER  KTG TG R +E+ +IN  L  LGNVISAL D K  S+H+PYR++K+TR+L+DSLGGN+KTLMIA I P+  NFDE+++SL+YANRAKNIRNK ++N +P    + + ++E++ L + L
Sbjct:    2 DDTLVRVAVRIRPLLRNEILYSQQTCV---RVVPGNQQILLGKDRA--------FTFDHVFGSKVAQEEVYKTCIQPLVKSFVDGYNVTVFAYGQTGSGKTFTIGGANIASSIEDERGIIPRAIADLFFAM-KESHNTDFSVGVSYIEVYKEELRDLLDIETLSKDMHIREDDKGNTVIIGTKESVVETEDEVLSLLEAGNAARHTGTTQMNEHSSRSHTIFTLTVTQRRPYGSSNSGDNLNNESESLSSKFHFVDLAGSERVSKTGNTGERFKESIQINSGLLALGNVISALGDPKRKSSHIPYRDAKITRILKDSLGGNAKTLMIACISPSSGNFDETINSLKYANRAKNIRNKPVVNYNPDWDRIDEMEQEIKTLREAL 371          
BLAST of KIF3A-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 245.358 bits (625), Expect = 2.090e-69
Identity = 160/403 (39.70%), Postives = 223/403 (55.33%), Query Frame = 1
Query:   76 CTMDKEDSD-NVKVVMRCRPLNEKELKQ-GCVIAAQVNELNGSITITN-PKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDV------------PELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKE-----------RPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVT---VEGSETLHDGEKTF-RQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINED-PKDALLRQYQKELERLEQQLK 1191
            C      SD N+ V +RCR  N++E+++   V+ + +      I ++N    S     K + FD VFG  S Q  V+N  A+  +  +L GYN TIFAYGQTGTGKT+TM G  ++             E  GIIP     +F  ++    N  + V++S+LE+YNE ++DLL   +     V +             +  + VK +    ++ A E   L+  G+  R   AT  N+ SSRSH ++T+T   VE     H   K F + GKL+LVDLAGSE   ++GA   R QEA  IN SL TLG VI+ALVD  S H+PYR SKLTRLLQDSLGG +KT +IA I PA  + +E+ S+L YA RAK+I+N   +N+   KD  L+ Y +E+E+L   LK
Sbjct:   42 CNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSL--NKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD-HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLK 441          
BLAST of KIF3A-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 236.884 bits (603), Expect = 1.026e-67
Identity = 130/298 (43.62%), Postives = 179/298 (60.07%), Query Frame = 1
Query:  244 QFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTA-RLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALV--DG-KSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINE 1125
            +F FD +F   S Q  VY +   P++DSVL G+N T+FAYG TG GKT+T+ G    P   GII  +   +F  I   +    F + +SYLEIYNE +RDLL  +  + RL ++E     + V +L+    +  +++  L+  GN NR T  T  NE SSRSHA+  + +  +  L D         L ++DLAGSER   T   GIRL E   IN SL  LGN I+AL   DG +S H+PYR+SKLTRLL+ SLGGN KT+MI  I P+  ++DE++++L+YANRAK I+ K I N+
Sbjct:  152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG---TPSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQ 446          
BLAST of KIF3A-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 210.305 bits (534), Expect = 9.693e-59
Identity = 137/353 (38.81%), Postives = 194/353 (54.96%), Query Frame = 1
Query:  103 NVKVVMRCRPLNEKELKQGCVIAAQVNELN---GSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVL-FLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGV-------------YVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKST--HVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIR 1104
            N++V  R RP   K L+        VNE +   G  ++   K        +F FD +F      VDV+ +V + +V S L GYN  IFAYGQTG+GKTFTM    D     GIIP++ +H+F  I K +T    + V   ++EIYNE + DLL  D       KE   IG+              + ++ S  +   + ++ ++   NK R T +T  NEHSSRSH+I+ + + GS     G  ++  G L+LVDLAGSER   +   G RL+E   IN SL+ LG+VI AL    ST  H+P+RNSKLT LLQ SL G+SKTLM  NI P+  + +E+++SLR+A++  + R
Sbjct:  386 NIRVYCRIRPA-LKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-----GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNN----KEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNA-KTGAHSY--GTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTR 724          
BLAST of KIF3A-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 184.111 bits (466), Expect = 9.729e-50
Identity = 141/397 (35.52%), Postives = 202/397 (50.88%), Query Frame = 1
Query:  205 ITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETN--VLFLVRVSYLEIYNEEVRDLL--GKDQTAR---------------------LEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGI--RLQEANKINLSLATLGNVISALVDGK------------------------------STHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKN----IRNKAII----NEDPKD---ALLRQYQKELERLEQQLK 1191
            ITN K  V +   +F FD+VF  +   ++VY + ++P++D +L G+N TIFAYG TG+GKTFTM G     EL G+IP S +++F  I +   N    F V +SYLEIYNE + DLL  G +++                       L++++    GV V  L       ++E+ + +  G+K+R  G T+ N  SSRSHAI  + +  S  + +G  T R   L L DLAGSER     ATG   R +E + IN SL  LG VIS L   K                              S H+PYR+SKLTRLLQ +L G+S    I  +   +    E++++LR+A+RAKN    +  K+II    N+  KD    LLR+  +E  R+  +LK
Sbjct:  149 ITNDKTIVHEEIGEFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ--EL-GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLT-STNVKNG--TSRSSTLSLCDLAGSER-----ATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVSKKSIISNGNNDGDKDRTIELLRRQLEEQRRMISELK 534          
BLAST of KIF3A-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 164.851 bits (416), Expect = 1.422e-42
Identity = 95/198 (47.98%), Postives = 129/198 (65.15%), Query Frame = 1
Query:  598 GVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINE-DPKDALLRQYQKELERLEQQL 1188
            G+Y+++L  F +  A E   L+  G K+R   +T MN+ SSRSH I+T+T+      H  E  FR  K++LVDLAGSE   ++GA   R +EA  IN SL TLG VI+ALVD KS H+P+R SKLTRLLQDSLGGN+KT +IA I PA    +E+ S+L YA++AKNI+NK  +     KD L++    EL +++  L
Sbjct:  315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKK---HQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD-KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDL 507          

HSP 2 Score: 103.99 bits (258), Expect = 2.582e-23
Identity = 52/159 (32.70%), Postives = 88/159 (55.35%), Query Frame = 1
Query:  103 NVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITIT-----NPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKR-----DVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLL 549
            N+ V +RCR  NE+E+     +   V ++ GS  I+     +   +     K++T D VFGP + Q  ++++VA P+    + GYN T+  YG T TGKT+TM G       ++ +  GIIP     +F  +   + +  ++V+ S++E+YNEE++DLL
Sbjct:   36 NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192          
BLAST of KIF3A-like protein vs. Ensembl Nematostella
Match: EDO47075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN53])

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 367/673 (54.53%), Postives = 471/673 (69.99%), Query Frame = 1
Query:   85 DKEDS-DNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQD-NDMELPIPYRTYSLDGEQQLFQN--RSKTTR 2091
            +KEDS DNV+VV+RCRPLNEKE   GC +   V+E  GSI +T P     +PPK+FTFD VF  + KQ DVY   AR IV+SVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGI+PNSFAH+FG IAK + +V FLVRVSYLEIYNE VRDLLGKDQ A+LEVKERPDIGVYVKDL+S+V++ AD++D+ MT GNKNR  GATNMNE SSRSHAI+++TVE SE   DG++  R GKLHLVDLAGSERQ KTGATG+RL+EA +INLSL+TLGNVISALVDGKSTH+PYRNSKLTRLLQDSLGGNSKT+M+   G   +N              KN+  K+      K+A LR+Y    E +E +                               VK+ K  +   I  +++AE++  IE  + +L+++KDM  EEKN V ++L ++E  L +A +EQ  L+ R+  ++ KIIVGG NLLEKA+EQE LLE+SAKEL   ++ + +++K ++EKE+ER++IE +Y SLQEEA+ K KK+KK+  +  + K+E+ D +QE QRE EGLLENIR L R+L   VL+ID+ IP EFQ+L+ +N  WN++ GEWQL+ +AYTGNNMRR   +   ++  +D ND ++   Y +Y+  G     Q+  R KT R
Sbjct:    3 EKEDSGDNVRVVVRCRPLNEKEKGSGCKMCVNVDEGTGSIAVTPPGGRSSEPPKKFTFDRVFNVDCKQTDVYTDAARGIVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSVPELRGIVPNSFAHIFGHIAKVDGHVRFLVRVSYLEIYNENVRDLLGKDQNAKLEVKERPDIGVYVKDLSSYVMNNADDLDRTMTLGNKNRSVGATNMNERSSRSHAIFSITVECSEKGLDGQQHVRMGKLHLVDLAGSERQAKTGATGVRLKEATQINLSLSTLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTIMVG--GKTVHNL--------LITTCKNLNGKS---SGVKEAELRRYNSSEEEVEVE----------------------------GVMVKRKKNKKGHAIPPEKIAEMKAKIEAEKLQLQEKKDMAEEEKNAVAKELEKREKDLMEAEEEQNKLQERLKAVESKIIVGGVNLLEKAKEQELLLEESAKELAERRERQENLQKLIKEKEQERIDIEEKYASLQEEASGKTKKLKKVWTMLMSAKSEMADQQQEHQRETEGLLENIRELRRELQRQVLIIDSFIPVEFQELVEQNKLWNDEIGEWQLRYIAYTGNNMRRATPSPDPKDKHKDVNDTDISGVYLSYNQVGYPSSSQDPSRPKTGR 634          
BLAST of KIF3A-like protein vs. Ensembl Nematostella
Match: EDO40836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5X0])

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 303/607 (49.92%), Postives = 417/607 (68.70%), Query Frame = 1
Query:  133 LNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERS----IEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVA 1941
            +NEKE+  G     ++N   G I I NP    D+ PK FT+D V+  NSKQ+D+Y++  R +V+SVL GYNGTIFAYGQTGTGKTFTMEG R  P+LRG+IPNSF H+F  IA+  TN  +LVR SYLEIY EEVRDLLGKDQ  RLE+KERPD GVYVKDL SFV     E++ +M  GN+NR  GAT MNEHSSRSHAI+ +T+E S+    GE   R GKL++VDLAGSERQ KT ATG RL+EA KINLSL+ LGNVISALVDGKSTH+PYR+SKLTRLLQDSLGGN++T+M+ANIGPA YN++ES+++LRYANRAKNI+NK  INEDPKDALLR++Q+E+ RL+ +L   G +    +   E  +E  +D+   E+             S+ +L EI ++    IE+ ++ L +   M +EEK R+  ++ +K   L K ++ Q  L  ++  ++ K++ GG+++++K  EQER LE+  +E+  HK+ E  M +KL+ K+E+ + I+  Y++LQ+E   K KK+KKL    QT K+E+ +L++   RE + L +    L R+L    L++++ IP E +  +   A ++E+   W+LK +A
Sbjct:    1 MNEKEIANGHTRVVEMNVKKGQIEIRNP-LKKDEVPKMFTYDAVYDWNSKQIDLYDETFRQLVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSDPDLRGVIPNSFDHIFTHIART-TNQQYLVRASYLEIYQEEVRDLLGKDQKKRLELKERPDTGVYVKDLQSFVCKSVKEIEHVMNVGNQNRSVGATKMNEHSSRSHAIFIITIECSQLNAVGECHIRVGKLNMVDLAGSERQTKTEATGDRLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNYEESITTLRYANRAKNIKNKPHINEDPKDALLREFQEEIARLKNELDRRGGKKKKVKRRREDGTEEEVDDEDEEQ-------------SQAQLEEIMKAEQEKIEQEKKALLENHSMVAEEKERLMAEMQKKAAHLKKKQEAQAALVQKIKMMESKLLEGGKSIVDKTSEQERDLERKRQEIAEHKRQEREMLQKLEAKDEDTIEIKDTYSNLQQEVDVKTKKLKKLFMKLQTIKSEITELQEVHIRERQELEQAQDELTRELKLKSLIVESFIPTEEKNKLMNRAIYDEENESWKLKPLA 592          
BLAST of KIF3A-like protein vs. Ensembl Nematostella
Match: EDO37529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFN7])

HSP 1 Score: 427.557 bits (1098), Expect = 1.668e-144
Identity = 209/361 (57.89%), Postives = 268/361 (74.24%), Query Frame = 1
Query:  106 VKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL 1188
            V+V++RCRPLN++E    C    +++   G   +  P      PPK FTFD  +  +S   ++YN +  P+V+ VL GYNGT+FAYGQTG GK+F+M G  D P  RGIIP +F H+F +I  A+ +  FLV  SYLEIYNEE+RDLLGKD  A+L++KE PD GVYVKDL    V+   E++ +M  G+KNR  GAT MN  SSRSH+I+++ +E  +   +G +  R GKL+LVDLAGSERQ KTGATG RL+EA KINLSL+ LGNVISALVDGK+ H+PYR+SKLTRLLQDSLGGN+KTLM+A + PAD N+DE++S+LRYANRAKNI+NK  INEDPKDALLRQY +E+ERL++ L
Sbjct:    5 VRVIVRCRPLNKREKDLKCETVLEMDSDTGQCRLHKPGDKTQ-PPKAFTFDGAYFIDSTTENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSMMGITDPPTQRGIIPRAFEHIFESINVADDSK-FLVHASYLEIYNEEIRDLLGKDHKAKLDLKEHPDKGVYVKDLTMIPVNCVSEIEHVMDLGSKNRSVGATLMNADSSRSHSIFSINLEILDDDSEGNEHIRAGKLNLVDLAGSERQSKTGATGGRLKEATKINLSLSALGNVISALVDGKAKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPKINEDPKDALLRQYSEEIERLKKML 363          
BLAST of KIF3A-like protein vs. Ensembl Nematostella
Match: EDO39610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N5])

HSP 1 Score: 364.385 bits (934), Expect = 7.200e-120
Identity = 185/364 (50.82%), Postives = 248/364 (68.13%), Query Frame = 1
Query:  106 VKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQ---FTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKA--ETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQ 1182
            V+V+ RCRPL+  E+K    I   ++      ++  P     DP K    FTFD V+G       +Y+++  PIVD VL GYNGT+FAYGQT  GKTFTM+G        GI P    H+  ++       N  +L+ VSYLEIYNEE+RDLL K+  + LE+KE PD G+YVK L+S  V   ++M +++  G+ NR  G+T MN  SSRSH+I+ + ++ +       +  R GKL+LVDLAGSERQ K+GATG R +EA KINLSL+ LGNVISALVDGKS H+PYR+SKLTRLLQDSLGGNSKTLM+A I P   N++E++S+LRYA RAKNI+N+  INEDPKD+L+R+Y +E+++L++
Sbjct:    6 VRVIARCRPLDYNEIKMKTEIIVSIDSSLRQCSLRKP----GDPAKMRKVFTFDGVYGSQCNTEKLYSEIVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQGSAQPESQVGITPRCCRHILNSMQGKGRRRNREYLLHVSYLEIYNEEIRDLLVKNTRSNLEIKEHPDKGMYVKGLSSITVDCYEDMAEILEIGSANRSVGSTCMNTDSSRSHSIFIIDLQVNVNKGGEGECVRNGKLNLVDLAGSERQSKSGATGERFREATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNSKTLMVACISPGSNNYEETLSTLRYAKRAKNIKNRPRINEDPKDSLIRKYLEEIQQLKK 365          
BLAST of KIF3A-like protein vs. Ensembl Nematostella
Match: EDO49145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH21])

HSP 1 Score: 321.242 bits (822), Expect = 4.680e-96
Identity = 178/373 (47.72%), Postives = 242/373 (64.88%), Query Frame = 1
Query:  103 NVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKR-------DVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKD-QTARLEVKERP--DIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINED-PKDALLRQYQKELERLEQQL 1188
            N++VV+RCRP N KE+K+          +   IT+     +     K FTFD VF PNSKQ+DVY  V  P +D VL GYN TIFAYGQTGTGKT+TMEG++       D   L GIIP +   +F  +  ++T+  F VRVS+LEIYNEE+ DLL  + +TA+L + E       V ++ L   VV   DE+  ++  G   R T AT MN HSSRSH++++VT+   E   +GE+  + GKL+LVDLAGSE   ++GA   RL+EA  IN SL TLG VI++LV+ ++ HVPYR SKLTRLLQDSLGG +KT +IA I PA  N +E++S+L YA+RAKNI N+  +N+   K AL+++Y  E+E+L++ L
Sbjct:   11 NIQVVVRCRPRNGKEIKEASPAIVDCQPVKREITVQQDIGNNAHTTKTFTFDKVFAPNSKQIDVYKAVVMPTLDEVLQGYNCTIFAYGQTGTGKTYTMEGEKSEENLSWDQDPLAGIIPRTMHQLFERL-NSQTDCEFSVRVSFLEIYNEELFDLLSPNFETAKLRLFEDGARKGSVVIQGLEELVVSDRDEVYNILDRGRARRQTAATLMNAHSSRSHSLFSVTIHIKENSVNGEELLKIGKLNLVDLAGSENVGRSGAVDKRLREAGTINQSLLTLGRVITSLVE-RAPHVPYRESKLTRLLQDSLGGRTKTSIIATISPALCNIEETLSTLDYAHRAKNILNRPEVNQKLTKRALIKEYTDEIEKLKKDL 381          
BLAST of KIF3A-like protein vs. Ensembl Medaka
Match: kif3a (kinesin-like protein KIF3A [Source:NCBI gene;Acc:101164388])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 410/670 (61.19%), Postives = 514/670 (76.72%), Query Frame = 1
Query:   88 KEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQ--LFQNRSKTTR 2091
            +E SDNVKVV+RCRPLN++E   G   A  V+E+ G+IT+ N   +  +PPK FTFD VFGP+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPDIGVY+KDL S+  + AD+MD++MT G+KNR  GATNMNEHSSRSHAI+TVT+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L ++L++G     S  S SE   E   +    E    + ++   +K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE Q+L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   + +ID  IP+E+Q++I  N  WNED GEWQLKCVA+TGNNM++ +   QD+      +++L   Y  Y+ +  QQ  + Q R KT++
Sbjct:   11 QEVSDNVKVVVRCRPLNQREKMTGFKQAVTVDEIRGTITV-NKFETAQEPPKTFTFDTVFGPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDIGVYIKDLTSYAANNADDMDRIMTVGHKNRSVGATNMNEHSSRSHAIFTVTIEYSEKGLDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLRKKLEEGEEISGSEGSGSEEMDEGDDEAG--EPGEGRRRRKGRKKVSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLIKAQQEHQLLLEKLSTLEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQENNREIEGLLENIRQLSRELRLQMHIIDNFIPQEYQEMIENNVYWNEDIGEWQLKCVAFTGNNMKK-QSPAQDKKEKDPFEVDLSHVYLAYTEESLQQSLMKQERPKTSK 676          
BLAST of KIF3A-like protein vs. Ensembl Medaka
Match: kif3a (kinesin-like protein KIF3A [Source:NCBI gene;Acc:101164388])

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 410/670 (61.19%), Postives = 514/670 (76.72%), Query Frame = 1
Query:   88 KEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQ--LFQNRSKTTR 2091
            +E SDNVKVV+RCRPLN++E   G   A  V+E+ G+IT+ N   +  +PPK FTFD VFGP+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPDIGVY+KDL S+  + AD+MD++MT G+KNR  GATNMNEHSSRSHAI+TVT+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L ++L++G     S  S SE   E   +    E    + ++   +K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE Q+L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   + +ID  IP+E+Q++I  N  WNED GEWQLKCVA+TGNNM++ +   QD+      +++L   Y  Y+ +  QQ  + Q R KT++
Sbjct:    9 QEVSDNVKVVVRCRPLNQREKMTGFKQAVTVDEIRGTITV-NKFETAQEPPKTFTFDTVFGPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDIGVYIKDLTSYAANNADDMDRIMTVGHKNRSVGATNMNEHSSRSHAIFTVTIEYSEKGLDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLRKKLEEGEEISGSEGSGSEEMDEGDDEAG--EPGEGRRRRKGRKKVSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLIKAQQEHQLLLEKLSTLEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQENNREIEGLLENIRQLSRELRLQMHIIDNFIPQEYQEMIENNVYWNEDIGEWQLKCVAFTGNNMKK-QSPAQDKKEKDPFEVDLSHVYLAYTEESLQQSLMKQERPKTSK 674          
BLAST of KIF3A-like protein vs. Ensembl Medaka
Match: kif3a (kinesin-like protein KIF3A [Source:NCBI gene;Acc:101164388])

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 395/647 (61.05%), Postives = 495/647 (76.51%), Query Frame = 1
Query:  157 GCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQ--LFQNRSKTTR 2091
            G   A  V+E+ G+IT+ N   +  +PPK FTFD VFGP+SKQ+DVYN  ARPIVDSVL GYNGTIFAYGQTGTGKTFTMEG R VPELRGIIPNSFAH+FG IAKAE +  FLVRVSYLEIYNEEVRDLLGKDQ  RLEVKERPDIGVY+KDL S+  + AD+MD++MT G+KNR  GATNMNEHSSRSHAI+TVT+E SE   DG +  R GKLHLVDLAGSERQ KTGATG RL+EA KINLSL+TLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++S+LRYANRAKNI+NKA INEDPKDALLRQ+QKE+E L ++L++G     S  S SE   E   +    E    + ++   +K+S  ++ E++  IEE R+ LE + DME EE+N+ + +L ++E  L KA+QE Q+L  +++ L++K+IVGG +LL KAEEQE+LLE+S  ELE  ++    +RK+L+EKE+ER++IE +Y SLQEEA  K KK+KK+  +    K+E+ DL+QE  RE+EGLLENIR L+R+L   + +ID  IP+E+Q++I  N  WNED GEWQLKCVA+TGNNM++ +   QD+      +++L   Y  Y+ +  QQ  + Q R KT++
Sbjct:    3 GFKQAVTVDEIRGTITV-NKFETAQEPPKTFTFDTVFGPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDIGVYIKDLTSYAANNADDMDRIMTVGHKNRSVGATNMNEHSSRSHAIFTVTIEYSEKGLDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLRKKLEEGEEISGSEGSGSEEMDEGDDEAG--EPGEGRRRRKGRKKVSPDKMVEMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLIKAQQEHQLLLEKLSTLEKKVIVGGVDLLAKAEEQEKLLEESNNELEERRRRAEQLRKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQENNREIEGLLENIRQLSRELRLQMHIIDNFIPQEYQEMIENNVYWNEDIGEWQLKCVAFTGNNMKK-QSPAQDKKEKDPFEVDLSHVYLAYTEESLQQSLMKQERPKTSK 645          
BLAST of KIF3A-like protein vs. Ensembl Medaka
Match: ENSORLT00000017915.2 (kinesin-like protein KIF3A [Source:NCBI gene;Acc:101170096])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 372/662 (56.19%), Postives = 481/662 (72.66%), Query Frame = 1
Query:   73 ICTMDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQ 2058
            I  +++  SDN+KVV+RCRPL++KE   G   A  V+E+ G+IT+ N      +PPK+FTFD VFGP+SKQ++VYN  ARPIV+SVL GYNGTIFAYGQTGTGKTFTMEG R VPEL GIIPNSFAH+FG IAKA+ +  FLV VSYLEIYNEEVRDLL KDQ  RLEVKERPD GVYVKDL+ + V+ AD+MDK+MT GNKNR  GAT MNEHSSRSHAI+TVT+E SE   DG +    GKLHLVDLAGSERQ K+GAT  RL+EA KINLSL+TLGNVISALVDGKS+H+PYRNSKLTRLLQDSLGGNSKT+M ANIGPADYN+DE++ +LR+ANR KNI+NKA INED KDALLR  QKE++ L+++L++        +++          E  + R+ +K       + S  ++AE++  IE+ R  LE + +M  EE+N+ + +L  +E  L KA+QE+  L  ++  L+R +IVGG +LL  A+EQE+LLE+S  ELE  ++    +  +L EKE+E +  E +Y+SLQEEA  K +K+KK+  + +  K+EL DL+ E  RE+EGL EN   L R++    L+ID  IP E+Q++I+ NA WNED GEWQL+CVA+TGNN++R   N QD+      +++L   Y TY+ +  Q
Sbjct:    4 ITPIEQAVSDNIKVVVRCRPLDQKEKTMGLKEAVTVDEIRGTITV-NKLDMPQEPPKKFTFDTVFGPDSKQLEVYNLTARPIVESVLGGYNGTIFAYGQTGTGKTFTMEGVRAVPELLGIIPNSFAHIFGHIAKAKGDTRFLVHVSYLEIYNEEVRDLLVKDQMKRLEVKERPDRGVYVKDLSRYGVNKADDMDKIMTVGNKNRSVGATKMNEHSSRSHAIFTVTIEYSEKGVDGNQHVCMGKLHLVDLAGSERQGKSGATDQRLKEAAKINLSLSTLGNVISALVDGKSSHIPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETICTLRFANRVKNIQNKARINEDLKDALLRHLQKEIKDLQKKLEECEEISGPEDTDESDYEAGEPGEGRLRRKERK-------QFSSDKMAEMQAKIEKEREVLEAKLNMTEEERNKARAELEMREKDLLKAQQERHQLLEKLEKLERNVIVGGVDLLATAKEQEKLLEESKIELEERRRRAEQLHHELAEKEQEHLQREEKYSSLQEEAQRKTEKIKKVWTVLRAAKSELADLQLENYRELEGLQENNCQLMREIRQQTLIIDHFIPLEYQEMIKNNAHWNEDIGEWQLRCVAFTGNNIKRQNPN-QDKKEKDLFEVDLSSFYSTYTTESLQ 656          
BLAST of KIF3A-like protein vs. Ensembl Medaka
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:101155428])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 297/625 (47.52%), Postives = 432/625 (69.12%), Query Frame = 1
Query:   82 MDKEDS-DNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPK-ASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQ---QMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVA 1941
            M K  S ++VKVV+RCRP+NEKE   G      ++   G I + NP+ AS ++PPK FTFD V+  NSKQ+D+Y++  RP+VDSVL G+NGTIFAYGQTGTGKT+TMEG R  PE RG+IPNSF H+F  I++++ N  +LV  SYLEIY EE+RDLL KDQ+ RLE++ERPD+GV+V+DL+SFV     E++ +M  GN+NR  GATNMNEHSSRSHAI+ +TVE SE   D E   R GKL+LVDLAGSERQ KTGA G RL+EA KINLSL+ LGNVISALVDG+S+H+PYR+SKLTRLLQDSLGGN++T+M+ANIGPA YN +E++++LRYANRAKNI+NK  INEDPKDA+LR +Q+E+ RL++QLK           + +   +     +G ++   +      ++   +   E +  +E  RR + +   + +EEK R+   L EKE K+   R+E+   +ML  ++ D++ +++VGG+N+++   EQ+R+LE+  +E+   K+ E  MR++++ ++EE + ++  Y+SLQ+E   K KK+KKL +  Q  K E++D++++   E +   +    L R+L    L+++  IP++ +  I+    ++E+   W++K + 
Sbjct:    1 MSKSKSPESVKVVVRCRPMNEKERAAGFERVVSLDVKLGQIMVKNPREASANEPPKVFTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRKDPERRGVIPNSFEHIFTHISRSQ-NQQYLVSASYLEIYQEEIRDLLSKDQSRRLELRERPDVGVHVRDLSSFVTKSVREIENVMNIGNQNRSVGATNMNEHSSRSHAIFVITVECSEMGVDEENHIRVGKLNLVDLAGSERQSKTGAQGERLKEATKINLSLSALGNVISALVDGRSSHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRINEDPKDAMLRTFQEEILRLKEQLK-------KRGGKKKRRKQRRRRADGEDQEEGE-TDDDDDEDKGEYWKEQQEKLERERRAIVEDHSLVAEEKARL---LKEKEKKMEDLRREKEAGEMLAAKVKDMESRLLVGGKNIVDHTNEQQRVLEQKRQEIAEQKRREREMRQQMENRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQAVKGEIEDVQEQHISERQEHEQIQDELTRELKLKQLILENFIPQDEKNKIKTRMFFDEEEESWKMKPIT 613          
BLAST of KIF3A-like protein vs. Planmine SMEST
Match: SMESG000075065.1 (SMESG000075065.1)

HSP 1 Score: 1258.05 bits (3254), Expect = 0.000e+0
Identity = 653/671 (97.32%), Postives = 654/671 (97.47%), Query Frame = 1
Query:   82 MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQLFQNRSKTTRD 2094
            MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQ                +QQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADKKKKVKKLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENV QDNDMELPIPYRTYSLDGEQQLFQNRSKTTRD
Sbjct:    1 MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQ----------------QQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADKKKKVKKLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVKQDNDMELPIPYRTYSLDGEQQLFQNRSKTTRD 655          
BLAST of KIF3A-like protein vs. Planmine SMEST
Match: SMESG000075065.1 (SMESG000075065.1)

HSP 1 Score: 1254.2 bits (3244), Expect = 0.000e+0
Identity = 653/671 (97.32%), Postives = 654/671 (97.47%), Query Frame = 1
Query:   82 MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPYRTYSLDGEQQLFQNRSKTTRD 2094
            MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQ                +QQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADKKKKVKKLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENV QDNDMELPIPYRTYSLDGEQQLFQNRSKTTRD
Sbjct:    1 MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRVKKPKKIRSEKISKQ----------------QQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADKKKKVKKLNNIYQTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVKQDNDMELPIPYRTYSLDGEQQLFQNRSKTTRD 655          
BLAST of KIF3A-like protein vs. Planmine SMEST
Match: SMESG000020245.1 (SMESG000020245.1)

HSP 1 Score: 461.07 bits (1185), Expect = 2.133e-152
Identity = 269/612 (43.95%), Postives = 392/612 (64.05%), Query Frame = 1
Query:  133 LNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL--KXXXXXXXXXXXXXXXXXXXXXXXNGVERRVKKPKKIRSEKIS----KQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIEKENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKELERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADXXXXXXXLNNIYQTTKAELDDLKQE---QQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKLIRENAQWNEDTGEWQLKCVA 1941
            +N++E+++G     +++   G + +   K+S  + P++FTFD V+  NS Q D+Y++  + +V SVL G+NGTIFAYGQTGTGKTFTM+G ++ P L+G+IP SF H+F  I+++ T+  +LVR SYLEIY E VRDLL KDQT +LE+KE+PD GVYV DL+S + +   E++ +M  GNKNR  GATNMNEHSSRSHAI+ VT+E      +GE   R GKL++VDLAGSERQ KT + G RL+EA KINLSL+ LGNVISALVDGKSTH+PYR+SKLTRLLQDSLGGN+KT+M+ANIGPA YN+DE+ ++LRYANRAKNI+NK  INEDPKDALLR+YQ ++E+L+  L  K+               +      N  +  ++    I  E  +    +Q+LAE    +EE +R +   K +  E+K  +   L +KE  L +    ++ L N++  ++ K++ G +++ +   EQE  LEK  +E+   K  E  M K+++ KEE    +     SL +E      ++KK     +  K E+ +L++E   Q++E E   E    L +++   +++I+  I  E +  I +  + +E+   W+LK +A
Sbjct:    1 MNKREVEEGHSRCVEMDTKKGIVEVNCGKSS-QEGPRRFTFDAVYDWNSAQKDLYDETFQDLVQSVLEGFNGTIFAYGQTGTGKTFTMQGLKEDPVLKGVIPRSFDHIFNHISRS-TDAQYLVRASYLEIYKESVRDLLHKDQTKQLEIKEKPDTGVYVNDLSSVLTNSCREIENVMNIGNKNRSVGATNMNEHSSRSHAIFIVTIECCRANAEGENHIRVGKLNMVDLAGSERQSKTHSEGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIGPASYNYDETTNTLRYANRAKNIKNKPKINEDPKDALLREYQDKIEKLKGMLENKETKTGRKKKSRRRRKVNADGTTNNESDSDMEGNDDIDEEATAQAYHQQKLAE----LEEEKRAILNDKSLIQEQKLELLDKLKKKEENLNQELANKEELENQIKAMESKVLRGDKDIAQHTREQEEALEKRRREINEQKNKEREMAKEMEMKEENLATLHEGKTSLIQEVELYTTRMKKFYERVKEIKIEIQELQEEYVKQRQEHEAEQE---ELTKEIKLRMVIIENFISIEDKLKIEKRLELDEEEDVWRLKPLA 603          
BLAST of KIF3A-like protein vs. Planmine SMEST
Match: SMESG000035453.1 (SMESG000035453.1)

HSP 1 Score: 404.06 bits (1037), Expect = 1.940e-129
Identity = 204/361 (56.51%), Postives = 260/361 (72.02%), Query Frame = 1
Query:  106 VKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL 1188
            VKV++R RPLNE+E+   C     ++   G  +I NP  +   P K F FD  +  +S    +Y+ +  P+V++V  GYNGTIFAYGQTG GK+FTM+G  +    RG+IP +F HVF  I+ AE N  +LV  SYLEIYNEE+RDLL KD  A+L++KE P+ GVYV  L+   V    +   +M  G KNR TG+T MN  SSRSH+I+T+ +E   T  + E   + GKL+LVDLAGSERQ KTGATG RL+EA KINLSL+ LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KTLMIA + PAD N++E++S+LRYANRAKNI+NK  INEDPKDALLR++Q E+ RL+Q L
Sbjct:    6 VKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDN-KTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 364          
BLAST of KIF3A-like protein vs. Planmine SMEST
Match: SMESG000035453.1 (SMESG000035453.1)

HSP 1 Score: 404.06 bits (1037), Expect = 2.649e-129
Identity = 204/361 (56.51%), Postives = 260/361 (72.02%), Query Frame = 1
Query:  106 VKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL 1188
            VKV++R RPLNE+E+   C     ++   G  +I NP  +   P K F FD  +  +S    +Y+ +  P+V++V  GYNGTIFAYGQTG GK+FTM+G  +    RG+IP +F HVF  I+ AE N  +LV  SYLEIYNEE+RDLL KD  A+L++KE P+ GVYV  L+   V    +   +M  G KNR TG+T MN  SSRSH+I+T+ +E   T  + E   + GKL+LVDLAGSERQ KTGATG RL+EA KINLSL+ LGNVISALVDGKS H+PYR+SKLTR+LQDSLGGN+KTLMIA + PAD N++E++S+LRYANRAKNI+NK  INEDPKDALLR++Q E+ RL+Q L
Sbjct:    6 VKVIVRVRPLNEREINLNCKNIIDIDVSRGQCSIRNPNDN-KTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAE-NSKYLVHASYLEIYNEEIRDLLAKDVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKPKINEDPKDALLREFQNEINRLKQML 364          
The following BLAST results are available for this feature:
BLAST of KIF3A-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF3A0.000e+063.10kinesin family member 3A [Source:HGNC Symbol;Acc:H... [more]
KIF3A0.000e+063.52kinesin family member 3A [Source:HGNC Symbol;Acc:H... [more]
KIF3A0.000e+061.08kinesin family member 3A [Source:HGNC Symbol;Acc:H... [more]
KIF3A0.000e+076.40kinesin family member 3A [Source:HGNC Symbol;Acc:H... [more]
KIF3B0.000e+048.39kinesin family member 3B [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-200.000e+050.90Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-200.000e+050.90Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-200.000e+050.90Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-114.742e-16945.26Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
osm-33.564e-13656.83Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klp64D0.000e+051.96gene:FBgn0004380 transcript:FBtr0077157[more]
Klp68D5.501e-13440.36gene:FBgn0004381 transcript:FBtr0332129[more]
Klp68D5.501e-13440.36gene:FBgn0004381 transcript:FBtr0076030[more]
Kif3C4.157e-13040.03gene:FBgn0039925 transcript:FBtr0089196[more]
Klp61F1.183e-8843.95gene:FBgn0004378 transcript:FBtr0072733[more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3a0.000e+063.52kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3a0.000e+063.52kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3a0.000e+063.52kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3b8.937e-17947.10kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3b2.541e-17847.10kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbll10.000e+062.97Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
cbll10.000e+062.97Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
cbll10.000e+063.68Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
cbll10.000e+063.68Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
cbll10.000e+061.63Cbl proto-oncogene-like 1, E3 ubiquitin protein li... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif3a0.000e+063.52kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
Kif3a0.000e+063.68kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
Kif3a0.000e+061.33kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
Kif3a0.000e+063.68kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
Kif3b0.000e+048.07kinesin family member 3B [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of KIF3A-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R628|KIF3A_MACFA0.000e+063.26Kinesin-like protein KIF3A OS=Macaca fascicularis ... [more]
sp|Q5R4H3|KIF3A_PONAB0.000e+062.94Kinesin-like protein KIF3A OS=Pongo abelii OX=9601... [more]
sp|Q9Y496|KIF3A_HUMAN0.000e+063.52Kinesin-like protein KIF3A OS=Homo sapiens OX=9606... [more]
sp|P28741|KIF3A_MOUSE0.000e+063.52Kinesin-like protein KIF3A OS=Mus musculus OX=1009... [more]
sp|P46872|KRP85_STRPU0.000e+058.99Kinesin-II 85 kDa subunit OS=Strongylocentrotus pu... [more]
back to top
BLAST of KIF3A-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A219MDK07.661e-897.87Kinesin-like protein OS=Schmidtea mediterranea OX=... [more]
D2ILT50.000e+0100.00Kinesin-like protein (Fragment) OS=Schmidtea medit... [more]
A0A4S2L6T50.000e+067.52Kinesin-like protein OS=Opisthorchis felineus OX=1... [more]
A0A4E0RLP80.000e+066.21Kinesin-like protein OS=Fasciola hepatica OX=6192 ... [more]
A0A3Q0KLZ50.000e+067.46Kinesin-like protein OS=Schistosoma mansoni OX=618... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3a0.000e+064.16kinesin family member 3A [Source:NCBI gene;Acc:103... [more]
kif3a0.000e+064.06kinesin family member 3A [Source:NCBI gene;Acc:103... [more]
kif3a0.000e+063.65kinesin family member 3A [Source:NCBI gene;Acc:103... [more]
kif3a0.000e+061.92kinesin family member 3A [Source:NCBI gene;Acc:103... [more]
kif3a0.000e+061.16kinesin family member 3A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3a0.000e+059.94kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3ca4.550e-17848.22kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000010617.15.083e-11963.19pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 ge... [more]
kif111.461e-9244.68kinesin family member 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
KIF274.082e-8745.03kinesin family member 27 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP12.090e-6939.70Kinesin-related motor protein; required for mitoti... [more]
KIP31.026e-6743.62Kinesin-related antiparallel sliding motor protein... [more]
KAR39.693e-5938.81Minus-end-directed microtubule motor; functions in... [more]
KIP29.729e-5035.52Kinesin-related motor protein involved in mitotic ... [more]
CIN81.422e-4247.98Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470750.000e+054.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408360.000e+049.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375291.668e-14457.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396107.200e-12050.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491454.680e-9647.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of KIF3A-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3a0.000e+061.19kinesin-like protein KIF3A [Source:NCBI gene;Acc:1... [more]
kif3a0.000e+061.19kinesin-like protein KIF3A [Source:NCBI gene;Acc:1... [more]
kif3a0.000e+061.05kinesin-like protein KIF3A [Source:NCBI gene;Acc:1... [more]
ENSORLT00000017915.20.000e+056.19kinesin-like protein KIF3A [Source:NCBI gene;Acc:1... [more]
kif3b0.000e+047.52kinesin family member 3B [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of KIF3A-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075065.10.000e+097.32SMESG000075065.1[more]
SMESG000075065.10.000e+097.32SMESG000075065.1[more]
SMESG000020245.12.133e-15243.95SMESG000020245.1[more]
SMESG000035453.11.940e-12956.51SMESG000035453.1[more]
SMESG000035453.12.649e-12956.51SMESG000035453.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014919
GenBankACZ64526.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014919 ID=SMED30014919|Name=KIF3A-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2208bp
GATATTTTTCAAATGTCTGCTGTTTTAATATTTTAATTGGAGTTTATTGT
AAATTTCAATATTTAAAAGTTTATCTGTACCATGGATAAAGAAGATTCAG
ATAATGTAAAAGTTGTTATGCGATGTAGACCTCTTAATGAGAAGGAATTG
AAACAAGGATGTGTTATAGCTGCTCAAGTTAATGAATTGAATGGCTCAAT
TACGATAACCAACCCAAAAGCTAGTGTGGATGATCCACCGAAACAATTTA
CGTTTGATTATGTATTTGGACCTAATAGTAAACAGGTAGATGTATATAAC
AAAGTAGCAAGACCAATAGTTGATTCAGTTTTAAGTGGATATAATGGAAC
AATATTTGCTTATGGTCAAACTGGCACAGGAAAAACCTTTACAATGGAAG
GAAAGAGGGATGTGCCGGAATTGCGAGGTATTATTCCAAATTCATTTGCC
CACGTATTTGGTGCAATCGCCAAGGCAGAGACAAATGTTCTGTTTTTAGT
TCGTGTATCATACTTAGAGATTTATAATGAAGAGGTTAGAGACCTTCTTG
GCAAAGATCAAACTGCGAGACTGGAAGTTAAAGAACGCCCGGATATTGGT
GTGTACGTGAAAGATCTGGCTAGCTTTGTGGTTCATGGAGCCGATGAAAT
GGATAAACTGATGACATATGGCAATAAAAACCGTGTGACTGGAGCTACGA
ATATGAATGAGCACAGTTCTCGATCTCATGCCATTTATACGGTAACTGTT
GAAGGCAGTGAAACTCTACATGACGGAGAGAAAACCTTTCGACAAGGAAA
ATTACATTTAGTAGATCTTGCTGGTTCAGAAAGACAAGTAAAGACAGGAG
CGACTGGAATACGACTTCAAGAAGCTAACAAAATTAATTTATCGTTGGCA
ACTTTAGGAAACGTTATTTCAGCTCTTGTTGATGGCAAAAGCACTCATGT
TCCATATCGTAACTCTAAATTGACGAGATTGCTCCAAGATTCCCTTGGAG
GAAATTCAAAAACCTTAATGATTGCAAATATCGGCCCAGCAGATTATAAT
TTTGACGAATCAGTTAGCTCGTTGCGTTATGCCAATAGAGCCAAAAACAT
AAGGAATAAAGCAATAATTAATGAAGATCCAAAAGATGCATTGTTGAGAC
AATATCAGAAAGAATTGGAACGATTAGAACAGCAATTAAAGGACGGAGGT
ATAGAAGATGTATCAGGAGAATCAGAATCAGAATCAGAATCCGAAATTGT
TATAGATGAGAATGGGGTCGAAAGACGCGTTAAAAAACCTAAAAAAATCA
GATCAGAGAAAATCAGTAAGCAACGTTTAGCAGAAATCGAACGATCTATT
GAAGAGAATAGACGAAAATTAGAACAACAGAAAGATATGGAATCAGAAGA
GAAAAATCGTGTCCAACAAGATCTTATCGAGAAAGAAAATAAATTAGCCA
AGGCTCGTCAAGAACAGCAAATGTTGCGCAACAGAATGAACGATTTACAG
CGGAAAATTATTGTCGGAGGTGAAAACCTCCTTGAGAAAGCTGAAGAACA
AGAGCGGTTATTGGAGAAATCGGCAAAGGAGTTAGAGCGCCATAAACAGA
CTGAAGTTTCTATGAGAAAGAAACTCCAAGAGAAAGAGGAGGAGAGAATG
AATATCGAAGTGCAGTATAATAGCTTACAGGAAGAAGCGGCGGATAAAAA
GAAAAAAGTGAAAAAACTTAACAATATCTATCAGACTACAAAAGCGGAAC
TTGATGATTTGAAGCAAGAACAACAACGGGAAATGGAAGGCCTACTGGAA
AACATACGATCATTAAATCGAGATCTCGGTTTCCACGTGTTATTAATTGA
CACATGTATACCGAAAGAATTCCAAAAACTAATTCGAGAGAACGCGCAAT
GGAACGAGGACACCGGAGAGTGGCAGTTGAAATGCGTGGCCTACACCGGG
AATAATATGAGACGGGTGAAAGAGAATGACCAAGATGAAAATGTTATACA
AGATAACGACATGGAACTGCCGATTCCCTATCGAACGTACAGTCTCGATG
GAGAGCAGCAATTATTCCAGAACAGGAGTAAAACGACTCGAGATAAAGTG
CCGAGGCCGAAAACAGGGAAAAAGAAAAGGAAGAAAGAAGTGATGTGATA
TAATGGTGAAATGTTACAGAAATTTTATAAGTTTTATTTGAATATATTTG
TCTTGATA
back to top

protein sequence of SMED30014919-orf-1

>SMED30014919-orf-1 ID=SMED30014919-orf-1|Name=SMED30014919-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=689bp
MDKEDSDNVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVD
DPPKQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTG
KTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNE
EVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKN
RVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSE
RQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRL
LQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDP
KDALLRQYQKELERLEQQLKDGGIEDVSGESESESESEIVIDENGVERRV
KKPKKIRSEKISKQRLAEIERSIEENRRKLEQQKDMESEEKNRVQQDLIE
KENKLAKARQEQQMLRNRMNDLQRKIIVGGENLLEKAEEQERLLEKSAKE
LERHKQTEVSMRKKLQEKEEERMNIEVQYNSLQEEAADKKKKVKKLNNIY
QTTKAELDDLKQEQQREMEGLLENIRSLNRDLGFHVLLIDTCIPKEFQKL
IRENAQWNEDTGEWQLKCVAYTGNNMRRVKENDQDENVIQDNDMELPIPY
RTYSLDGEQQLFQNRSKTTRDKVPRPKTGKKKRKKEVM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0008017microtubule binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule