2-oxoglutarate dehydrogenase mitochondrial

Overview
Name2-oxoglutarate dehydrogenase mitochondrial
Smed IDSMED30014911
Length (bp)3299
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 2-oxoglutarate dehydrogenase mitochondrial (SMED30014911) t-SNE clustered cells

Violin plots show distribution of expression levels for 2-oxoglutarate dehydrogenase mitochondrial (SMED30014911) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 2-oxoglutarate dehydrogenase mitochondrial (SMED30014911) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 2-oxoglutarate dehydrogenase mitochondrial (SMED30014911) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014911

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30014911SMESG000020522.1 dd_Smed_v4_1869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014911SMESG000020522.1 dd_Smed_v4_1869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014911SMESG000020522.1 dd_Smed_v4_1869_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Human
Match: OGDHL (oxoglutarate dehydrogenase like [Source:HGNC Symbol;Acc:HGNC:25590])

HSP 1 Score: 1286.17 bits (3327), Expect = 0.000e+0
Identity = 623/1043 (59.73%), Postives = 776/1043 (74.40%), Query Frame = 1
Query:  100 MYKIRLLAQK----QRSLLSNYGFPIFKNSVKNSS--ASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            M ++RLL  +       LL+ +  P+F    ++S   A+  S   GG S Y+EEMY +WLENP SVHK               SW+ +F + S+ A  G A   PP+ ++                    S+++        +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L       A   + +E  LDK F+LPTTT IGG    L+LREII RLEN YC+HIG+E+MFIND+ +C WIR+KFETPG+M+FS EEKR ++ARL+RS RFE+FLA+KWS+EKRFGLEGCEV+IP++KT+ID SS++G+E+  +GMPHRGRLNVLANV RK LEQ+FCQFD KLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D QGKK MSI++HGDAAF GQGVV+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +KLI E  V+ Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF+ + +P  M  P TG+ E +L HIG V SSVP E+F IH+GL R L+ R      R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELG++   PN+LV+WEAQFGDF+NTAQCIIDQFI++GQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F + FEV QL+D NW VVNC+TPAN FHVLRRQ+LL FRKPLI  TPKSLLR PEAKSSFD+M+  T F+R+IPE G A   PE+V+++I C+GKVYY+L+KER  + L++++AI R+EQISPFP+DL+ +E  KY  A + W QEEHKNMG + Y+ PR   +++   P      I YVGR P+AA A GN+  HL+ + +F+  A + ++
Sbjct:    1 MSQLRLLPSRLGVQAARLLAAHDVPVFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHK---------------SWDSFFREASEEAFSGSAQPRPPSVVHE-----------------SRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAF-YDLQEADLDKEFQLPTTTFIGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDMLTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVKERSSQDLEEKVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILRRARP------IWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQA 1004          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Human
Match: OGDH (oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8124])

HSP 1 Score: 1271.14 bits (3288), Expect = 0.000e+0
Identity = 624/1064 (58.65%), Postives = 764/1064 (71.80%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGE-HFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*NDFF*FRLDILYN 3240
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  P      LP            V    S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD S+P ++              E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E +L HIG V SSVP ENF IH GL R LK R + +  R  +WAL E  AFGSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P   E +F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IPE G A +NPE V++++ C+GKVYY+L +ER+ R +  ++AI R+EQ+SPFP+DLL +E+ KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ + +  A           F LD+  N
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQSP------LP----LSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGF-YGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIS------RAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTA-----------FDLDVFKN 1021          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Human
Match: OGDH (oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8124])

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 625/1078 (57.98%), Postives = 766/1078 (71.06%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELT--------------LKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGE-HFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*NDFF*FRLDILYN 3240
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  P      LP            V    S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD S+P ++               L+           E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E +L HIG V SSVP ENF IH GL R LK R + +  R  +WAL E  AFGSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P   E +F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IPE G A +NPE V++++ C+GKVYY+L +ER+ R +  ++AI R+EQ+SPFP+DLL +E+ KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ + +  A           F LD+  N
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQSP------LP----LSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLDLAVFKERLRMLTVGGFYGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIS------RAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTA-----------FDLDVFKN 1036          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Human
Match: OGDH (oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8124])

HSP 1 Score: 1259.2 bits (3257), Expect = 0.000e+0
Identity = 620/1064 (58.27%), Postives = 764/1064 (71.80%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGE-HFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*NDFF*FRLDILYN 3240
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  P      LP            V    S +  +      +E+HLAVQ++IR+YQ RGH+++ LDPLGI   + DD+ P  ++     + L+    E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E +L HIG V SSVP ENF IH GL R LK R + +  R  +WAL E  AFGSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P   E +F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IPE G A +NPE V++++ C+GKVYY+L +ER+ R +  ++AI R+EQ+SPFP+DLL +E+ KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ + +  A           F LD+  N
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQSP------LP----LSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDA-PVTVSSNVGFYGLD----ESDLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIS------RAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTA-----------FDLDVFKN 1017          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Human
Match: OGDH (oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8124])

HSP 1 Score: 1256.12 bits (3249), Expect = 0.000e+0
Identity = 621/1075 (57.77%), Postives = 765/1075 (71.16%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAF-SPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDD---SIPKELTLKHYNFALEQ-------NFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGE-HFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*NDFF*FRLDILYN 3240
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+ SP P    SL    +             S +  +      +E+HLAVQ++IR+YQ RGH+++ LDPLGI   + DD   ++   + L  +   L            E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E +L HIG V SSVP ENF IH GL R LK R + +  R  +WAL E  AFGSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P   E +F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IPE G A +NPE V++++ C+GKVYY+L +ER+ R +  ++AI R+EQ+SPFP+DLL +E+ KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ + +  A           F LD+  N
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAH-----------AQSLVEAQPNVDKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDAPVTVSSNVDLAVFKERLRMLTVGGFYGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIS------RAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTA-----------FDLDVFKN 1032          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Celegans
Match: ogdh-1 (2-oxoglutarate dehydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O61199])

HSP 1 Score: 1215.68 bits (3144), Expect = 0.000e+0
Identity = 586/1006 (58.25%), Postives = 731/1006 (72.66%), Query Frame = 1
Query:  181 KNSSASA----ESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIP----PFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFM 3174
            +N S +A    E FLNG SS+YIE+MY +WL++P+SVH                SW+ YF  V  GA  GQAF  PP   Y+            T      + L      QS I +HL +Q +IRSYQ RGHN++ LDPLGI SADLDD+IP EL L  Y         E  LD+ F LP TT I    + LTLREI+ RL++ YC   GVEYM +N+L + DWIRR+FE P + + S ++K+++  RLIRST+FEEFLAKKW +EKRFGLEGCEVLIP+MK VID+SS LGV+SF IGMPHRGRLNVLANVCR+PL  +  QF S LEP+DEGSGDVKYHLG+  +R+NR + K +K+AV ANPSHLEAVDPV+ GK  AE +Y  D++  + M+I+LHGDAAF GQGVV ETF+L DLPSY+T G IHIVVNNQIGFTTDPR +RSSPYCTDV RV   PIFHVN DDPEAV++V  VAA+WR  F KDV++DLVCYRR GHNE+DEPMFTQPLMY++I    T L +Y+EK++ E V + Q  +EE+ KY  I E+AY  A+K T +RNR+WLDSPWD FF  +DP+K+P TG+++  ++ I    S  PE FN+H GL+R+LK R+Q + +   +WA GEA AFGSLLK GIHVRLSGQDV+RGTFSHRH VLHDQ+ D  ++ PLN+L  GQ E++V NSSLSEYAVLGFELG+S  DPNSLVIWEAQFGDF+NTAQCIIDQFI+SGQSKW+RQSGLVMLLPHGYEGMGPEHSSAR ERFLQM N+D D I      F   FE QQLHD NW V NCTTPAN++H+LRRQV + FRKP +  +PKSLLR P A+S  ++    + F+R+IPETG  ++NP  V++V+ C+GKVYY+++  R+    ++ +A++RVEQ+SPFPYDL+ +E  KY  A + W QEEHKNMGAW +V+PR+N+L+ +   + R  K  Y GR PS++ A GNKF H+ E  + M
Sbjct:   38 RNQSVAAAVKHEPFLNGSSSIYIEQMYEAWLQDPSSVH---------------TSWDAYFRNVEAGAGPGQAFQAPPATAYAGALGVSPAAAQVTTSSAPATRLDTNASVQS-ISDHLKIQLLIRSYQTRGHNIADLDPLGINSADLDDTIPPELELSFYGLG------ERDLDREFLLPPTTFI-SEKKSLTLREILQRLKDIYCTSTGVEYMHLNNLEQQDWIRRRFEAPRVTELSHDQKKVLFKRLIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVIDSSSTLGVDSFVIGMPHRGRLNVLANVCRQPLATILSQF-STLEPADEGSGDVKYHLGVCIERLNRQSQKNVKIAVVANPSHLEAVDPVVMGKVRAEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNLDDLPSYTTHGAIHIVVNNQIGFTTDPRSSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPLMYQRIKQTKTALEKYQEKILNEGVANEQYVKEELTKYGSILEDAYENAQKVTYVRNRDWLDSPWDDFFKKRDPLKLPSTGIEQENIEQIIGKFSQYPEGFNLHRGLERTLKGRQQMLKDNSLDWACGEALAFGSLLKEGIHVRLSGQDVQRGTFSHRHHVLHDQKVDQKIYNPLNDLSEGQGEYTVCNSSLSEYAVLGFELGYSMVDPNSLVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLPHGYEGMGPEHSSARPERFLQMCNED-DEIDLEKIAFEGTFEAQQLHDTNWIVANCTTPANIYHLLRRQVTMPFRKPAVVFSPKSLLRHPMARSPVEDFQSGSNFQRVIPETGAPSQNPPDVKRVVFCTGKVYYDMVAARKHVGKENDVALVRVEQLSPFPYDLVQQECRKYQGAEILWAQEEHKNMGAWSFVQPRINSLLSI---DGRATK--YAGRLPSSSPATGNKFTHMQEQKEMM 1013          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Celegans
Match: ogdh-1 (2-oxoglutarate dehydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O61199])

HSP 1 Score: 1059.67 bits (2739), Expect = 0.000e+0
Identity = 491/792 (61.99%), Postives = 615/792 (77.65%), Query Frame = 1
Query:  808 MFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDY---IPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFM 3174
            M +N+L + DWIRR+FE P + + S ++K+++  RLIRST+FEEFLAKKW +EKRFGLEGCEVLIP+MK VID+SS LGV+SF IGMPHRGRLNVLANVCR+PL  +  QF S LEP+DEGSGDVKYHLG+  +R+NR + K +K+AV ANPSHLEAVDPV+ GK  AE +Y  D++  + M+I+LHGDAAF GQGVV ETF+L DLPSY+T G IHIVVNNQIGFTTDPR +RSSPYCTDV RV   PIFHVN DDPEAV++V  VAA+WR  F KDV++DLVCYRR GHNE+DEPMFTQPLMY++I    T L +Y+EK++ E V + Q  +EE+ KY  I E+AY  A+K T +RNR+WLDSPWD FF  +DP+K+P TG+++  ++ I    S  PE FN+H GL+R+LK R+Q + +   +WA GEA AFGSLLK GIHVRLSGQDV+RGTFSHRH VLHDQ+ D  ++ PLN+L  GQ E++V NSSLSEYAVLGFELG+S  DPNSLVIWEAQFGDF+NTAQCIIDQFI+SGQSKW+RQSGLVMLLPHGYEGMGPEHSSAR ERFLQM N+D +       F   FE QQLHD NW V NCTTPAN++H+LRRQV + FRKP +  +PKSLLR P A+S  ++    + F+R+IPETG  ++NP  V++V+ C+GKVYY+++  R+    ++ +A++RVEQ+SPFPYDL+ +E  KY  A + W QEEHKNMGAW +V+PR+N+L+ +   + R  K  Y GR PS++ A GNKF H+ E  + M
Sbjct:    1 MHLNNLEQQDWIRRRFEAPRVTELSHDQKKVLFKRLIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVIDSSSTLGVDSFVIGMPHRGRLNVLANVCRQPLATILSQF-STLEPADEGSGDVKYHLGVCIERLNRQSQKNVKIAVVANPSHLEAVDPVVMGKVRAEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNLDDLPSYTTHGAIHIVVNNQIGFTTDPRSSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPLMYQRIKQTKTALEKYQEKILNEGVANEQYVKEELTKYGSILEDAYENAQKVTYVRNRDWLDSPWDDFFKKRDPLKLPSTGIEQENIEQIIGKFSQYPEGFNLHRGLERTLKGRQQMLKDNSLDWACGEALAFGSLLKEGIHVRLSGQDVQRGTFSHRHHVLHDQKVDQKIYNPLNDLSEGQGEYTVCNSSLSEYAVLGFELGYSMVDPNSLVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLPHGYEGMGPEHSSARPERFLQMCNEDDEIDLEKIAFEGTFEAQQLHDTNWIVANCTTPANIYHLLRRQVTMPFRKPAVVFSPKSLLRHPMARSPVEDFQSGSNFQRVIPETGAPSQNPPDVKRVVFCTGKVYYDMVAARKHVGKENDVALVRVEQLSPFPYDLVQQECRKYQGAEILWAQEEHKNMGAWSFVQPRINSLLSI---DGRATK--YAGRLPSSSPATGNKFTHMQEQKEMM 786          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Celegans
Match: ogdh-1 (2-oxoglutarate dehydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O61199])

HSP 1 Score: 1059.67 bits (2739), Expect = 0.000e+0
Identity = 491/792 (61.99%), Postives = 615/792 (77.65%), Query Frame = 1
Query:  808 MFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDY---IPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFM 3174
            M +N+L + DWIRR+FE P + + S ++K+++  RLIRST+FEEFLAKKW +EKRFGLEGCEVLIP+MK VID+SS LGV+SF IGMPHRGRLNVLANVCR+PL  +  QF S LEP+DEGSGDVKYHLG+  +R+NR + K +K+AV ANPSHLEAVDPV+ GK  AE +Y  D++  + M+I+LHGDAAF GQGVV ETF+L DLPSY+T G IHIVVNNQIGFTTDPR +RSSPYCTDV RV   PIFHVN DDPEAV++V  VAA+WR  F KDV++DLVCYRR GHNE+DEPMFTQPLMY++I    T L +Y+EK++ E V + Q  +EE+ KY  I E+AY  A+K T +RNR+WLDSPWD FF  +DP+K+P TG+++  ++ I    S  PE FN+H GL+R+LK R+Q + +   +WA GEA AFGSLLK GIHVRLSGQDV+RGTFSHRH VLHDQ+ D  ++ PLN+L  GQ E++V NSSLSEYAVLGFELG+S  DPNSLVIWEAQFGDF+NTAQCIIDQFI+SGQSKW+RQSGLVMLLPHGYEGMGPEHSSAR ERFLQM N+D +       F   FE QQLHD NW V NCTTPAN++H+LRRQV + FRKP +  +PKSLLR P A+S  ++    + F+R+IPETG  ++NP  V++V+ C+GKVYY+++  R+    ++ +A++RVEQ+SPFPYDL+ +E  KY  A + W QEEHKNMGAW +V+PR+N+L+ +   + R  K  Y GR PS++ A GNKF H+ E  + M
Sbjct:    1 MHLNNLEQQDWIRRRFEAPRVTELSHDQKKVLFKRLIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVIDSSSTLGVDSFVIGMPHRGRLNVLANVCRQPLATILSQF-STLEPADEGSGDVKYHLGVCIERLNRQSQKNVKIAVVANPSHLEAVDPVVMGKVRAEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNLDDLPSYTTHGAIHIVVNNQIGFTTDPRSSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPLMYQRIKQTKTALEKYQEKILNEGVANEQYVKEELTKYGSILEDAYENAQKVTYVRNRDWLDSPWDDFFKKRDPLKLPSTGIEQENIEQIIGKFSQYPEGFNLHRGLERTLKGRQQMLKDNSLDWACGEALAFGSLLKEGIHVRLSGQDVQRGTFSHRHHVLHDQKVDQKIYNPLNDLSEGQGEYTVCNSSLSEYAVLGFELGYSMVDPNSLVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLPHGYEGMGPEHSSARPERFLQMCNEDDEIDLEKIAFEGTFEAQQLHDTNWIVANCTTPANIYHLLRRQVTMPFRKPAVVFSPKSLLRHPMARSPVEDFQSGSNFQRVIPETGAPSQNPPDVKRVVFCTGKVYYDMVAARKHVGKENDVALVRVEQLSPFPYDLVQQECRKYQGAEILWAQEEHKNMGAWSFVQPRINSLLSI---DGRATK--YAGRLPSSSPATGNKFTHMQEQKEMM 786          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Celegans
Match: ogdh-2 (Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 homolog, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q23629])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 340/905 (37.57%), Postives = 502/905 (55.47%), Query Frame = 1
Query:  535 IIRSYQARGHNVSGLDPLGILS----ADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLE--PSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQY------YNKDKQGKKA----MSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGL-KRSLKEREQFI-SERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQA-EFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAA-VQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            +I +++  G+  + LDPLG+      A+LD +I        Y  +L++N +                       +L ++  +L + YC    +E+M IN+  +  WI + FE     +   EE   I   +++   F++FL+ K+   KR+G EG E +      + + +++  VE   IG+ HRGRLN+L  +   P   +F +   + E   S + +GDV  HL  S        N  + V +  NPSHLEAV+PV  GK  A  +      Y+ D++  +A    +++++HGD AF GQGVV+E+  LS  P +   GT+H+V NNQI FT +  V RSS +CTD+A+    P+ HVN D PE VV  +++A  +R  F KDV I+LVC+RR+GHNE+D+P FT P+MYK++ ++ +V   + ++L+ E   + +  +E+++K+ +       L K ++ +         W+GF      ++   TGV   +L+ IG     VPE+F+ H  L K  +  R Q + +    +WA  EA AFGS+L  G  VR+SGQDV RGTF HRH ++ DQ  D  +H+PLN L   Q  +  V+N+ LSE A+LGFE GFS  +P  L IWEAQFGDF N AQ IID F+AS +SKW+  SGL MLLPHG++G GPEHSS R+ERFLQ+ +  +D  P  GE        ++N  V N TT A  FH+LRRQV+ ++RKPLI + PK LLR P+A S+ +E    T ++ +I E    +   +K++KVI  SGK +  + K R+ R L+D +AI+RVE + PFP   L   L KY  A    W QEE +N GAW +V PR  N + V+L         + GRP  A  A      H  E  + + Q  +
Sbjct:   58 LINAFRRYGYLEADLDPLGLRKVESVAELDPAI--------YGLSLDENVK--------------------GNFSLHDLAEQLRHIYCGPTAIEFMHINNWEERQWISQNFENCIAEELRKEELLRIGDLMLKCENFDKFLSTKFPTLKRYGAEGAESMFAFFSELFEGAAEKQVEEIIIGIAHRGRLNLLTQLMDFPPVHMFRKIKGRAEFPESADAAGDVLSHLVSSFDYKGSEGN--VHVTMLPNPSHLEAVNPVAMGKARARAWSMNKGDYSPDERSARAGDSVLNVLVHGDGAFTGQGVVWESIALSQAPHFRLGGTVHLVTNNQIAFTAESSVGRSSTHCTDIAKAFEYPVIHVNGDHPEEVVKATRLALAYRERFRKDVFINLVCFRRWGHNELDDPTFTSPVMYKEVEARESVPRLFLDRLVEEGFTTEEAVKEQLQKHTEQLNNE--LKKVDSTVPIDISHRGRWEGFKQAPKAIESWDTGVATDLLRFIGAGSVKVPEDFDTHKHLYKMHIDSRMQKMQTGEGIDWATAEAMAFGSILLEGNDVRISGQDVGRGTFCHRHAMMVDQSTDH-IHIPLNELVEEQKNQLEVANNLLSEEAILGFEWGFSSENPRRLCIWEAQFGDFFNGAQIIIDTFLASAESKWLTSSGLTMLLPHGFDGAGPEHSSCRMERFLQLCDSREDQTPVDGE--------NVNMRVANPTTSAQYFHLLRRQVVPNYRKPLIVVGPKILLRHPKAASTINEFGPGTTYQNVISEEHATSS--QKIKKVIFVSGKHWINVEKARDERGLKDSVAIVRVEMLCPFPVVDLQAVLKKYPGAQDFVWSQEEPRNAGAWSFVRPRFENALGVRL--------KFAGRPELAWTATAIGEHHTKEAEEVINQTFA 911          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Celegans
Match: ogdh-2 (Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 homolog, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q23629])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 340/905 (37.57%), Postives = 502/905 (55.47%), Query Frame = 1
Query:  535 IIRSYQARGHNVSGLDPLGILS----ADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLE--PSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQY------YNKDKQGKKA----MSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGL-KRSLKEREQFI-SERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQA-EFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAA-VQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            +I +++  G+  + LDPLG+      A+LD +I        Y  +L++N +                       +L ++  +L + YC    +E+M IN+  +  WI + FE     +   EE   I   +++   F++FL+ K+   KR+G EG E +      + + +++  VE   IG+ HRGRLN+L  +   P   +F +   + E   S + +GDV  HL  S        N  + V +  NPSHLEAV+PV  GK  A  +      Y+ D++  +A    +++++HGD AF GQGVV+E+  LS  P +   GT+H+V NNQI FT +  V RSS +CTD+A+    P+ HVN D PE VV  +++A  +R  F KDV I+LVC+RR+GHNE+D+P FT P+MYK++ ++ +V   + ++L+ E   + +  +E+++K+ +       L K ++ +         W+GF      ++   TGV   +L+ IG     VPE+F+ H  L K  +  R Q + +    +WA  EA AFGS+L  G  VR+SGQDV RGTF HRH ++ DQ  D  +H+PLN L   Q  +  V+N+ LSE A+LGFE GFS  +P  L IWEAQFGDF N AQ IID F+AS +SKW+  SGL MLLPHG++G GPEHSS R+ERFLQ+ +  +D  P  GE        ++N  V N TT A  FH+LRRQV+ ++RKPLI + PK LLR P+A S+ +E    T ++ +I E    +   +K++KVI  SGK +  + K R+ R L+D +AI+RVE + PFP   L   L KY  A    W QEE +N GAW +V PR  N + V+L         + GRP  A  A      H  E  + + Q  +
Sbjct:   58 LINAFRRYGYLEADLDPLGLRKVESVAELDPAI--------YGLSLDENVK--------------------GNFSLHDLAEQLRHIYCGPTAIEFMHINNWEERQWISQNFENCIAEELRKEELLRIGDLMLKCENFDKFLSTKFPTLKRYGAEGAESMFAFFSELFEGAAEKQVEEIIIGIAHRGRLNLLTQLMDFPPVHMFRKIKGRAEFPESADAAGDVLSHLVSSFDYKGSEGN--VHVTMLPNPSHLEAVNPVAMGKARARAWSMNKGDYSPDERSARAGDSVLNVLVHGDGAFTGQGVVWESIALSQAPHFRLGGTVHLVTNNQIAFTAESSVGRSSTHCTDIAKAFEYPVIHVNGDHPEEVVKATRLALAYRERFRKDVFINLVCFRRWGHNELDDPTFTSPVMYKEVEARESVPRLFLDRLVEEGFTTEEAVKEQLQKHTEQLNNE--LKKVDSTVPIDISHRGRWEGFKQAPKAIESWDTGVATDLLRFIGAGSVKVPEDFDTHKHLYKMHIDSRMQKMQTGEGIDWATAEAMAFGSILLEGNDVRISGQDVGRGTFCHRHAMMVDQSTDH-IHIPLNELVEEQKNQLEVANNLLSEEAILGFEWGFSSENPRRLCIWEAQFGDFFNGAQIIIDTFLASAESKWLTSSGLTMLLPHGFDGAGPEHSSCRMERFLQLCDSREDQTPVDGE--------NVNMRVANPTTSAQYFHLLRRQVVPNYRKPLIVVGPKILLRHPKAASTINEFGPGTTYQNVISEEHATSS--QKIKKVIFVSGKHWINVEKARDERGLKDSVAIVRVEMLCPFPVVDLQAVLKKYPGAQDFVWSQEEPRNAGAWSFVRPRFENALGVRL--------KFAGRPELAWTATAIGEHHTKEAEEVINQTFA 911          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Fly
Match: Nc73EF (gene:FBgn0010352 transcript:FBtr0075267)

HSP 1 Score: 1233.39 bits (3190), Expect = 0.000e+0
Identity = 602/1015 (59.31%), Postives = 741/1015 (73.00%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFM----YSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSAD---LDDSIPK---ELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPEN---FNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIST 3192
            +SA+AE F NG ++ Y+EEMYN+WL +P SVH                SW+ YF   S        +  PPN       +LP   +              ++     D  TI++HLAVQAIIRSYQ+RGH  S LDPLGIL+ +     D + +   E  L+ ++  L   F E  +D+ F+LP+TT IGG    L L+EI++RLEN YC  IGVE+MFIN L +C+WIR++FETPG++ FS EEKRLI+ARL R+T FE FLAKK+S+EKRFGLEGCE++IP++K +ID S++LGVES  +GMPHRGRLN LANVCRKPL Q+F QF + LE +D+GSGDVKYHLG   +R+NR+ NK I++AV ANPSHLEAVDPV+QGKT AEQ+Y  D++GKK MSI++HGDAAFCGQGVV+ET HLSDLP Y+T GTIH+V NNQIGFTTDPR +RSSPYCTDVARV NAPIFHVNADDPEAV++V KVAAEWR  F KD VIDLV YRR GHNE+DEPMFTQPLMY+KI      L+ Y +KLI E  V++++ +    KY+ ICEEA+ LAK ET ++ ++WLDSPW GFF+ KDP+K+  TGV E  L HIG   SS P N   F IH GL R L  R+  + E++A+WALGEA AFGSLLK GIHVRLSGQDVERGTFSHRH VLH Q  D   +  L ++Y  QA +SVSNSSLSEYAVLGFE G+S T+PN+LV+WEAQFGDF+NTAQ IIDQFI+SGQSKWVRQSGLVMLLPHG EGMGPEHSS R+ERFLQMS+DD DY PP  + F V+QLHDINW V NC+TPAN +H+LRRQ+ L FRKPLI  TPKSLLR PEAKS F EM   ++F+R+IP+ G A +NP  V+KV+ CSG+VYY+L K R  + L+  IAI+RVEQISPFP+DL+ E+ N Y  A + W QEEHKN G+W YV+PR    +     NH +  +SYVGR   A+ A G+K  H+ E++  +  AIST
Sbjct:   46 NSAAAEPFANGSTASYVEEMYNAWLRDPTSVHT---------------SWDAYFRSNS--------YVSPPNLAPVQANTLPLTAF----------NFGGAVAGAAPDSKTIDDHLAVQAIIRSYQSRGHLASDLDPLGILTREKTVCKDGLARRANEDVLRQHSGFL---FGEQDMDRQFKLPSTTFIGGDEASLPLKEILNRLENVYCNKIGVEFMFINSLEQCNWIRKRFETPGVLNFSPEEKRLILARLTRATGFEAFLAKKYSSEKRFGLEGCEIMIPALKEIIDVSTELGVESVIMGMPHRGRLNTLANVCRKPLNQIFTQF-AGLEAADDGSGDVKYHLGTYIERLNRVTNKNIRLAVVANPSHLEAVDPVVQGKTRAEQFYRGDQEGKKVMSILIHGDAAFCGQGVVYETMHLSDLPDYTTHGTIHVVANNQIGFTTDPRFSRSSPYCTDVARVVNAPIFHVNADDPEAVMHVCKVAAEWRATFHKDCVIDLVGYRRNGHNEIDEPMFTQPLMYQKIRKHKNCLDLYADKLIAEGTVTAEEVKSVAAKYENICEEAFALAKTETHVKYKDWLDSPWSGFFEGKDPLKVAPTGVKEETLIHIGNRFSSPPPNAAEFVIHKGLLRVLAARKAMVDEKVADWALGEAMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQLVDKATYNSLQHMYPDQAPYSVSNSSLSEYAVLGFEHGYSMTNPNALVLWEAQFGDFSNTAQSIIDQFISSGQSKWVRQSGLVMLLPHGMEGMGPEHSSCRVERFLQMSSDDPDYFPPESDEFGVRQLHDINWIVANCSTPANYYHILRRQIALPFRKPLILCTPKSLLRHPEAKSPFSEMSEGSEFQRIIPDNGPAGQNPSNVKKVVFCSGRVYYDLTKTRREKQLEGEIAIVRVEQISPFPFDLVKEQANLYKNAELVWAQEEHKNQGSWTYVQPRFLTAL-----NHSR-DVSYVGRACGASTATGSKAQHIRELNALLNDAIST 1017          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Fly
Match: Nc73EF (gene:FBgn0010352 transcript:FBtr0075269)

HSP 1 Score: 1233.39 bits (3190), Expect = 0.000e+0
Identity = 602/1015 (59.31%), Postives = 741/1015 (73.00%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFM----YSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSAD---LDDSIPK---ELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPEN---FNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIST 3192
            +SA+AE F NG ++ Y+EEMYN+WL +P SVH                SW+ YF   S        +  PPN       +LP   +              ++     D  TI++HLAVQAIIRSYQ+RGH  S LDPLGIL+ +     D + +   E  L+ ++  L   F E  +D+ F+LP+TT IGG    L L+EI++RLEN YC  IGVE+MFIN L +C+WIR++FETPG++ FS EEKRLI+ARL R+T FE FLAKK+S+EKRFGLEGCE++IP++K +ID S++LGVES  +GMPHRGRLN LANVCRKPL Q+F QF + LE +D+GSGDVKYHLG   +R+NR+ NK I++AV ANPSHLEAVDPV+QGKT AEQ+Y  D++GKK MSI++HGDAAFCGQGVV+ET HLSDLP Y+T GTIH+V NNQIGFTTDPR +RSSPYCTDVARV NAPIFHVNADDPEAV++V KVAAEWR  F KD VIDLV YRR GHNE+DEPMFTQPLMY+KI      L+ Y +KLI E  V++++ +    KY+ ICEEA+ LAK ET ++ ++WLDSPW GFF+ KDP+K+  TGV E  L HIG   SS P N   F IH GL R L  R+  + E++A+WALGEA AFGSLLK GIHVRLSGQDVERGTFSHRH VLH Q  D   +  L ++Y  QA +SVSNSSLSEYAVLGFE G+S T+PN+LV+WEAQFGDF+NTAQ IIDQFI+SGQSKWVRQSGLVMLLPHG EGMGPEHSS R+ERFLQMS+DD DY PP  + F V+QLHDINW V NC+TPAN +H+LRRQ+ L FRKPLI  TPKSLLR PEAKS F EM   ++F+R+IP+ G A +NP  V+KV+ CSG+VYY+L K R  + L+  IAI+RVEQISPFP+DL+ E+ N Y  A + W QEEHKN G+W YV+PR    +     NH +  +SYVGR   A+ A G+K  H+ E++  +  AIST
Sbjct:   46 NSAAAEPFANGSTASYVEEMYNAWLRDPTSVHT---------------SWDAYFRSNS--------YVSPPNLAPVQANTLPLTAF----------NFGGAVAGAAPDSKTIDDHLAVQAIIRSYQSRGHLASDLDPLGILTREKTVCKDGLARRANEDVLRQHSGFL---FGEQDMDRQFKLPSTTFIGGDEASLPLKEILNRLENVYCNKIGVEFMFINSLEQCNWIRKRFETPGVLNFSPEEKRLILARLTRATGFEAFLAKKYSSEKRFGLEGCEIMIPALKEIIDVSTELGVESVIMGMPHRGRLNTLANVCRKPLNQIFTQF-AGLEAADDGSGDVKYHLGTYIERLNRVTNKNIRLAVVANPSHLEAVDPVVQGKTRAEQFYRGDQEGKKVMSILIHGDAAFCGQGVVYETMHLSDLPDYTTHGTIHVVANNQIGFTTDPRFSRSSPYCTDVARVVNAPIFHVNADDPEAVMHVCKVAAEWRATFHKDCVIDLVGYRRNGHNEIDEPMFTQPLMYQKIRKHKNCLDLYADKLIAEGTVTAEEVKSVAAKYENICEEAFALAKTETHVKYKDWLDSPWSGFFEGKDPLKVAPTGVKEETLIHIGNRFSSPPPNAAEFVIHKGLLRVLAARKAMVDEKVADWALGEAMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQLVDKATYNSLQHMYPDQAPYSVSNSSLSEYAVLGFEHGYSMTNPNALVLWEAQFGDFSNTAQSIIDQFISSGQSKWVRQSGLVMLLPHGMEGMGPEHSSCRVERFLQMSSDDPDYFPPESDEFGVRQLHDINWIVANCSTPANYYHILRRQIALPFRKPLILCTPKSLLRHPEAKSPFSEMSEGSEFQRIIPDNGPAGQNPSNVKKVVFCSGRVYYDLTKTRREKQLEGEIAIVRVEQISPFPFDLVKEQANLYKNAELVWAQEEHKNQGSWTYVQPRFLTAL-----NHSR-DVSYVGRACGASTATGSKAQHIRELNALLNDAIST 1017          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Fly
Match: Nc73EF (gene:FBgn0010352 transcript:FBtr0075266)

HSP 1 Score: 1233.01 bits (3189), Expect = 0.000e+0
Identity = 601/1010 (59.50%), Postives = 740/1010 (73.27%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFM----YSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADL-DDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPEN---FNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIST 3192
            +SA+AE F NG ++ Y+EEMYN+WL +P SVH                SW+ YF   S        +  PPN       +LP   +              ++     D  TI++HLAVQAIIRSYQ RGHN++ LDPL I + +L  +S  K +   + NF+    F E  +D+ F+LP+TT IGG    L L+EI++RLEN YC  IGVE+MFIN L +C+WIR++FETPG++ FS EEKRLI+ARL R+T FE FLAKK+S+EKRFGLEGCE++IP++K +ID S++LGVES  +GMPHRGRLN LANVCRKPL Q+F QF + LE +D+GSGDVKYHLG   +R+NR+ NK I++AV ANPSHLEAVDPV+QGKT AEQ+Y  D++GKK MSI++HGDAAFCGQGVV+ET HLSDLP Y+T GTIH+V NNQIGFTTDPR +RSSPYCTDVARV NAPIFHVNADDPEAV++V KVAAEWR  F KD VIDLV YRR GHNE+DEPMFTQPLMY+KI      L+ Y +KLI E  V++++ +    KY+ ICEEA+ LAK ET ++ ++WLDSPW GFF+ KDP+K+  TGV E  L HIG   SS P N   F IH GL R L  R+  + E++A+WALGEA AFGSLLK GIHVRLSGQDVERGTFSHRH VLH Q  D   +  L ++Y  QA +SVSNSSLSEYAVLGFE G+S T+PN+LV+WEAQFGDF+NTAQ IIDQFI+SGQSKWVRQSGLVMLLPHG EGMGPEHSS R+ERFLQMS+DD DY PP  + F V+QLHDINW V NC+TPAN +H+LRRQ+ L FRKPLI  TPKSLLR PEAKS F EM   ++F+R+IP+ G A +NP  V+KV+ CSG+VYY+L K R  + L+  IAI+RVEQISPFP+DL+ E+ N Y  A + W QEEHKN G+W YV+PR    +     NH +  +SYVGR   A+ A G+K  H+ E++  +  AIST
Sbjct:   46 NSAAAEPFANGSTASYVEEMYNAWLRDPTSVHT---------------SWDAYFRSNS--------YVSPPNLAPVQANTLPLTAF----------NFGGAVAGAAPDSKTIDDHLAVQAIIRSYQIRGHNIAHLDPLEINTPELPGNSSTKSI---YANFS----FGEQDMDRQFKLPSTTFIGGDEASLPLKEILNRLENVYCNKIGVEFMFINSLEQCNWIRKRFETPGVLNFSPEEKRLILARLTRATGFEAFLAKKYSSEKRFGLEGCEIMIPALKEIIDVSTELGVESVIMGMPHRGRLNTLANVCRKPLNQIFTQF-AGLEAADDGSGDVKYHLGTYIERLNRVTNKNIRLAVVANPSHLEAVDPVVQGKTRAEQFYRGDQEGKKVMSILIHGDAAFCGQGVVYETMHLSDLPDYTTHGTIHVVANNQIGFTTDPRFSRSSPYCTDVARVVNAPIFHVNADDPEAVMHVCKVAAEWRATFHKDCVIDLVGYRRNGHNEIDEPMFTQPLMYQKIRKHKNCLDLYADKLIAEGTVTAEEVKSVAAKYENICEEAFALAKTETHVKYKDWLDSPWSGFFEGKDPLKVAPTGVKEETLIHIGNRFSSPPPNAAEFVIHKGLLRVLAARKAMVDEKVADWALGEAMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQLVDKATYNSLQHMYPDQAPYSVSNSSLSEYAVLGFEHGYSMTNPNALVLWEAQFGDFSNTAQSIIDQFISSGQSKWVRQSGLVMLLPHGMEGMGPEHSSCRVERFLQMSSDDPDYFPPESDEFGVRQLHDINWIVANCSTPANYYHILRRQIALPFRKPLILCTPKSLLRHPEAKSPFSEMSEGSEFQRIIPDNGPAGQNPSNVKKVVFCSGRVYYDLTKTRREKQLEGEIAIVRVEQISPFPFDLVKEQANLYKNAELVWAQEEHKNQGSWTYVQPRFLTAL-----NHSR-DVSYVGRACGASTATGSKAQHIRELNALLNDAIST 1008          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Fly
Match: Nc73EF (gene:FBgn0010352 transcript:FBtr0075268)

HSP 1 Score: 1233.01 bits (3189), Expect = 0.000e+0
Identity = 601/1010 (59.50%), Postives = 740/1010 (73.27%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFM----YSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADL-DDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPEN---FNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIST 3192
            +SA+AE F NG ++ Y+EEMYN+WL +P SVH                SW+ YF   S        +  PPN       +LP   +              ++     D  TI++HLAVQAIIRSYQ RGHN++ LDPL I + +L  +S  K +   + NF+    F E  +D+ F+LP+TT IGG    L L+EI++RLEN YC  IGVE+MFIN L +C+WIR++FETPG++ FS EEKRLI+ARL R+T FE FLAKK+S+EKRFGLEGCE++IP++K +ID S++LGVES  +GMPHRGRLN LANVCRKPL Q+F QF + LE +D+GSGDVKYHLG   +R+NR+ NK I++AV ANPSHLEAVDPV+QGKT AEQ+Y  D++GKK MSI++HGDAAFCGQGVV+ET HLSDLP Y+T GTIH+V NNQIGFTTDPR +RSSPYCTDVARV NAPIFHVNADDPEAV++V KVAAEWR  F KD VIDLV YRR GHNE+DEPMFTQPLMY+KI      L+ Y +KLI E  V++++ +    KY+ ICEEA+ LAK ET ++ ++WLDSPW GFF+ KDP+K+  TGV E  L HIG   SS P N   F IH GL R L  R+  + E++A+WALGEA AFGSLLK GIHVRLSGQDVERGTFSHRH VLH Q  D   +  L ++Y  QA +SVSNSSLSEYAVLGFE G+S T+PN+LV+WEAQFGDF+NTAQ IIDQFI+SGQSKWVRQSGLVMLLPHG EGMGPEHSS R+ERFLQMS+DD DY PP  + F V+QLHDINW V NC+TPAN +H+LRRQ+ L FRKPLI  TPKSLLR PEAKS F EM   ++F+R+IP+ G A +NP  V+KV+ CSG+VYY+L K R  + L+  IAI+RVEQISPFP+DL+ E+ N Y  A + W QEEHKN G+W YV+PR    +     NH +  +SYVGR   A+ A G+K  H+ E++  +  AIST
Sbjct:   46 NSAAAEPFANGSTASYVEEMYNAWLRDPTSVHT---------------SWDAYFRSNS--------YVSPPNLAPVQANTLPLTAF----------NFGGAVAGAAPDSKTIDDHLAVQAIIRSYQIRGHNIAHLDPLEINTPELPGNSSTKSI---YANFS----FGEQDMDRQFKLPSTTFIGGDEASLPLKEILNRLENVYCNKIGVEFMFINSLEQCNWIRKRFETPGVLNFSPEEKRLILARLTRATGFEAFLAKKYSSEKRFGLEGCEIMIPALKEIIDVSTELGVESVIMGMPHRGRLNTLANVCRKPLNQIFTQF-AGLEAADDGSGDVKYHLGTYIERLNRVTNKNIRLAVVANPSHLEAVDPVVQGKTRAEQFYRGDQEGKKVMSILIHGDAAFCGQGVVYETMHLSDLPDYTTHGTIHVVANNQIGFTTDPRFSRSSPYCTDVARVVNAPIFHVNADDPEAVMHVCKVAAEWRATFHKDCVIDLVGYRRNGHNEIDEPMFTQPLMYQKIRKHKNCLDLYADKLIAEGTVTAEEVKSVAAKYENICEEAFALAKTETHVKYKDWLDSPWSGFFEGKDPLKVAPTGVKEETLIHIGNRFSSPPPNAAEFVIHKGLLRVLAARKAMVDEKVADWALGEAMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQLVDKATYNSLQHMYPDQAPYSVSNSSLSEYAVLGFEHGYSMTNPNALVLWEAQFGDFSNTAQSIIDQFISSGQSKWVRQSGLVMLLPHGMEGMGPEHSSCRVERFLQMSSDDPDYFPPESDEFGVRQLHDINWIVANCSTPANYYHILRRQIALPFRKPLILCTPKSLLRHPEAKSPFSEMSEGSEFQRIIPDNGPAGQNPSNVKKVVFCSGRVYYDLTKTRREKQLEGEIAIVRVEQISPFPFDLVKEQANLYKNAELVWAQEEHKNQGSWTYVQPRFLTAL-----NHSR-DVSYVGRACGASTATGSKAQHIRELNALLNDAIST 1008          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Fly
Match: Nc73EF (gene:FBgn0010352 transcript:FBtr0075264)

HSP 1 Score: 1233.01 bits (3189), Expect = 0.000e+0
Identity = 601/1010 (59.50%), Postives = 740/1010 (73.27%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFM----YSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADL-DDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPEN---FNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIST 3192
            +SA+AE F NG ++ Y+EEMYN+WL +P SVH                SW+ YF   S        +  PPN       +LP   +              ++     D  TI++HLAVQAIIRSYQ RGHN++ LDPL I + +L  +S  K +   + NF+    F E  +D+ F+LP+TT IGG    L L+EI++RLEN YC  IGVE+MFIN L +C+WIR++FETPG++ FS EEKRLI+ARL R+T FE FLAKK+S+EKRFGLEGCE++IP++K +ID S++LGVES  +GMPHRGRLN LANVCRKPL Q+F QF + LE +D+GSGDVKYHLG   +R+NR+ NK I++AV ANPSHLEAVDPV+QGKT AEQ+Y  D++GKK MSI++HGDAAFCGQGVV+ET HLSDLP Y+T GTIH+V NNQIGFTTDPR +RSSPYCTDVARV NAPIFHVNADDPEAV++V KVAAEWR  F KD VIDLV YRR GHNE+DEPMFTQPLMY+KI      L+ Y +KLI E  V++++ +    KY+ ICEEA+ LAK ET ++ ++WLDSPW GFF+ KDP+K+  TGV E  L HIG   SS P N   F IH GL R L  R+  + E++A+WALGEA AFGSLLK GIHVRLSGQDVERGTFSHRH VLH Q  D   +  L ++Y  QA +SVSNSSLSEYAVLGFE G+S T+PN+LV+WEAQFGDF+NTAQ IIDQFI+SGQSKWVRQSGLVMLLPHG EGMGPEHSS R+ERFLQMS+DD DY PP  + F V+QLHDINW V NC+TPAN +H+LRRQ+ L FRKPLI  TPKSLLR PEAKS F EM   ++F+R+IP+ G A +NP  V+KV+ CSG+VYY+L K R  + L+  IAI+RVEQISPFP+DL+ E+ N Y  A + W QEEHKN G+W YV+PR    +     NH +  +SYVGR   A+ A G+K  H+ E++  +  AIST
Sbjct:   46 NSAAAEPFANGSTASYVEEMYNAWLRDPTSVHT---------------SWDAYFRSNS--------YVSPPNLAPVQANTLPLTAF----------NFGGAVAGAAPDSKTIDDHLAVQAIIRSYQIRGHNIAHLDPLEINTPELPGNSSTKSI---YANFS----FGEQDMDRQFKLPSTTFIGGDEASLPLKEILNRLENVYCNKIGVEFMFINSLEQCNWIRKRFETPGVLNFSPEEKRLILARLTRATGFEAFLAKKYSSEKRFGLEGCEIMIPALKEIIDVSTELGVESVIMGMPHRGRLNTLANVCRKPLNQIFTQF-AGLEAADDGSGDVKYHLGTYIERLNRVTNKNIRLAVVANPSHLEAVDPVVQGKTRAEQFYRGDQEGKKVMSILIHGDAAFCGQGVVYETMHLSDLPDYTTHGTIHVVANNQIGFTTDPRFSRSSPYCTDVARVVNAPIFHVNADDPEAVMHVCKVAAEWRATFHKDCVIDLVGYRRNGHNEIDEPMFTQPLMYQKIRKHKNCLDLYADKLIAEGTVTAEEVKSVAAKYENICEEAFALAKTETHVKYKDWLDSPWSGFFEGKDPLKVAPTGVKEETLIHIGNRFSSPPPNAAEFVIHKGLLRVLAARKAMVDEKVADWALGEAMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQLVDKATYNSLQHMYPDQAPYSVSNSSLSEYAVLGFEHGYSMTNPNALVLWEAQFGDFSNTAQSIIDQFISSGQSKWVRQSGLVMLLPHGMEGMGPEHSSCRVERFLQMSSDDPDYFPPESDEFGVRQLHDINWIVANCSTPANYYHILRRQIALPFRKPLILCTPKSLLRHPEAKSPFSEMSEGSEFQRIIPDNGPAGQNPSNVKKVVFCSGRVYYDLTKTRREKQLEGEIAIVRVEQISPFPFDLVKEQANLYKNAELVWAQEEHKNQGSWTYVQPRFLTAL-----NHSR-DVSYVGRACGASTATGSKAQHIRELNALLNDAIST 1008          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Zebrafish
Match: ogdhb (oxoglutarate (alpha-ketoglutarate) dehydrogenase b (lipoamide) [Source:ZFIN;Acc:ZDB-GENE-090311-8])

HSP 1 Score: 1269.6 bits (3284), Expect = 0.000e+0
Identity = 622/1051 (59.18%), Postives = 756/1051 (71.93%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKN--------------SVKNSSA--SAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAF-SPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD---NKDPMKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            M+++R  A + R L ++     F                 ++N +A  +AE FLNG SS Y+EEMY +WLE+P SVHK               SW+++F   + G A G A+ S PP  +  L + Q                       +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P ++              E  LDKVFRLPTTT IGG    L LREIIHRLE AYC+HIGVE+MFINDL +C WIR+KFE PG+M+F+ +EKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GVE+  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+  + I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D  G + MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GTIH+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLV YRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E  V+ Q+Y+EEI KYDKICEEAY  +K E  +  + WLDSPW GFF        M  P TG+ E  L HIG+  SSVP E+F IH GL R LK R   +  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N +   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   E F V+QL+D NW VVNC+TPAN FHVLRRQ+LL FRKPLI  TPKSLLR PEAKSSF+EM+  T F RLIPE G A+++   V+ +I C+GKV+Y+L +ER+ R L++R+AI R+EQ+SPFP+DL+  E  KY  A + W QEEHKN G + YV+PR++  +     N+ +P + YVGR P+AA A GNK  HL+E+ +F+  A +
Sbjct:    1 MHRLRTCAARLRPLTASQNAASFSQHRPAVVHGARRTFQPIRNYTAPVTAEPFLNGTSSNYLEEMYYAWLEDPKSVHK---------------SWDIFFRNANAGVAPGSAYQSVPPMGLSGLSQSQALIGAQPNV--------------EKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSCVPADIITSSDKLGF-YGLEETDLDKVFRLPTTTFIGGSETALPLREIIHRLEMAYCQHIGVEFMFINDLEQCQWIRQKFEKPGVMQFTLDEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDKSSENGVENVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTERQITLSLVANPSHLEAVDPVVQGKTKAEQFYCGDTDGNRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTIHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVSYRRNGHNEMDEPMFTQPLMYKQIKKQKPVLQKYAEKLIAEGAVTRQEYEEEISKYDKICEEAYNRSKDEKIMHIKHWLDSPWPGFFTLDGQPKTMSCPSTGLSEETLAHIGQTASSVPVEDFTIHGGLSRILKSRSLMVQNRSVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNYMDPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVFPKITEDFAVRQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFEEMLPGTHFSRLIPEQGSASQSAAGVQHLIFCTGKVFYDLQRERKSRGLEERVAISRIEQLSPFPFDLVKAEAEKYPHAHLLWCQEEHKNQGYYDYVKPRISTTL-----NNTRP-VWYVGRDPAAAPATGNKKAHLLELQRFLDTAFN 1015          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Zebrafish
Match: ogdhl (oxoglutarate dehydrogenase like [Source:ZFIN;Acc:ZDB-GENE-111201-4])

HSP 1 Score: 1268.83 bits (3282), Expect = 0.000e+0
Identity = 623/1025 (60.78%), Postives = 758/1025 (73.95%), Query Frame = 1
Query:  154 GFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTL---KHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*ND 3207
            G  +F      SS   E  L   SS Y+ EMY +WLE+  +VH               +SW+ YF      ++V     P    +      Q                     + +  +E+HLAV  +IR+YQ RGH+V+ LDPLGIL+ADLD  +P +L     K  ++ LE    E  LDK F+LP TT IGG    L LREIIHRLE +YC H GVE+MFIN++ +C WIR+KFETPGIMKFS  EKR ++ARL+RSTRFE+FLA+KWS+EKRFGLEGCEVLIP++K +ID SS+ G+ES  +GMPHRGRLNVLANV RK L+Q+FCQFD KLE +DEGSGDVKYHLGM H+RINR  +K I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D +G++ MSI++HGDAAF GQGVV+ETFHLS+LPSY+T GTIH+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV K+AAEWR  F+KDVVIDLVCYRRFGHNEMDEPMFTQPLMYK+I  Q  VL +Y +KLI+E VV+ Q+++EE+ KYDKICEEAY  +K E  +  R WLDSPW  FF  + +P  M  P TG+ E VL+HIG+V SSVP ++F IHSGL R L+ R   I++RMA+WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELGF+  +PN+LV WEAQFGDF+NTAQCIIDQFI++GQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMS DD D  P +   FEVQQL+D NW VVNC+TPA+ FHVLRRQ+LL FRKPLI  TPKSLLRLPEA+SSFDEM+  TKF R+IP+ G A++NPEKV++VI C+GKVYYEL KER++  L++ +AI+R+EQISPFP+DL+  E+ KYS A + W QEEHKNMG + Y+ PR        L    K  I YVGR P+AA A GNKF HL E+ +F+  A +  +  D
Sbjct:   25 GKRVFDLRRNCSSGVTEPSLAACSSSYVVEMYYAWLEDHKNVH---------------ESWDAYFRNAEASSSVESGEKPLSMLLQGRTMSQT------------------PAMSEKVVEDHLAVHTLIRAYQVRGHHVARLDPLGILTADLDSFVPSDLITSIDKLASYGLE----ESDLDKSFQLPLTTFIGGNENTLPLREIIHRLETSYCGHTGVEFMFINNMEQCQWIRQKFETPGIMKFSAREKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVLIPALKMIIDKSSEAGIESVIMGMPHRGRLNVLANVVRKDLDQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRETDKNITLSLMANPSHLEAVDPVVQGKTKAEQFYRGDTEGRRVMSILMHGDAAFAGQGVVYETFHLSELPSYTTYGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCKIAAEWRTTFNKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKQIRKQEHVLKKYADKLISEGVVTLQEFEEEVAKYDKICEEAYTSSKDEKILHIRHWLDSPWPDFFKPDGEPKSMSCPSTGLSEEVLKHIGEVASSVPLKDFAIHSGLSRILRGRADMITKRMADWALAEYMAFGSLLKDGIHVRLSGQDVERGTFSHRHHVLHDQEVDKRFCVPMNHLWQNQALYTVCNSSLSEYGVLGFELGFAMANPNALVCWEAQFGDFHNTAQCIIDQFISAGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSKDDPDRYPEYTGDFEVQQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPLIIFTPKSLLRLPEARSSFDEMVTGTKFIRVIPDDGPASKNPEKVKRVIFCTGKVYYELAKERKQLKLEENVAIVRLEQISPFPFDLIKAEVEKYSNAELIWCQEEHKNMGYYDYIRPRF-------LTVQPKNPIWYVGRDPAAAPATGNKFTHLAELKRFLDTAFNLEAFQD 1005          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Zebrafish
Match: ogdha (oxoglutarate (alpha-ketoglutarate) dehydrogenase a (lipoamide) [Source:ZFIN;Acc:ZDB-GENE-030131-2143])

HSP 1 Score: 1267.29 bits (3278), Expect = 0.000e+0
Identity = 609/1006 (60.54%), Postives = 749/1006 (74.45%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDPMKI--PITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            +S  +AE FLNG SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  PP    SL             +    S +  +   +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGI+ ADLD  +P ++              E  LDKVFRLPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL++C WIR+KFE PG+M+FS EEKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GV++  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAV+PV+QGKT AEQ+Y+ D  GK+ MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E  V+ Q+Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  I  P TG+ E  L  IG+V SSVP E+F IH GL R LK R   I  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D  + +P+N++   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D+ P   + F+V+QL+D NW VVNC+ PAN FHV+RRQ+LL FRKPLI  TPKSLLR PEAKS+FD+M+  T F+R+I + G   +NP +V++++ C+GK+YYEL +ER+ R++++ +AI R+EQ+SPFP+DL+  E  K+  A + W QEEHKN G + YV+PR+   I     N  KP + Y GR P+AA A GNK  HL+E+ +F+  A +
Sbjct:   42 SSPVAAEPFLNGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGAPPGTAYQSPPPLGVSL-----------AGLAQAQSLVGAQPNVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSCVPTDIITSSDKLGF-YGLEESDLDKVFRLPTTTFIGGDESALPLREIIRRLEMAYCQHIGVEFMFINDLDQCQWIRQKFERPGVMQFSLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDKSSENGVDTVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTNRNITLSLVANPSHLEAVNPVVQGKTKAEQFYSGDTDGKRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIKKQKGVLQKYAEKLIAEGAVTRQEYEEEIAKYDKICEEAHSRSKDEKILHIKHWLDSPWPGFFTLDGQPKSISCPSTGLPEEELAQIGQVASSVPVEDFTIHGGLSRILKGRGDMIKNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRICIPMNHMSPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDFNPKITDDFDVRQLYDCNWIVVNCSNPANYFHVIRRQILLPFRKPLIVFTPKSLLRHPEAKSNFDQMLPGTHFQRVITDDGPPAQNPSEVKRIVFCTGKIYYELTRERKARNMENSVAITRIEQLSPFPFDLVRAETEKFPNADLVWCQEEHKNQGYYDYVKPRMRTTI-----NRTKP-VWYAGREPAAAPATGNKNTHLLELKRFLDTAFN 1014          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Zebrafish
Match: ogdha (oxoglutarate (alpha-ketoglutarate) dehydrogenase a (lipoamide) [Source:ZFIN;Acc:ZDB-GENE-030131-2143])

HSP 1 Score: 1263.06 bits (3267), Expect = 0.000e+0
Identity = 607/1006 (60.34%), Postives = 748/1006 (74.35%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDPMKI--PITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            +S  +AE FLNG SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  PP    SL             +    S +  +   +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGI+ ADLD  +P ++              E  LDKVFRLPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL++C WIR+KFE PG+M+FS EEKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GV++  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAV+PV+QGKT AEQ+Y+ D  GK+ MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E  V+ Q+Y+ +I KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  I  P TG+ E  L  IG+V SSVP E+F IH GL R LK R   I  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D  + +P+N++   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D+ P   + F+V+QL+D NW VVNC+ PAN FHV+RRQ+LL FRKPLI  TPKSLLR PEAKS+FD+M+  T F+R+I + G   +NP +V++++ C+GK+YYEL +ER+ R++++ +AI R+EQ+SPFP+DL+  E  K+  A + W QEEHKN G + YV+PR+   I     N  KP + Y GR P+AA A GNK  HL+E+ +F+  A +
Sbjct:   42 SSPVAAEPFLNGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGAPPGTAYQSPPPLGVSL-----------AGLAQAQSLVGAQPNVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSCVPTDIITSSDKLGF-YGLEESDLDKVFRLPTTTFIGGDESALPLREIIRRLEMAYCQHIGVEFMFINDLDQCQWIRQKFERPGVMQFSLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDKSSENGVDTVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTNRNITLSLVANPSHLEAVNPVVQGKTKAEQFYSGDTDGKRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIKKQKGVLQKYAEKLIAEGAVTRQEYEVQIAKYDKICEEAHSRSKDEKILHIKHWLDSPWPGFFTLDGQPKSISCPSTGLPEEELAQIGQVASSVPVEDFTIHGGLSRILKGRGDMIKNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRICIPMNHMSPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDFNPKITDDFDVRQLYDCNWIVVNCSNPANYFHVIRRQILLPFRKPLIVFTPKSLLRHPEAKSNFDQMLPGTHFQRVITDDGPPAQNPSEVKRIVFCTGKIYYELTRERKARNMENSVAITRIEQLSPFPFDLVRAETEKFPNADLVWCQEEHKNQGYYDYVKPRMRTTI-----NRTKP-VWYAGREPAAAPATGNKNTHLLELKRFLDTAFN 1014          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Zebrafish
Match: ogdha (oxoglutarate (alpha-ketoglutarate) dehydrogenase a (lipoamide) [Source:ZFIN;Acc:ZDB-GENE-030131-2143])

HSP 1 Score: 1253.43 bits (3242), Expect = 0.000e+0
Identity = 606/1006 (60.24%), Postives = 746/1006 (74.16%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDPMKI--PITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            +S  +AE FLNG SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  PP    SL             +    S +  +   +  +E+HLAVQ++IR+YQ  GH+ + LDPLGI   + D++ P     +H  F       E  LDKVFRLPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL++C WIR+KFE PG+M+FS EEKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GV++  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAV+PV+QGKT AEQ+Y+ D  GK+ MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E  V+ Q+Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  I  P TG+ E  L  IG+V SSVP E+F IH GL R LK R   I  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D  + +P+N++   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D+ P   + F+V+QL+D NW VVNC+ PAN FHV+RRQ+LL FRKPLI  TPKSLLR PEAKS+FD+M+  T F+R+I + G   +NP +V++++ C+GK+YYEL +ER+ R++++ +AI R+EQ+SPFP+DL+  E  K+  A + W QEEHKN G + YV+PR+   I     N  KP + Y GR P+AA A GNK  HL+E+ +F+  A +
Sbjct:   42 SSPVAAEPFLNGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGAPPGTAYQSPPPLGVSL-----------AGLAQAQSLVGAQPNVEKLVEDHLAVQSLIRAYQVMGHHNANLDPLGISCVNFDEA-PVATGFQHVGF---YGLEESDLDKVFRLPTTTFIGGDESALPLREIIRRLEMAYCQHIGVEFMFINDLDQCQWIRQKFERPGVMQFSLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDKSSENGVDTVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTNRNITLSLVANPSHLEAVNPVVQGKTKAEQFYSGDTDGKRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIKKQKGVLQKYAEKLIAEGAVTRQEYEEEIAKYDKICEEAHSRSKDEKILHIKHWLDSPWPGFFTLDGQPKSISCPSTGLPEEELAQIGQVASSVPVEDFTIHGGLSRILKGRGDMIKNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRICIPMNHMSPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDFNPKITDDFDVRQLYDCNWIVVNCSNPANYFHVIRRQILLPFRKPLIVFTPKSLLRHPEAKSNFDQMLPGTHFQRVITDDGPPAQNPSEVKRIVFCTGKIYYELTRERKARNMENSVAITRIEQLSPFPFDLVRAETEKFPNADLVWCQEEHKNQGYYDYVKPRMRTTI-----NRTKP-VWYAGREPAAAPATGNKNTHLLELKRFLDTAFN 1011          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Xenopus
Match: ogdh (oxoglutarate dehydrogenase [Source:NCBI gene;Acc:100216252])

HSP 1 Score: 1279.62 bits (3310), Expect = 0.000e+0
Identity = 623/1050 (59.33%), Postives = 764/1050 (72.76%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALE-QNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            M+ +R  A K R L ++      K+S              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA+ G A+  PP    SL           + +    S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P ++              +E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+QGKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q TVL +Y E LI++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E VL HIG V SSVP E+F IH GL R LK R + +  R  +WAL E  A GSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQF+  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   E   V+QL+D NW VVNC+TPA+ FHV+RRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IP+ G A++NPE+V+++I C+GKVYYEL KER  R +   +AI RVEQ+SPFP+DL+ +E+ KY  A + W QEEHKN G + YV+PR+   I      HR   + Y GR P+AA A GNK  H+ E+ +F+  A +  S
Sbjct:    1 MFNLRTCASKLRPLTASQTVRSLKHSRPAAPRTFQQFRCLSTPVAAEPFLSGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGASPGAAYQSPPPLGSSL-----------STLTQAQSLVQAQPNIDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSCVPADIVTSSDKLGKGFYGLQESDLDKVFHLPTTTFIGGNEMALPLREIIRRLETAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFNNEEKRTLLARLVRSTRFEEFLHRKWSSEKRFGLEGCEGLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVQGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKTVLQKYAETLISQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLSEEVLTHIGTVASSVPVEDFTIHGGLSRILKGRGEMVKNRSVDWALAEYMALGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFVCPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVWPVISEDIAVRQLYDCNWIVVNCSTPASFFHVIRRQILLPFRKPLIVFTPKSLLRHPEARSSFDEMLPGTHFERIIPDAGPASQNPEQVKRLIFCTGKVYYELNKERSSRGMDGDVAITRVEQLSPFPFDLVEKEVQKYPNAELIWCQEEHKNQGYYDYVKPRIRTTI------HRAKPVWYAGRDPAAAPATGNKKTHMTELRRFLDTAFNLDS 1018          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Xenopus
Match: OGDHL (oxoglutarate dehydrogenase like [Source:NCBI gene;Acc:100497480])

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 621/1007 (61.67%), Postives = 756/1007 (75.07%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKEL--TLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            SS + E FL+G +S Y+EEMY +WLENP SVH               KSW+++F     G    +    P     SL   +     + +       +   +IV     EEHLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L  TL    F       E  LDKVFRLPTTT+IGG    L+LREII RLEN+YC+HIG+E+MFIND+ +C WIR+KFETPGIMKF++EEKR ++ARL+RSTRFE+FLA+KWS+EKRFGLEGCEV+IP++K +ID SS++G+E   +GMPHRGRLNVLANV RK L+Q+FCQFD KLE SDEGSGDVKYHLGM H+RINR  NK I +++ ANPSHLEA DPV+QGKT AEQ+Y  D  G K MS+++HGDAAF GQGVV+ETFHLSDLPSY+T GTIHIVVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +K+I E +VS Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF  + +P  M  P TG+ E +L HIG + SSVP  +F IH GL R LK R +    R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF NTAQCIIDQFI+SGQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F   FEV QL+D NW VVNC+TPA+ FHVLRRQ+LL FRKPLI  TPKSLLR PEAKSSFD+M   T F+R+IPE G A+ NP+ V++VI C+GK+YYEL+KER  + L +++AI R+EQ+SPFP+DL+ +E  KY+ + + W QEEHKNMG + YV+ R   ++     NH +P + YVGR P+AA A GNK  H +E+ +F+  A +
Sbjct:   37 SSGAKEPFLSGTNSSYVEEMYYAWLENPKSVH---------------KSWDIFFQSADAGTPQCETRGVP-----SLTGIESKLQSLSSQGLATAPAKAEKIV-----EEHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTLDKLGF---YGLHEGDLDKVFRLPTTTYIGGIDSTLSLREIIRRLENSYCQHIGLEFMFINDVEQCQWIRQKFETPGIMKFTNEEKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKVIIDKSSEMGLEYVILGMPHRGRLNVLANVIRKDLDQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRATNKKITLSLVANPSHLEAADPVVQGKTKAEQFYRGDSHGNKVMSVLVHGDAAFAGQGVVYETFHLSDLPSYTTNGTIHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSVAAEWRNTFNKDVVVDLVCYRRSGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKMIAEGMVSLQEFEEEIAKYDRICEEAYARSKDKKILNIKHWLDSPWPGFFTLDGEPKSMTCPPTGIPEDLLSHIGNIASSVPVTDFKIHGGLSRILKSRLEMTKNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRKTCVPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFYNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPEFTNDFEVCQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFDDMNTGTNFQRVIPENGAASHNPQAVKRVIFCTGKIYYELVKERHNKGLDNQVAITRLEQLSPFPFDLVKQEAEKYATSELVWCQEEHKNMGYYDYVKARFLTIL-----NHARP-VWYVGRDPAAAPATGNKNTHHVELKRFLDVAFN 1009          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Xenopus
Match: ogdh (oxoglutarate dehydrogenase [Source:NCBI gene;Acc:100216252])

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 615/1015 (60.59%), Postives = 751/1015 (73.99%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQN------FREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA+ G A+  PP    SL           + +    S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P ++                   +E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+QGKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q TVL +Y E LI++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E VL HIG V SSVP E+F IH GL R LK R + +  R  +WAL E  A GSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQF+  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   E   V+QL+D NW VVNC+TPA+ FHV+RRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IP+ G A++NPE+V+++I C+GKVYYEL KER  R +   +AI RVEQ+SPFP+DL+ +E+ KY  A + W QEEHKN G + YV+PR+   I      HR   + Y GR P+AA A GNK  H+ E+ +F+  A +  S
Sbjct:   28 STPVAAEPFLSGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGASPGAAYQSPPPLGSSL-----------STLTQAQSLVQAQPNIDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSCVPADIVTSSDKLGKAGTAGGFYGLQESDLDKVFHLPTTTFIGGNEMALPLREIIRRLETAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFNNEEKRTLLARLVRSTRFEEFLHRKWSSEKRFGLEGCEGLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVQGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKTVLQKYAETLISQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLSEEVLTHIGTVASSVPVEDFTIHGGLSRILKGRGEMVKNRSVDWALAEYMALGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFVCPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVWPVISEDIAVRQLYDCNWIVVNCSTPASFFHVIRRQILLPFRKPLIVFTPKSLLRHPEARSSFDEMLPGTHFERIIPDAGPASQNPEQVKRLIFCTGKVYYELNKERSSRGMDGDVAITRVEQLSPFPFDLVEKEVQKYPNAELIWCQEEHKNQGYYDYVKPRIRTTI------HRAKPVWYAGRDPAAAPATGNKKTHMTELRRFLDTAFNLDS 1010          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Xenopus
Match: OGDHL (oxoglutarate dehydrogenase like [Source:NCBI gene;Acc:100497480])

HSP 1 Score: 1271.53 bits (3289), Expect = 0.000e+0
Identity = 619/1014 (61.05%), Postives = 755/1014 (74.46%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELT---------LKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            SS + E FL+G +S Y+EEMY +WLENP SVH               KSW+++F     G    +    P     SL   +     + +       +   +IV     EEHLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L          L  +         E  LDKVFRLPTTT+IGG    L+LREII RLEN+YC+HIG+E+MFIND+ +C WIR+KFETPGIMKF++EEKR ++ARL+RSTRFE+FLA+KWS+EKRFGLEGCEV+IP++K +ID SS++G+E   +GMPHRGRLNVLANV RK L+Q+FCQFD KLE SDEGSGDVKYHLGM H+RINR  NK I +++ ANPSHLEA DPV+QGKT AEQ+Y  D  G K MS+++HGDAAF GQGVV+ETFHLSDLPSY+T GTIHIVVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +K+I E +VS Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF  + +P  M  P TG+ E +L HIG + SSVP  +F IH GL R LK R +    R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF NTAQCIIDQFI+SGQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F   FEV QL+D NW VVNC+TPA+ FHVLRRQ+LL FRKPLI  TPKSLLR PEAKSSFD+M   T F+R+IPE G A+ NP+ V++VI C+GK+YYEL+KER  + L +++AI R+EQ+SPFP+DL+ +E  KY+ + + W QEEHKNMG + YV+ R   ++     NH +P + YVGR P+AA A GNK  H +E+ +F+  A +
Sbjct:   37 SSGAKEPFLSGTNSSYVEEMYYAWLENPKSVH---------------KSWDIFFQSADAGTPQCETRGVP-----SLTGIESKLQSLSSQGLATAPAKAEKIV-----EEHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTLDKLGSDLTVFPLFCFYGLHEGDLDKVFRLPTTTYIGGIDSTLSLREIIRRLENSYCQHIGLEFMFINDVEQCQWIRQKFETPGIMKFTNEEKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKVIIDKSSEMGLEYVILGMPHRGRLNVLANVIRKDLDQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRATNKKITLSLVANPSHLEAADPVVQGKTKAEQFYRGDSHGNKVMSVLVHGDAAFAGQGVVYETFHLSDLPSYTTNGTIHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSVAAEWRNTFNKDVVVDLVCYRRSGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKMIAEGMVSLQEFEEEIAKYDRICEEAYARSKDKKILNIKHWLDSPWPGFFTLDGEPKSMTCPPTGIPEDLLSHIGNIASSVPVTDFKIHGGLSRILKSRLEMTKNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRKTCVPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFYNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPEFTNDFEVCQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFDDMNTGTNFQRVIPENGAASHNPQAVKRVIFCTGKIYYELVKERHNKGLDNQVAITRLEQLSPFPFDLVKQEAEKYATSELVWCQEEHKNMGYYDYVKARFLTIL-----NHARP-VWYVGRDPAAAPATGNKNTHHVELKRFLDVAFN 1019          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Xenopus
Match: ogdh (oxoglutarate dehydrogenase [Source:NCBI gene;Acc:100216252])

HSP 1 Score: 1267.68 bits (3279), Expect = 0.000e+0
Identity = 620/1049 (59.10%), Postives = 763/1049 (72.74%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            M+ +R  A K R L ++      K+S              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA+ G A+  PP    SL           + +    S +  +      +E+HLAVQ++IR+YQ RGH+++ LDPLGI S + D + P  +   +  F      +E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+QGKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q TVL +Y E LI++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E VL HIG V SSVP E+F IH GL R LK R + +  R  +WAL E  A GSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQF+  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   E   V+QL+D NW VVNC+TPA+ FHV+RRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IP+ G A++NPE+V+++I C+GKVYYEL KER  R +   +AI RVEQ+SPFP+DL+ +E+ KY  A + W QEEHKN G + YV+PR+   I      HR   + Y GR P+AA A GNK  H+ E+ +F+  A +  S
Sbjct:    1 MFNLRTCASKLRPLTASQTVRSLKHSRPAAPRTFQQFRCLSTPVAAEPFLSGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGASPGAAYQSPPPLGSSL-----------STLTQAQSLVQAQPNIDKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISSVNFDGA-PVIVGSPNMGF---YGLQESDLDKVFHLPTTTFIGGNEMALPLREIIRRLETAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFNNEEKRTLLARLVRSTRFEEFLHRKWSSEKRFGLEGCEGLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVQGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKTVLQKYAETLISQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLSEEVLTHIGTVASSVPVEDFTIHGGLSRILKGRGEMVKNRSVDWALAEYMALGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFVCPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVWPKVSEDIAVRQLYDCNWIVVNCSTPASFFHVIRRQILLPFRKPLIVFTPKSLLRHPEARSSFDEMLPGTHFERIIPDAGPASQNPEQVKRLIFCTGKVYYELNKERSSRGMDGDVAITRVEQLSPFPFDLVEKEVQKYPNAELIWCQEEHKNQGYYDYVKPRIRTTI------HRAKPVWYAGRDPAAAPATGNKKTHMTELRRFLDTAFNLDS 1013          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Mouse
Match: Ogdhl (oxoglutarate dehydrogenase-like [Source:MGI Symbol;Acc:MGI:3616088])

HSP 1 Score: 1290.4 bits (3338), Expect = 0.000e+0
Identity = 625/1043 (59.92%), Postives = 775/1043 (74.30%), Query Frame = 1
Query:  100 MYKIRLL----AQKQRSLLSNYGFPIFKNSVKNSS--ASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            M ++RLL      +   LL+    P+F    ++S    +     +G SS Y+EEMY +WLENP SVHK               SW+ +F + SK A+VG A    P  +                     +S++        +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L       A   + +E  LDK FRLPTTT IGG    L+LREII RLE+ YC+HIG+E+MFIND+ +C WIR+KFETPG+M+FS EEKR ++ARL+RS RFE+FLA+KWS+EKRFGLEGCEV+IP++KT+ID SS++G+E+  +GMPHRGRLNVLANV RK LEQ+FCQFD KLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D QG+K MSI++HGDAAF GQGVV+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +KLI E  V+ Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF+ + +P  M  P TG+ E +L HIG V SSVP E+F IH+GL R L+ R     +R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELG++   PN+LV+WEAQFGDF+NTAQCIIDQFI++GQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F E FEV QL+D NW VVNC+TPA+ FHVLRRQ+LL FRKPLI  TPKSLLR P+AKSSFD+M+  T F+RLIPE G A  +PE+V+++I C+GKVYY+L+KER  + L+ ++AI R+EQISPFP+DL+  E  KYS A + W QEEHKNMG + Y+ PR   L+      H +P I YVGR P+AA A GNK  HL+ + +F+  A + ++
Sbjct:    1 MSQLRLLPFRLGPRATKLLATRAIPVFSGCRRSSGPPTTIPRSRSGVSSSYVEEMYFAWLENPQSVHK---------------SWDSFFQRASKEASVGPAQPQLPAVL-----------------QESRTSVSSCTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAF-YDLQEADLDKEFRLPTTTFIGGPENTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSVEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGRKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPTTGIPEEMLTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKKRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPLIVFTPKSLLRHPDAKSSFDQMVSGTSFQRLIPEDGPAAHSPEQVQRLIFCTGKVYYDLVKERSSQGLEQQVAITRLEQISPFPFDLIMREAEKYSGAELVWCQEEHKNMGYYDYISPRFMTLL-----GHSRP-IWYVGRDPAAAPATGNKNAHLVSLRRFLDTAFNLKA 1004          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Mouse
Match: Ogdhl (oxoglutarate dehydrogenase-like [Source:MGI Symbol;Acc:MGI:3616088])

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 627/1061 (59.10%), Postives = 778/1061 (73.33%), Query Frame = 1
Query:  100 MYKIRLL----AQKQRSLLSNYGFPIFKNSVKNSS--ASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELT--------------LKHY----NFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            M ++RLL      +   LL+    P+F    ++S    +     +G SS Y+EEMY +WLENP SVHK               SW+ +F + SK A+VG A    P  +                     +S++        +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L               L  Y    +F    + +E  LDK FRLPTTT IGG    L+LREII RLE+ YC+HIG+E+MFIND+ +C WIR+KFETPG+M+FS EEKR ++ARL+RS RFE+FLA+KWS+EKRFGLEGCEV+IP++KT+ID SS++G+E+  +GMPHRGRLNVLANV RK LEQ+FCQFD KLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D QG+K MSI++HGDAAF GQGVV+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +KLI E  V+ Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF+ + +P  M  P TG+ E +L HIG V SSVP E+F IH+GL R L+ R     +R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELG++   PN+LV+WEAQFGDF+NTAQCIIDQFI++GQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F E FEV QL+D NW VVNC+TPA+ FHVLRRQ+LL FRKPLI  TPKSLLR P+AKSSFD+M+  T F+RLIPE G A  +PE+V+++I C+GKVYY+L+KER  + L+ ++AI R+EQISPFP+DL+  E  KYS A + W QEEHKNMG + Y+ PR   L+      H +P I YVGR P+AA A GNK  HL+ + +F+  A + ++
Sbjct:    1 MSQLRLLPFRLGPRATKLLATRAIPVFSGCRRSSGPPTTIPRSRSGVSSSYVEEMYFAWLENPQSVHK---------------SWDSFFQRASKEASVGPAQPQLPAVL-----------------QESRTSVSSCTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLGKSWDPSLLSFYAALASFPAFYDLQEADLDKEFRLPTTTFIGGPENTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSVEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGRKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPTTGIPEEMLTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKKRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPLIVFTPKSLLRHPDAKSSFDQMVSGTSFQRLIPEDGPAAHSPEQVQRLIFCTGKVYYDLVKERSSQGLEQQVAITRLEQISPFPFDLIMREAEKYSGAELVWCQEEHKNMGYYDYISPRFMTLL-----GHSRP-IWYVGRDPAAAPATGNKNAHLVSLRRFLDTAFNLKA 1023          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Mouse
Match: Ogdh (oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) [Source:MGI Symbol;Acc:MGI:1098267])

HSP 1 Score: 1270.37 bits (3286), Expect = 0.000e+0
Identity = 618/1045 (59.14%), Postives = 759/1045 (72.63%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFG-EHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQA 3183
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+                       +    S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD S+P ++              E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS  GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGD+KYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWRN F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG++E VL HIGKV SSVP ENF IH GL R LK R + ++ R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDFNN AQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P    E+F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA++SFDEM+  T F+R+IPE G A ++P KV++++ C+GKVYY+L +ER+ R++++ +AI R+EQ+SPFP+DLL +E  KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ +F+  A
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQ----------SPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGF-YGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTID------RAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTA 1013          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Mouse
Match: Ogdh (oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) [Source:MGI Symbol;Acc:MGI:1098267])

HSP 1 Score: 1270.37 bits (3286), Expect = 0.000e+0
Identity = 618/1045 (59.14%), Postives = 759/1045 (72.63%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFG-EHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQA 3183
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+                       +    S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD S+P ++              E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS  GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGD+KYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWRN F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG++E VL HIGKV SSVP ENF IH GL R LK R + ++ R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDFNN AQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P    E+F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA++SFDEM+  T F+R+IPE G A ++P KV++++ C+GKVYY+L +ER+ R++++ +AI R+EQ+SPFP+DLL +E  KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ +F+  A
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQ----------SPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGF-YGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTID------RAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTA 1013          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Mouse
Match: Ogdh (oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) [Source:MGI Symbol;Acc:MGI:1098267])

HSP 1 Score: 1257.28 bits (3252), Expect = 0.000e+0
Identity = 614/1045 (58.76%), Postives = 758/1045 (72.54%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFG-EHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQA 3183
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+                       +    S +  +      +E+HLAVQ++IR+YQ RGH+++ LDPLGI   + DD+ P  ++     + L     E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS  GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGD+KYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWRN F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG++E VL HIGKV SSVP ENF IH GL R LK R + ++ R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDFNN AQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P    E+F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA++SFDEM+  T F+R+IPE G A ++P KV++++ C+GKVYY+L +ER+ R++++ +AI R+EQ+SPFP+DLL +E  KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ +F+  A
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQ----------SPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDA-PVTVSSNVGFYGLH----ESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTID------RAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTA 1009          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. UniProt/SwissProt
Match: sp|Q9ULD0|OGDHL_HUMAN (2-oxoglutarate dehydrogenase-like, mitochondrial OS=Homo sapiens OX=9606 GN=OGDHL PE=1 SV=3)

HSP 1 Score: 1286.17 bits (3327), Expect = 0.000e+0
Identity = 623/1043 (59.73%), Postives = 776/1043 (74.40%), Query Frame = 1
Query:  100 MYKIRLLAQK----QRSLLSNYGFPIFKNSVKNSS--ASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            M ++RLL  +       LL+ +  P+F    ++S   A+  S   GG S Y+EEMY +WLENP SVHK               SW+ +F + S+ A  G A   PP+ ++                    S+++        +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L       A   + +E  LDK F+LPTTT IGG    L+LREII RLEN YC+HIG+E+MFIND+ +C WIR+KFETPG+M+FS EEKR ++ARL+RS RFE+FLA+KWS+EKRFGLEGCEV+IP++KT+ID SS++G+E+  +GMPHRGRLNVLANV RK LEQ+FCQFD KLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D QGKK MSI++HGDAAF GQGVV+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +KLI E  V+ Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF+ + +P  M  P TG+ E +L HIG V SSVP E+F IH+GL R L+ R      R  +WAL E  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELG++   PN+LV+WEAQFGDF+NTAQCIIDQFI++GQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F + FEV QL+D NW VVNC+TPAN FHVLRRQ+LL FRKPLI  TPKSLLR PEAKSSFD+M+  T F+R+IPE G A   PE+V+++I C+GKVYY+L+KER  + L++++AI R+EQISPFP+DL+ +E  KY  A + W QEEHKNMG + Y+ PR   +++   P      I YVGR P+AA A GN+  HL+ + +F+  A + ++
Sbjct:    1 MSQLRLLPSRLGVQAARLLAAHDVPVFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHK---------------SWDSFFREASEEAFSGSAQPRPPSVVHE-----------------SRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAF-YDLQEADLDKEFQLPTTTFIGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDMLTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVKERSSQDLEEKVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILRRARP------IWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQA 1004          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. UniProt/SwissProt
Match: sp|Q5R9L8|OGDHL_PONAB (2-oxoglutarate dehydrogenase-like, mitochondrial OS=Pongo abelii OX=9601 GN=OGDHL PE=2 SV=2)

HSP 1 Score: 1281.93 bits (3316), Expect = 0.000e+0
Identity = 623/1035 (60.19%), Postives = 772/1035 (74.59%), Query Frame = 1
Query:  112 RLLAQKQRSLLSNYGFPIFKNSVKNS--SASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            RL AQ  R LL+ +  P+F    ++S   A+  S   GG S Y+EEMY +WLENP SVHK               SW+ +F + S+ A  G A   PP+ ++                    S+++        +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L       A   + +E  LDK F+LPTTT IGG    L+LREII RLEN YC+HIG+E+MFIND+ +C WIR+KFETPG+M+FS EEKR ++ARL+RS RFE+FLA+KWS+EKRFGLEGCEV+IP++KT+ID SS++G+E+  +GMPHRGRLNVLANV RK LEQ+FCQFD KLE +DEGSGDVKYHLGM H+RINR+ N+ I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D QGKK MSI++HGDAAF GQGVV+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +KLI E  V+ Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF+ + +P  M  P TG+ E +L HIG V SSVP E+F IH+GL R L+ R   I  R  +WAL E  AFGSLLK GI VRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELG++   PN+LV+WEAQFGDF+NTAQCIIDQFI++GQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F + FEV QL+D NW VVNC+TPAN FHVLRRQ+LL FRKPLI  TPKSLLR PEAK SFD+M+  T F+R+IPE G A   PE+V ++I C+GKVYY+L+KER  + L++++AI R+EQISPFP+DL+ +E  KY  A + W QEEHKNMG + Y+ PR   +++   P      I YVGR P+AA A GN+  HL+ + +F+  A + ++
Sbjct:   10 RLGAQAAR-LLAAHDIPVFGWRSRSSRPPATLPSSKGGGGSSYMEEMYFAWLENPRSVHK---------------SWDSFFRKASEEAFSGSAQPRPPSVVHE-----------------SRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAF-YDLQEADLDKEFQLPTTTFIGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDMLTHIGSVASSVPLEDFKIHTGLSRILRGRADMIKNRTVDWALAEYMAFGSLLKEGIRVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKFSFDQMVSGTSFQRVIPEDGAAARAPEQVRRLIFCTGKVYYDLVKERSSQGLEEKVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILRRARP------IWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQA 1004          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. UniProt/SwissProt
Match: sp|Q60HE2|ODO1_MACFA (2-oxoglutarate dehydrogenase, mitochondrial OS=Macaca fascicularis OX=9541 GN=OGDH PE=2 SV=1)

HSP 1 Score: 1273.46 bits (3294), Expect = 0.000e+0
Identity = 626/1065 (58.78%), Postives = 766/1065 (71.92%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAF-SPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGE-HFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*NDFF*FRLDILYN 3240
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+ SP P    SL    +             S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD S+P ++              E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E +L HIG V SSVP ENF IH GL R LK R + +  R  +WAL E  AFGSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P   E +F++ QLHD NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IPE G A +NPE V++++ C+GKVYY+L +ER+ R +  ++AI R+EQ+SPFP+DLL +E+ KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ + +  A           F LD+  N
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAH-----------AQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGF-YGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLHDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIS------RAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTA-----------FDLDVFKN 1021          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. UniProt/SwissProt
Match: sp|Q5RCB8|ODO1_PONAB (2-oxoglutarate dehydrogenase, mitochondrial OS=Pongo abelii OX=9601 GN=OGDH PE=2 SV=1)

HSP 1 Score: 1272.69 bits (3292), Expect = 0.000e+0
Identity = 626/1065 (58.78%), Postives = 766/1065 (71.92%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNS------------VKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAF-SPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGE-HFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*NDFF*FRLDILYN 3240
            M+ +R  A K R L ++     F  +              ++  +AE FL+G SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+ SP P    SL    +             S +  +      +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD S+P ++              E  LDKVF LPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR+KFETPGIM+F++EEKR ++ARL+RSTRFEEFL +KWS+EKRFGLEGCEVLIP++KT+ID SS+ GV+   +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEA DPV+ GKT AEQ+Y  D +GKK MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVN+DDPEAV+YV KVAAEWR+ F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y E L+++ VV+  +Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF  +  P  M  P TG+ E +L HIG V SSVP ENF IH GL R LK R + +  R  +WAL E  AFGSLLK GIH+RLSGQDVERGTFSHRH VLHDQ  D    +P+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P   E +F++ QL+D NW VVNC+TP N FHVLRRQ+LL FRKPLI  TPKSLLR PEA+SSFDEM+  T F+R+IPE G A +NPE V++++ C+GKVYY+L +ER+ R +  ++AI R+EQ+SPFP+DLL +E+ KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A GNK  HL E+ + +  A           F LDI  N
Sbjct:    1 MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHK---------------SWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAH-----------AQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGF-YGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPSAELAWCQEEHKNQGYYDYVKPRLRTTIS------RAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTA-----------FDLDIFKN 1021          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. UniProt/SwissProt
Match: sp|Q68EW0|OGDHL_XENLA (2-oxoglutarate dehydrogenase-like, mitochondrial OS=Xenopus laevis OX=8355 GN=ogdhl PE=2 SV=1)

HSP 1 Score: 1272.3 bits (3291), Expect = 0.000e+0
Identity = 621/1002 (61.98%), Postives = 754/1002 (75.25%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKEL--TLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFM 3174
            SS + E FL+G +S Y+EEMY +WLENP SVH               KSW+ +F     G    +    P     SL   +     + +       +   +IV     EEHLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P +L  TL    F       E  LDKVFRLPTTT+IGG    L+LREII RLEN+YC+HIG+E+MFIND+ +C WIR+KFETPGIMKF +EEKR ++ARLIRSTRFE+FLA+KWS+EKRFGLEGCEV+IP++K +ID SS++G+E   +GMPHRGRLNVLANV RK L+Q+FCQFD KLE SDEGSGDVKYHLGM H+RINR  NK I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D +G K MSI++HGDAAF GQGVV+ETFHLSDLPSY+T GTIHIVVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWRN F+KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+IH Q  VL +Y +K+I E  V+ Q+++EEI KYD+ICEEAY  +K +  +  + WLDSPW GFF  + +P  M  P TG+ E +L HIG + SSVP ++F IH GL R LK R +  + R  +WAL E   FGSLLK GIHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF NTAQCIIDQFI+SGQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMSNDD D  P F + F+V QL D NW VVNC+ PA+ FHVLRRQ+LL FRKPLI  TPKSLLR PEAKSSFD+M   T F+R+IPE G A+ +P++V++VI C+GKVYYEL+KER R+ L  ++AI R+EQISPFP+DL+ +E  KY+ + + W QEEHKNMG + YV+ R   ++     NH +P + YVGR P+AA A GNK  H +E+ +F+
Sbjct:   37 SSGAKEPFLSGTNSSYVEEMYYAWLENPKSVH---------------KSWDAFFRSADNGTPQCEIQGVP-----SLADIESKLPSLSSQGLATAPAKAEKIV-----EEHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTLDKLGF---YGLHEGDLDKVFRLPTTTYIGGTDSTLSLREIIRRLENSYCQHIGLEFMFINDVEQCQWIRQKFETPGIMKFINEEKRTLLARLIRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKAIIDKSSEMGLEYVILGMPHRGRLNVLANVIRKDLDQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRATNKKITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDTEGNKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGTIHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSVAAEWRNTFNKDVVVDLVCYRRSGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKMIAEGTVTLQEFEEEIAKYDRICEEAYARSKDKKILNIKHWLDSPWPGFFTLDGEPKSMTCPPTGIPEDMLSHIGAIASSVPLKDFKIHGGLSRILKSRLEMTNSRTVDWALAEYMTFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRWTCVPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFYNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPEFTQDFDVSQLFDCNWIVVNCSNPASYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFDDMKTGTNFQRVIPENGAASHSPQEVKRVIFCTGKVYYELVKERHRKGLDSQVAITRLEQISPFPFDLVKQEAEKYATSELVWCQEEHKNMGYYDYVKARFLTIL-----NHARP-VWYVGRDPAAAPATGNKNTHHVELRRFL 1004          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. TrEMBL
Match: A0A4S2LJA1 (Transket_pyr domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007190 PE=4 SV=1)

HSP 1 Score: 1419.06 bits (3672), Expect = 0.000e+0
Identity = 666/1006 (66.20%), Postives = 798/1006 (79.32%), Query Frame = 1
Query:  172 NSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            ++V+      E FLNG SS Y+E++Y +WLENP+SVHK               SW++YF +V+ GAA G+A++PPP    +L +   F     +              D  TIE+HLAVQAIIRSYQ+ GH  + LDPLGILSADLDD++P EL+L  YN        EP LDK F LP TT+IGG   ELTLREII RLE  YC+HIGVE+MFIN LNKCDWIRRKFETPG + F+ EEKRLI+AR+IR+TRFE F AKKWS+EKRFG+EGCE+LIP++KTVID SS LGV+SF IGMPHRGRLNVLANVCRKPLE +FCQFDS+LE +DEGSGDVKYHLGMSH RIN +  K I +AVCANPSHLEAVDPV+QGKT AEQ+Y  D +G+K MSI+LHGDA+FCGQGVVFETFHLSDLPSYST GTIHIVVNNQIGFTTDPR+ARSSPYCTDVARVTN+ I HVNADDPEAV  VSKVAAEWR+EFSKDVVIDLVCYRR GHNEMDEPMFTQPLMYK+I  QPTVL+QY +KL+ E +V+  +Y+ EIEKYDKICE+AY LAKK+T   NR WLDSPW GFF+ +DPM +P TGV+ SVL+H+ + +S  PE   IH GLKR+L+ER +   + MANWALGE FA+GSLLK G HVRLSG+DVERGTFSHRH+VLHDQ  D   +VPLN+L+  QA F+V NSSLSEYAV+GFELG+S T+PN+LVIWEAQFGDF N AQCI+DQFI+SGQ KWVRQSGLV+LLPHGYEGMGPEHSSAR+ERFLQMS+DD+ ++P F +HF +QQLH+ NW V NCTTPAN+FH+LRRQ+LL FRKPL+  TPKSLLR P+ KS + +M+  ++FKR IPE+G A +NP+ V+K+ILCSGKVYY+L+K+R    L   IAI RVEQ++PFPYDLL  +L  Y EA ++WVQEEHKNMGAW YV+PRVN+LI++   +     ++Y GR  SA+ AAG+   HLME+S FM+QA++
Sbjct:   23 SAVRAQRVFKEPFLNGTSSNYLEDIYQAWLENPSSVHK---------------SWDIYFRRVAAGAAPGEAYTPPP----TLGRSSSFAAQSVSVSAQP---------DIKTIEDHLAVQAIIRSYQSLGHRSARLDPLGILSADLDDTVPPELSLNFYNLG------EPDLDKTFLLPPTTYIGGNKNELTLREIIKRLEEVYCQHIGVEFMFINSLNKCDWIRRKFETPGHLSFTPEEKRLILARVIRATRFEAFSAKKWSSEKRFGIEGCEMLIPALKTVIDTSSSLGVDSFVIGMPHRGRLNVLANVCRKPLEDIFCQFDSRLEAADEGSGDVKYHLGMSHSRINHVTQKTINLAVCANPSHLEAVDPVVQGKTKAEQFYRGDNEGRKVMSILLHGDASFCGQGVVFETFHLSDLPSYSTHGTIHIVVNNQIGFTTDPRMARSSPYCTDVARVTNSLILHVNADDPEAVTSVSKVAAEWRSEFSKDVVIDLVCYRRAGHNEMDEPMFTQPLMYKRIKQQPTVLDQYSKKLVAEGIVTEDEYKAEIEKYDKICEDAYELAKKQTVTYNRSWLDSPWHGFFEKRDPMFLPNTGVEISVLEHVARAISEPPEGMTIHPGLKRALRERHELSEQHMANWALGELFAYGSLLKEGCHVRLSGEDVERGTFSHRHSVLHDQNVDKKTYVPLNHLFPSQAPFTVCNSSLSEYAVMGFELGYSLTNPNALVIWEAQFGDFANVAQCIVDQFISSGQQKWVRQSGLVLLLPHGYEGMGPEHSSARIERFLQMSSDDEHHVPVFTDHFAMQQLHETNWIVANCTTPANLFHILRRQILLPFRKPLVLFTPKSLLRHPDCKSPWADMLPGSEFKRYIPESGDAAQNPKAVKKLILCSGKVYYDLVKQRNAVGLASDIAISRVEQLTPFPYDLLKADLELYPEARIEWVQEEHKNMGAWTYVQPRVNHLIEIAFADRLHKNLTYTGRQTSASTAAGHNATHLMEMSLFMKQALT 994          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. TrEMBL
Match: A0A3Q0KF78 (2-oxoglutarate dehydrogenase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1415.98 bits (3664), Expect = 0.000e+0
Identity = 668/1001 (66.73%), Postives = 793/1001 (79.22%), Query Frame = 1
Query:  193 ASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQS--TIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
             S E FLNG SS Y+E++Y +WL+NP SVHK               SW++YF  ++ GAA G A+  PP       K                  +T   V  S  TIE+HL+VQAIIRSYQ+ GH ++ LDPLGILSADLDDSIP EL+L  YN        EP LDK FRLP TTHIGG  QELTLREII RLE+ YC+HIG+EYMFIN LNKCDWIRRKFETPG M  S EEKRLI+ARL+RSTRFE FLAKKWS+EKRFGLEGCEVLIP+MK VID+SS LGVESF IG+PHRGRLNVLANVCRKPL+ +FCQFDSKLE  DEGSGDVKYHLGMSH+R+N +  KMI +AVCANPSHLEAV PV QGKT AEQ+Y  D  GKK MSI++HGDAAF GQGVV+ETFHLSDLPSY+T+GTIHIVVNNQIGFTTDPR+ARSSPYCTDVARVTN+ I H NADDPE+V++V+KVAAEWR+EF KDVVIDLVCYRR GHNEMDEPMFTQPLMYK+I  QPTVL QY +KLI   +V+ Q++++E+ KYD+ICE+AY LAKK T   NR W+DSPW  FF+NKDPM +P TGV+  VL+HIG V+S  PE   IH GLKR+LKER+  + ++ ANWALGE FA+GSLL+ GIHVRLSGQDVERGTFSHRH+VLHDQE D   +VPLN+LY  QA F+V NSSLSEYAV+GFELG+S T+P +LVIWEAQFGDFNNTAQCIIDQFI+SGQ KWVRQSG+V+LLPHGYEGMGPEHSSAR+ERFLQM ND+++++P + ++F +QQLHD NW + NCTTPAN FH+LRRQ+LL FRKPLI  TPKSLLR P+A+S F +M+  ++F+R IP+ G A++ PE V+K+I+CSGK+YYEL KER   + +  IAI RVEQ++PFPYDL+ ++L +Y  A +QWVQEEHKNMG W YV+PR N+LI   +P+    KI Y GR PSAA AAGNK +HLMEIS +++ A+S
Sbjct:   31 TSNEPFLNGTSSNYLEDIYEAWLQNPDSVHK---------------SWDIYFKCLASGAAPGNAYVQPPTLGKEGLKLAQLA-----------PQITGRAVVPSLKTIEDHLSVQAIIRSYQSLGHRIADLDPLGILSADLDDSIPPELSLSFYNLG------EPDLDKTFRLPPTTHIGGDKQELTLREIIKRLEDVYCKHIGIEYMFINSLNKCDWIRRKFETPGSMNLSSEEKRLILARLVRSTRFEAFLAKKWSSEKRFGLEGCEVLIPAMKAVIDSSSALGVESFVIGIPHRGRLNVLANVCRKPLDDVFCQFDSKLEACDEGSGDVKYHLGMSHQRLNHMTGKMINLAVCANPSHLEAVCPVAQGKTKAEQFYRGDTDGKKVMSILIHGDAAFSGQGVVYETFHLSDLPSYTTKGTIHIVVNNQIGFTTDPRMARSSPYCTDVARVTNSLILHANADDPESVMHVAKVAAEWRSEFGKDVVIDLVCYRRSGHNEMDEPMFTQPLMYKRIREQPTVLEQYSKKLIDSGIVTEQEFKDEVAKYDQICEDAYELAKKRTVTYNRAWIDSPWHNFFENKDPMYLPNTGVESDVLEHIGHVISEPPEGMVIHPGLKRALKERKDLLEQKTANWALGELFAYGSLLREGIHVRLSGQDVERGTFSHRHSVLHDQEVDKKTYVPLNHLYPSQAPFTVCNSSLSEYAVMGFELGYSLTNPEALVIWEAQFGDFNNTAQCIIDQFISSGQQKWVRQSGIVLLLPHGYEGMGPEHSSARIERFLQMCNDEENHVPVYSDNFVMQQLHDTNWIIANCTTPANFFHILRRQILLPFRKPLIVFTPKSLLRHPDARSPFSDMLPGSEFQRYIPDNGPASQKPENVKKLIICSGKIYYELDKERRSINREADIAISRVEQLTPFPYDLIQQDLERYPNAIIQWVQEEHKNMGPWSYVQPRANHLIFRTMPDRLHNKILYAGRQPSAATAAGNKAMHLMEISHYLKNALS 999          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. TrEMBL
Match: A0A504Z421 (2-oxoglutarate dehydrogenase mitochondrial OS=Fasciola gigantica OX=46835 GN=FGIG_04989 PE=4 SV=1)

HSP 1 Score: 1409.43 bits (3647), Expect = 0.000e+0
Identity = 676/1049 (64.44%), Postives = 799/1049 (76.17%), Query Frame = 1
Query:  190 SASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNF-------------------------------------------------REPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            S+S E F+NG SS YIE++Y +W  +P+SVHK               SW++YF  V+ GA  G+A++PPP      P  Q   T                 ++  TIE+HL+VQAIIRSYQ+  H V+ LDPLGIL ADLDDSIP ELTL  YN A+  +                                                   EP LDK FRLP TT+IGG   ELTLREII RLE  YCRHIGVEYMFIN LNKCDWIRRKFETPG + F+ ++KR I+ARL+RSTRFE FLAKKWS+EKRFG+EGCE LIP+MKT+ID S+DLGV+S  IG+PHRGRLNVLANVCRKPLE++FCQFDS+LE +DEGSGDVKYHLGMSH RIN +NNK I VAVCANPSHLEAVDPV+QGKT AEQ+Y  D  GKK MSI++HGDA+FCGQGVV+ETFHLSDLPSYST GTIHIVVNNQIGFTTDPR+ARSSPYCTDVARVTN+ I HVNADDPEAV  V++VAAEWR+EFSKDVVIDLVCYRR GHNEMDEPMFTQPLMYK+I  QPT L QY +KLITE VV+  +Y+ EI+KYD+ICEEAY LAKK+T   NR W+DSPW GFF+NKDPM +P TGV+ SVL+HIG V+S  PE   IH GLKR+LKER +   +RMANWALGE FA+GSLLK G HVRLSGQDVERGTFSHRH+VLHDQE D   +VPLN+L+  QA F+V NSSLSE+AV+GFELG+S T+PN+LV+WEAQFGDFNN AQC++DQF++SGQ KWVRQSGLV+LLPHGYEGMGPEHSSAR+ERFLQMSNDD+ ++P F + F +QQLH+ NW V NCTTPAN FH+LRRQ+LL FRKPLI  TPKSLLR P+AKS F++ +  ++F+R IPE G+A   PE V+K+ILC GKVYY+L+KER+   L  +IAI RVEQI+PFPYDL+  EL +Y +A +QWVQEEHKNMGAW YV PRVN+LI+  LP      I+Y GR PSA+ AAG K +HLMEIS +++ A++
Sbjct:   30 SSSKEPFINGTSSHYIEDIYEAWRNDPSSVHK---------------SWDIYFRGVTSGAKFGEAYTPPPTLGRQGPYLQQIETPSF-----------QGTLNVKTIEDHLSVQAIIRSYQSLAHRVANLDPLGILDADLDDSIPPELTLSFYNLAVRLDVPCGCFANPYCSLFLRVRGHLAAHLDPLNITSPSEGTARYIVYKRYLGESGEPDLDKTFRLPQTTYIGGDKHELTLREIIRRLEEVYCRHIGVEYMFINSLNKCDWIRRKFETPGALSFTPQQKRFILARLVRSTRFEAFLAKKWSSEKRFGVEGCEALIPAMKTLIDVSTDLGVDSIVIGIPHRGRLNVLANVCRKPLEEIFCQFDSRLEAADEGSGDVKYHLGMSHSRINNMNNKRINVAVCANPSHLEAVDPVVQGKTKAEQFYRGDTDGKKVMSILVHGDASFCGQGVVYETFHLSDLPSYSTHGTIHIVVNNQIGFTTDPRMARSSPYCTDVARVTNSLILHVNADDPEAVARVAQVAAEWRSEFSKDVVIDLVCYRRSGHNEMDEPMFTQPLMYKRIRQQPTALEQYAKKLITEGVVTEAEYEAEIKKYDQICEEAYELAKKQTVTYNRAWIDSPWHGFFENKDPMYLPNTGVESSVLEHIGHVISESPEGMTIHPGLKRTLKERRELCEQRMANWALGELFAYGSLLKEGFHVRLSGQDVERGTFSHRHSVLHDQEVDKKTYVPLNHLFPSQAPFTVCNSSLSEFAVMGFELGYSLTNPNALVLWEAQFGDFNNNAQCVVDQFVSSGQQKWVRQSGLVLLLPHGYEGMGPEHSSARVERFLQMSNDDESHVPVFSDQFVMQQLHETNWIVANCTTPANFFHILRRQILLPFRKPLIVFTPKSLLRHPDAKSPFEDFLPGSEFQRFIPEGGVAANQPEGVKKLILCCGKVYYDLIKERQTLGLDQQIAIGRVEQITPFPYDLVKAELERYPDATLQWVQEEHKNMGAWSYVRPRVNHLIETCLPERLHKSITYAGRQPSASTAAGYKAMHLMEISLYLKNALT 1052          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. TrEMBL
Match: A0A2C9JG62 (Transket_pyr domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106072020 PE=4 SV=1)

HSP 1 Score: 1405.19 bits (3636), Expect = 0.000e+0
Identity = 667/1008 (66.17%), Postives = 793/1008 (78.67%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYS-------LPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAI 3186
            ++  +AE F+NG SS YIE+MY +W  +P SVHK               SW+ +F Q +KGA  GQA+S PP    +       LP++     +                VD+ TIE+HL+VQ+IIRSYQ RGH++  LDPLGIL+ADLD  IPK+L ++ YN        E  LD+VFRLP TT+IGG    L LREII RL+N YCR IGVE+MFIN+L + DWIRR+FETPGIM+FS EEKRLIMAR+IRSTRFEEFLA+KWS+EKRFGLEGCEVLIP+MKT+IDASS LGV+SF IGMPHRGRLNVLANVCRKPLE++ CQFDSKLE +DEGSGDVKYHLGMSH+R+NR+ NK IK+AV ANPSHLEAVDPV+QGK  AE +Y  D  GKK M ++LHGDAAF GQG+V+E  HLSDLP+++T GTIHIVVNNQIGFTTDPR +RSSPYCTDVARV NAPIFHVNADDPEAV+YV KVAA+WR  F KDVVIDLVCYRRFGHNE+DEPMFTQPLMYKKI  QPTVL +Y E LI    ++ Q+Y+EEI KYDKICEEAY LAKKETA+ N +WLDSPW GFF+ +DPM +P TGV E VL+HIG V S+ PE F IH GLKR LK R + ++ R  +WALGEA AFGSLLK GIHVRLSGQDVERGTFSHRH VLH Q  D    +PLNNLY  QA ++V NSSLSEY VLGFE+G+S T+PN+LVIWEAQFGDF NTAQCIIDQFI+SGQ+KWVRQSG+V+LLPHG+EGMGPEHSSARLERFLQ+SNDD DY PP G +FE+QQLH+ NW V N TTPAN FH +RRQ+ LSFRKPL+  TPKSLLRLPEA+SSFD+MI  T+F+RLIPE+GI+ +NPEKV+K+I C+GK+YYEL+KERE ++LQ+ IAI RVEQ++PFP+DL+ +EL KY +A + W QEEHKN GAW Y+ PR+  +++ K   +R  K+ Y GR  SAAAA GNK +HLME+SQ    A+
Sbjct:   47 STQVAAEPFMNGSSSAYIEDMYEAWQRDPNSVHK---------------SWDAFFRQTAKGAPPGQAYSAPPTLRPATGLVPSPLPRHAVEQGLP---------------VDEKTIEDHLSVQSIIRSYQTRGHSICELDPLGILAADLDTEIPKDLLIESYNLG------EGDLDRVFRLPHTTYIGGNEAVLPLREIIRRLQNVYCRSIGVEFMFINNLQQTDWIRRRFETPGIMQFSKEEKRLIMARVIRSTRFEEFLARKWSSEKRFGLEGCEVLIPAMKTIIDASSALGVDSFIIGMPHRGRLNVLANVCRKPLEKIICQFDSKLEAADEGSGDVKYHLGMSHERLNRVTNKNIKIAVVANPSHLEAVDPVVQGKARAEMFYRGDTDGKKVMPMLLHGDAAFAGQGIVYECLHLSDLPAFTTHGTIHIVVNNQIGFTTDPRFSRSSPYCTDVARVVNAPIFHVNADDPEAVIYVCKVAADWRATFGKDVVIDLVCYRRFGHNEIDEPMFTQPLMYKKIAKQPTVLVKYAEHLINSGALAQQEYEEEISKYDKICEEAYGLAKKETAVSNIDWLDSPWKGFFEGRDPMVLPTTGVSEDVLKHIGTVFSTPPEEFVIHGGLKRVLKSRAEMVAARQVDWALGEALAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQTIDKKTVIPLNNLYPDQATYTVCNSSLSEYGVLGFEVGYSITNPNALVIWEAQFGDFANTAQCIIDQFISSGQAKWVRQSGIVLLLPHGFEGMGPEHSSARLERFLQLSNDDPDYFPPEGSNFEIQQLHETNWIVGNFTTPANFFHAMRRQIALSFRKPLVVCTPKSLLRLPEARSSFDDMIDGTRFQRLIPESGISAKNPEKVKKIIFCTGKIYYELVKERETKNLQEEIAISRVEQLTPFPFDLIKQELEKYPKARLCWAQEEHKNAGAWSYIRPRIKTVLR-KQGVYR--KVEYAGRFSSAAAATGNKQMHLMELSQLYEAAM 1015          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. TrEMBL
Match: A0A4S2LH84 (Transket_pyr domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007190 PE=4 SV=1)

HSP 1 Score: 1403.65 bits (3632), Expect = 0.000e+0
Identity = 666/1037 (64.22%), Postives = 798/1037 (76.95%), Query Frame = 1
Query:  172 NSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPP-------------------------------FGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            ++V+      E FLNG SS Y+E++Y +WLENP+SVHK               SW++YF +V+ GAA G+A++PPP    +L +   F     +              D  TIE+HLAVQAIIRSYQ+ GH  + LDPLGILSADLDD++P EL+L  YN        EP LDK F LP TT+IGG   ELTLREII RLE  YC+HIGVE+MFIN LNKCDWIRRKFETPG + F+ EEKRLI+AR+IR+TRFE F AKKWS+EKRFG+EGCE+LIP++KTVID SS LGV+SF IGMPHRGRLNVLANVCRKPLE +FCQFDS+LE +DEGSGDVKYHLGMSH RIN +  K I +AVCANPSHLEAVDPV+QGKT AEQ+Y  D +G+K MSI+LHGDA+FCGQGVVFETFHLSDLPSYST GTIHIVVNNQIGFTTDPR+ARSSPYCTDVARVTN+ I HVNADDPEAV  VSKVAAEWR+EFSKDVVIDLVCYRR GHNEMDEPMFTQPLMYK+I  QPTVL+QY +KL+ E +V+  +Y+ EIEKYDKICE+AY LAKK+T   NR WLDSPW GFF+ +DPM +P TGV+ SVL+H+ + +S  PE   IH GLKR+L+ER +   + MANWALGE FA+GSLLK G HVRLSG+DVERGTFSHRH+VLHDQ  D   +VPLN+L+  QA F+V NSSLSEYAV+GFELG+S T+PN+LVIWEAQFGDF N AQCI+DQFI+SGQ KWVRQSGLV+LLPHGYEGMGPEHSSAR+ERFLQMS+DD+ ++P                                F +HF +QQLH+ NW V NCTTPAN+FH+LRRQ+LL FRKPL+  TPKSLLR P+ KS + +M+  ++FKR IPE+G A +NP+ V+K+ILCSGKVYY+L+K+R    L   IAI RVEQ++PFPYDLL  +L  Y EA ++WVQEEHKNMGAW YV+PRVN+LI++   +     ++Y GR  SA+ AAG+   HLME+S FM+QA++
Sbjct:   23 SAVRAQRVFKEPFLNGTSSNYLEDIYQAWLENPSSVHK---------------SWDIYFRRVAAGAAPGEAYTPPP----TLGRSSSFAAQSVSVSAQP---------DIKTIEDHLAVQAIIRSYQSLGHRSARLDPLGILSADLDDTVPPELSLNFYNLG------EPDLDKTFLLPPTTYIGGNKNELTLREIIKRLEEVYCQHIGVEFMFINSLNKCDWIRRKFETPGHLSFTPEEKRLILARVIRATRFEAFSAKKWSSEKRFGIEGCEMLIPALKTVIDTSSSLGVDSFVIGMPHRGRLNVLANVCRKPLEDIFCQFDSRLEAADEGSGDVKYHLGMSHSRINHVTQKTINLAVCANPSHLEAVDPVVQGKTKAEQFYRGDNEGRKVMSILLHGDASFCGQGVVFETFHLSDLPSYSTHGTIHIVVNNQIGFTTDPRMARSSPYCTDVARVTNSLILHVNADDPEAVTSVSKVAAEWRSEFSKDVVIDLVCYRRAGHNEMDEPMFTQPLMYKRIKQQPTVLDQYSKKLVAEGIVTEDEYKAEIEKYDKICEDAYELAKKQTVTYNRSWLDSPWHGFFEKRDPMFLPNTGVEISVLEHVARAISEPPEGMTIHPGLKRALRERHELSEQHMANWALGELFAYGSLLKEGCHVRLSGEDVERGTFSHRHSVLHDQNVDKKTYVPLNHLFPSQAPFTVCNSSLSEYAVMGFELGYSLTNPNALVIWEAQFGDFANVAQCIVDQFISSGQQKWVRQSGLVLLLPHGYEGMGPEHSSARIERFLQMSSDDEHHVPSENWQIPAPDQHLMPPVTEACQSCSATTAKFVFTDHFAMQQLHETNWIVANCTTPANLFHILRRQILLPFRKPLVLFTPKSLLRHPDCKSPWADMLPGSEFKRYIPESGDAAQNPKAVKKLILCSGKVYYDLVKQRNAVGLASDIAISRVEQLTPFPYDLLKADLELYPEARIEWVQEEHKNMGAWTYVQPRVNHLIEIAFADRLHKNLTYTGRQTSASTAAGHNATHLMEMSLFMKQALT 1025          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Cavefish
Match: ogdhb (oxoglutarate dehydrogenase [Source:NCBI gene;Acc:103040949])

HSP 1 Score: 1278.85 bits (3308), Expect = 0.000e+0
Identity = 625/1050 (59.52%), Postives = 762/1050 (72.57%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNY-------------GFPIFKNSVKNSSA--SAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD---NKDPMKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEH-FEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            M+++R  A + R L + +             G P     ++  +A  +AE FLNG SS Y+EEMY SWLENP SVH               KSW+++F   + GA+ G A+  PP    +L           + +    + +  +   +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P ++              E  LDKVFRLPTTT IGG    L LREII RLE AYC+HIGVE+MFINDL +C WIR KFE PG+M+F+ EEKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS+ GVES  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D +GK+ MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLV YRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E  V+  +Y+EE+  YDKICEEAY  +K E  +  + WLDSPW GFF        M  P TG+ E  LQHIGKV SSVP E+F IH GL R LK R   +  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N +   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   E+ F +QQL+D NW VVNC+TPAN FHVLRRQ+L  FRKPLI  TPKSLLR PEAKSSFD+M+  T FKRLIPE G A++NP  V+++I C+GKVYY+L KER+ R +++ +AI R+EQ+SPFP+DL+  E+ K+ +A V W QEEHKN G + Y++PR++  I     NH  P + Y GR P+AA A GNK  HL+E+ +F+  A +
Sbjct:    1 MHRLRTCAARLRPLAAPHIALNFSHRRPAAAGLPRTFQPIRCYTAPVAAEPFLNGTSSNYVEEMYYSWLENPKSVH---------------KSWDIFFRNANAGASPGAAYQSPPPLGVNL-----------SGLSQAQALVGTQPSVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPMDIITSSEKLGF-YGLNEADLDKVFRLPTTTFIGGSESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIREKFEKPGVMQFTLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDKSSENGVESVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLMANPSHLEAVDPVVQGKTKAEQFYCGDTEGKRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVSYRRNGHNEMDEPMFTQPLMYKQIKKQKPVLQKYAEKLIAEGTVTRLEYEEEVAIYDKICEEAYTRSKDEKILHIKHWLDSPWPGFFTLEGQPKSMSCPSTGLKEEDLQHIGKVASSVPVEDFTIHGGLTRILKGRAAMVESRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNYIDPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVFPKTSENEFAMQQLYDCNWIVVNCSTPANYFHVLRRQILQPFRKPLIIFTPKSLLRHPEAKSSFDDMVDGTHFKRLIPEEGAASQNPAGVKRIIFCTGKVYYDLTKERKSRGMEETVAIARIEQLSPFPFDLVKAEIEKFPQAEVMWSQEEHKNQGYYDYIKPRISTTI-----NHAHP-VRYAGREPAAAPATGNKKAHLLELERFLNTAFN 1017          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Cavefish
Match: ogdhl (oxoglutarate dehydrogenase like [Source:NCBI gene;Acc:103043721])

HSP 1 Score: 1266.14 bits (3275), Expect = 0.000e+0
Identity = 622/1017 (61.16%), Postives = 760/1017 (74.73%), Query Frame = 1
Query:  154 GFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHE-IVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKEL--TLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD-NKDP--MKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQA 3183
            G  +F      SS + +   +  SS Y+EEMY SWLE+P +VH               +SW+ YF      +   +A    P+ +                      +L+    + Q  +E+HLAV  +IR+YQ RGH+V+ LDPLGIL+AD+D  +P +L  T+    F       E  LDK F+LP+TT IGG    L LREII RLE +YC HIGVE+MFIN++ +C WIR+KFE+PGIMKF+++EKR ++ARL+RSTRFE+FLA+KWS+EKRFGLEGCEVLIP++K +ID SS  G+ES  +GMPHRGRLNVLANV RK L+Q+FCQFD KLE +DEGSGDVKYHLGM H+RINR  +K I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D +GKK MSI++HGDAAF GQGVV+ETFHLS+LPSY+T+GTIH+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV++V +VAAEWR+ F+KDVVIDLVCYRRFGHNEMDEPMFTQPLMYK+I  Q  VL +Y +KLI+E VV+ Q+++EE+ KYDKICEEAY  +K E  +  R WLDSPW  FF    +P  M  P TG++E VL+HIGK  SSVP ++F+IHSGL R L+ R   IS+R  +WAL E  AFGSLLK  IHVRLSGQDVERGTFSHRH VLHDQE D    VP+N+L+  QA ++V NSSLSEY VLGFELGF+  +PN+LV WEAQFGDF+NTAQCIIDQFI+SGQ+KWVR +G+V+LLPHG EGMGPEHSSAR ERFLQMS DD D  P F   FEVQQL D NW VVNC+TPAN FHVLRRQ+LL FRKPLI  TPKSLLRLPEA+SSFDEM  +TKF+R+IP+ G A++NP KV++VI C+GKVYYEL KER++  L+D +AI+R+EQISPFP+DL+  E+ K+  A + W QEEHKNMG + YV PR   ++  K P      I YVGR P+AA A GNKF HL E+ +FM  A
Sbjct:   25 GRQVFNPHRGCSSRATQPSPSALSSSYVEEMYYSWLEDPKNVH---------------ESWDAYFRNAQASSPAAEAEERRPSTLLQ------------------GRALSQTPAMSQKVVEDHLAVHNLIRAYQIRGHHVAQLDPLGILTADVDSFVPSDLITTIDKLGF---YGLDESDLDKTFQLPSTTFIGGQQTTLPLREIIRRLETSYCGHIGVEFMFINNVEQCQWIRQKFESPGIMKFTEKEKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVLIPALKMIIDKSSAAGIESVIMGMPHRGRLNVLANVVRKDLDQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRETDKDITLSLMANPSHLEAVDPVVQGKTKAEQFYRGDTEGKKVMSILMHGDAAFAGQGVVYETFHLSELPSYTTQGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMHVCRVAAEWRSTFNKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKQIRKQEHVLKKYADKLISEGVVTLQEFEEEVAKYDKICEEAYTSSKDEKILHIRHWLDSPWPNFFTIEGEPKRMSYPPTGLNEEVLKHIGKTASSVPLQDFSIHSGLSRILRGRSDMISKRTVDWALAEYMAFGSLLKDEIHVRLSGQDVERGTFSHRHHVLHDQEVDKRFCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGFAMANPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRNNGIVLLLPHGMEGMGPEHSSARPERFLQMSKDDPDRYPEFTGDFEVQQLFDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRLPEARSSFDEMTTETKFRRIIPDEGSASKNPSKVKRVIFCTGKVYYELAKERKQLKLEDVVAIVRLEQISPFPFDLIKAEVEKHPNAELIWCQEEHKNMGYYDYVRPRFLTVLSNKKP------IWYVGRDPAAAPATGNKFTHLAELKRFMDTA 999          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Cavefish
Match: OGDH (2-oxoglutarate dehydrogenase, mitochondrial [Source:NCBI gene;Acc:103029395])

HSP 1 Score: 1265.37 bits (3273), Expect = 0.000e+0
Identity = 614/1006 (61.03%), Postives = 740/1006 (73.56%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD---NKDPMKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
             +  +AE FLNG SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  PP    SL +                S +  +   +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGI+ ADLD S+P ++              E  LDKVFRLPTTT IGG    L LREII RLE +YC+HIGVE+MFINDL +C WIR+KFETPG M+FS EEKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS  GVE+  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEAV+PV+QGKT AEQ+Y  D  G + MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLV YRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E VV+ Q+Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF        M  P TG+ E  L HIG+V SSVP E+F IH GL R LK R + I  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N++   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   + F V+QL+D NW VVNC+TPAN FHVLRRQ+L  FRKPLI  TPKSLLR PEAKS+FD M+  T F+RLI E G A +NP +V+++I C+GKVYYEL +ER+ R+++D +AI R+EQ+SPFP+DL+  E  KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A G+K  HLME+ +F+  A +
Sbjct:   42 TAPVAAEPFLNGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGAPPGTAYQSPPPLGVSLAEL-----------TQAQSLVGAQPNVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSSVPTDIITSSDKLGF-YGLDESDLDKVFRLPTTTFIGGTESALPLREIIRRLEMSYCQHIGVEFMFINDLEQCQWIRQKFETPGAMQFSLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDRSSANGVENVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAVNPVVQGKTKAEQFYCGDTDGNRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVSYRRNGHNEMDEPMFTQPLMYKQIKKQKPVLQKYAEKLIAEGVVTRQEYEEEIAKYDKICEEAHARSKDEKILHIKHWLDSPWPGFFTLDGQPKSMSCPSTGLTEEELAHIGQVASSVPVEDFTIHGGLSRILKGRGEMIKNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHVAPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVFPKITDDFAVRQLYDCNWIVVNCSTPANYFHVLRRQILQPFRKPLIVFTPKSLLRHPEAKSNFDLMLPGTHFQRLIVEEGSAAQNPSEVKRLIFCTGKVYYELTRERKTRNMEDTVAIARIEQLSPFPFDLVKAETEKYPNADLVWCQEEHKNQGYYDYVKPRMRTTID------RVKPVWYAGREPAAAPATGSKNSHLMELKRFLDTAFN 1014          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Cavefish
Match: OGDH (2-oxoglutarate dehydrogenase, mitochondrial [Source:NCBI gene;Acc:103029395])

HSP 1 Score: 1263.83 bits (3269), Expect = 0.000e+0
Identity = 618/1020 (60.59%), Postives = 744/1020 (72.94%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKE-------LTLKHYNFALE-------QNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD---NKDPMKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
             +  +AE FLNG SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  PP    SL +                S +  +   +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGI+ ADLD S+P +       L L H+   L            E  LDKVFRLPTTT IGG    L LREII RLE +YC+HIGVE+MFINDL +C WIR+KFETPG M+FS EEKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS  GVE+  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEAV+PV+QGKT AEQ+Y  D  G + MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLV YRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E VV+ Q+Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF        M  P TG+ E  L HIG+V SSVP E+F IH GL R LK R + I  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N++   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   + F V+QL+D NW VVNC+TPAN FHVLRRQ+L  FRKPLI  TPKSLLR PEAKS+FD M+  T F+RLI E G A +NP +V+++I C+GKVYYEL +ER+ R+++D +AI R+EQ+SPFP+DL+  E  KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A G+K  HLME+ +F+  A +
Sbjct:   42 TAPVAAEPFLNGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGAPPGTAYQSPPPLGVSLAEL-----------TQAQSLVGAQPNVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSSVPTDIITSSDKLDLTHFKERLSVLTVGGFYGLDESDLDKVFRLPTTTFIGGTESALPLREIIRRLEMSYCQHIGVEFMFINDLEQCQWIRQKFETPGAMQFSLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDRSSANGVENVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAVNPVVQGKTKAEQFYCGDTDGNRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVSYRRNGHNEMDEPMFTQPLMYKQIKKQKPVLQKYAEKLIAEGVVTRQEYEEEIAKYDKICEEAHARSKDEKILHIKHWLDSPWPGFFTLDGQPKSMSCPSTGLTEEELAHIGQVASSVPVEDFTIHGGLSRILKGRGEMIKNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHVAPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVFPKITDDFAVRQLYDCNWIVVNCSTPANYFHVLRRQILQPFRKPLIVFTPKSLLRHPEAKSNFDLMLPGTHFQRLIVEEGSAAQNPSEVKRLIFCTGKVYYELTRERKTRNMEDTVAIARIEQLSPFPFDLVKAETEKYPNADLVWCQEEHKNQGYYDYVKPRMRTTID------RVKPVWYAGREPAAAPATGSKNSHLMELKRFLDTAFN 1029          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Cavefish
Match: OGDH (2-oxoglutarate dehydrogenase, mitochondrial [Source:NCBI gene;Acc:103029395])

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 620/1037 (59.79%), Postives = 749/1037 (72.23%), Query Frame = 1
Query:  184 NSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKE-------LTLKHY---------------------NFALEQNF---REPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD---NKDPMKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
             +  +AE FLNG SS Y+EEMY +WLENP SVHK               SW+++F   + GA  G A+  PP    SL +                S +  +   +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGI+ ADLD S+P +       L L H+                     + A+E+ F    E  LDKVFRLPTTT IGG    L LREII RLE +YC+HIGVE+MFINDL +C WIR+KFETPG M+FS EEKR ++AR++RSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS  GVE+  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEAV+PV+QGKT AEQ+Y  D  G + MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+V NNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV  VAAEWR  F KDVV+DLV YRR GHNEMDEPMFTQPLMYK+I  Q  VL +Y EKLI E VV+ Q+Y+EEI KYDKICEEA+  +K E  +  + WLDSPW GFF        M  P TG+ E  L HIG+V SSVP E+F IH GL R LK R + I  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N++   QA ++V NSSLSEY VLGFELGF+   PN+LV+WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D  P   + F V+QL+D NW VVNC+TPAN FHVLRRQ+L  FRKPLI  TPKSLLR PEAKS+FD M+  T F+RLI E G A +NP +V+++I C+GKVYYEL +ER+ R+++D +AI R+EQ+SPFP+DL+  E  KY  A + W QEEHKN G + YV+PR+   I       R   + Y GR P+AA A G+K  HLME+ +F+  A +
Sbjct:   42 TAPVAAEPFLNGTSSNYVEEMYYAWLENPKSVHK---------------SWDIFFRNANAGAPPGTAYQSPPPLGVSLAEL-----------TQAQSLVGAQPNVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSSVPTDIITSSDKLDLTHFKERLSVLTVGESDCKSHFTEISQAIERGFYGLDESDLDKVFRLPTTTFIGGTESALPLREIIRRLEMSYCQHIGVEFMFINDLEQCQWIRQKFETPGAMQFSLEEKRTLLARMVRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDRSSANGVENVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAVNPVVQGKTKAEQFYCGDTDGNRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVANNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVSYRRNGHNEMDEPMFTQPLMYKQIKKQKPVLQKYAEKLIAEGVVTRQEYEEEIAKYDKICEEAHARSKDEKILHIKHWLDSPWPGFFTLDGQPKSMSCPSTGLTEEELAHIGQVASSVPVEDFTIHGGLSRILKGRGEMIKNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHVAPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVFPKITDDFAVRQLYDCNWIVVNCSTPANYFHVLRRQILQPFRKPLIVFTPKSLLRHPEAKSNFDLMLPGTHFQRLIVEEGSAAQNPSEVKRLIFCTGKVYYELTRERKTRNMEDTVAIARIEQLSPFPFDLVKAETEKYPNADLVWCQEEHKNQGYYDYVKPRMRTTID------RVKPVWYAGREPAAAPATGSKNSHLMELKRFLDTAFN 1046          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Sea Lamprey
Match: ogdhb (oxoglutarate (alpha-ketoglutarate) dehydrogenase b (lipoamide) [Source:ZFIN;Acc:ZDB-GENE-090311-8])

HSP 1 Score: 1109.75 bits (2869), Expect = 0.000e+0
Identity = 514/846 (60.76%), Postives = 649/846 (76.71%), Query Frame = 1
Query:  667 NFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHR--GRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD---NKDPMKIPITGVDESVLQHIGKVVSSVPE-NFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAI 3186
             F E  LD+  +LP TT IGG   +LTLR+I+ RL++ YC  IGVE+MFIND  +C WIR++FE PG    +  EK+ ++ RL+R+TRFEEFLAKKWS+EKRFG+EGCE+L+P+++T++D SS +GV++  +GMPHR  GRLNVL NV RK L+++FCQFDSKLEP +EGSGDVKYHLGMSH+ INR++ + +K+++ ANPSHLEAV PV+QGKT AEQ+Y  D +GK+ MS+++HGDAAF GQGVV+ETFHLSDLP+Y+T GTIH+V   +IGFTTDPR +RSSPYCTDVARV NAPIFHVNADDPEAV +V +VAAEWRN F KDVV+DLV YRR GHNE+DEPMFTQP MYK++  Q  VL QY + LI E V++ Q+Y+ E+ K+D+ICE+AY  +K E   R  +W+DSPW GFF        M  P +GV E +L+HIGK  SSVP  +FNIH GL R L+ R + +  R A+WAL E  AFGSLLK G+HVRLSGQDVERGTFSHRH VLHDQ  D    VP+ NL+  QA ++V NSSLSEY VLGFELGF+ + P++LV WEAQFGDFNN AQCIIDQFI+SGQ+KW+RQ+G+V+LLPHG EGMGPEHSSARLERFLQM  DD D  P  GEHF+V+Q+ + NW V NC+TPAN FH+LRRQ+LL FRKPLI  TPKSLLRLPEA+SSF +M+  T F+R+IPE G A + P +V ++I C GKVYY+L++ER+ R +Q  +AI R+EQ+SPFP+DL+ +E  +Y  A + W QEEHKN G + +V PRV   I    P      + YVGR  ++A A GNK++H ME  +F+ +A 
Sbjct:    8 GFLESDLDQTLKLPNTTFIGGDRSDLTLRDILQRLKDVYCGSIGVEFMFINDREQCQWIRQRFEVPGAGTLTPAEKKQLLIRLLRATRFEEFLAKKWSSEKRFGVEGCEMLVPALRTIVDCSSVMGVDAITLGMPHRFRGRLNVLVNVIRKGLDEVFCQFDSKLEPQEEGSGDVKYHLGMSHQHINRLSGRKLKLSLVANPSHLEAVGPVVQGKTRAEQFYRGDTEGKQVMSVLIHGDAAFAGQGVVYETFHLSDLPAYTTHGTIHLVHARKIGFTTDPRSSRSSPYCTDVARVVNAPIFHVNADDPEAVTHVCRVAAEWRNTFHKDVVVDLVGYRRNGHNEVDEPMFTQPFMYKRVARQVPVLKQYSDALIKEGVITGQEYKTEVSKFDQICEDAYASSKDEKLQRTSQWIDSPWHGFFGPDGRPQSMWTPPSGVPEEILEHIGKAASSVPAPDFNIHPGLMRVLRSRAEMVKNRTADWALAEYMAFGSLLKEGVHVRLSGQDVERGTFSHRHHVLHDQNVDKKTLVPMKNLWPSQAPYTVCNSSLSEYGVLGFELGFAMSSPHALVCWEAQFGDFNNMAQCIIDQFISSGQAKWLRQNGIVLLLPHGMEGMGPEHSSARLERFLQMCTDDPDVFPKIGEHFDVRQIFESNWTVANCSTPANYFHILRRQILLPFRKPLILATPKSLLRLPEARSSFADMMPGTSFRRVIPEEGPAAKGPGEVRRLIFCCGKVYYDLVRERDARGMQGLVAICRLEQLSPFPHDLVRDEALRYPAAELVWCQEEHKNQGFFAHVHPRVRTAISQSRP------LWYVGRDAASAPATGNKYLHNMESERFLAKAF 847          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Sea Lamprey
Match: dhtkd1 (dehydrogenase E1 and transketolase domain containing 1 [Source:NCBI gene;Acc:494076])

HSP 1 Score: 240.736 bits (613), Expect = 2.862e-71
Identity = 130/357 (36.41%), Postives = 205/357 (57.42%), Query Frame = 1
Query:  739 ELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGS----GDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKD---------KQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREK 1770
            E TL  ++  L+++YC  I VE   +    + +W+  + E      F  EE+RL+   ++ S  F+ F+A K++  KR+G EG E ++P        ++  G+    + MPHRGRLN+LA + + P E +F +    L    EG+    GDV  HL  +   +     + ++VA+  NPSHLEAV+PV  GK    Q   ++         + G +   + +HGDAAF GQG+V ETF L+ LP Y   G++H++VNNQ+GFTT     RSS Y +D+ +V    + HVN D+ E VV  +++A ++R+ F +DV++DL+CYR++GHNE+D+P  T P MY  I S+ +V + Y ++
Sbjct:    5 EATLDHLLRFLQDSYCGAIAVETAQLASAEEREWLAERVERLRGETFPPEERRLLATLMLESQAFDNFVATKFATVKRYGGEGAEAMLPFFHETFRHAALSGLSDLVLAMPHRGRLNLLAGLLQLPPEIMFRKMRG-LSEFPEGTRGAVGDVLSHLTATLD-VEAAPGRSVRVALLPNPSHLEAVNPVAVGKARGRQRTRREGHYSGEPGARPGDRVACLQVHGDAAFAGQGIVAETFTLAYLPHYDVGGSVHLIVNNQLGFTTPCEWGRSSLYSSDMGKVVGCAVVHVNGDEVEEVVRAARLAMDYRHRFRRDVIVDLLCYRQWGHNELDDPTVTNPAMYGLIRSRKSVPDSYAKR 359          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Yeast
Match: KGD1 (Subunit of the mitochondrial alpha-ketoglutarate dehydrogenase complex; catalyzes a key step in the tricarboxylic acid (TCA) cycle, the oxidative decarboxylation of alpha-ketoglutarate to form succinyl-CoA [Source:SGD;Acc:S000001387])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 459/1013 (45.31%), Postives = 644/1013 (63.57%), Query Frame = 1
Query:  187 SSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSK-GAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGI-LSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSD-EGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKD-KQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPI-------TGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFI-SERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIP--ETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDR-IAIIRVEQISPFPYDLLHEELNKYSE-AAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMR 3177
            ++   ++FL+  ++ YI+EMY +W ++P+SVH                SW+ YF  +S       +AF  PP+ + + P+        GT    + +++T  + +  +I  HL VQ + R+YQ RGH  + +DPLGI   ++ ++ +P ELTL +Y F+     +E +L     LP       G  +++L+EI+  LE  YC   GV+Y  I    KCDW+R + E P   +++ ++KR I+ RL  +T FE FL+ K+  +KRFGLEG E ++P +KT++D S +LGVE   +GM HRGRLNVL+NV RKP E +F +F       D EGSGDVKYHLGM+++R    + K + +++ ANPSHLE+ DPV+ G+T A  +   D K+  KA+ ++LHGDAAF GQGVV+ET     LP YST GTIH++ NNQIGFTTDPR ARS+PY +D+A+  +APIFHVNA+D EAV ++  +AAEWR++F  D +ID+V +R+ GHNE D+P FTQPLMYKKI  Q +V++ Y EKLI+E   S +   E  +    + E+A+  A K+     REWL + W+GF   K P ++         T V ES L+ +GKV+SS PE F +H  LKR LK R + I +    +WA GEA AFG+L+  G +VR+SG+DVERGTFS RH VLHDQ+ +  ++ PL+ L   +A+F+++NSSLSEY V+GFE G+S T P+ LV+WEAQFGDF NTAQ IIDQFIA G+ KW ++SGLV+ LPHGY+G GPEHSS RLERFLQ++N+D  Y P   E    +Q  D N+ VV  TTPAN+FH+LRRQ    FRKPL     K LLR P A+SS  E   +  F+ +I   E G +    E+ ++++L SG+VY  L K RE  SL D+  A +++EQ+ PFP+  L + LN Y     + W QEE  NMG+W Y EPR++  +K +   ++  K+ Y GR PS A AAG+K +HL E   F++
Sbjct:   37 ATTGTDNFLSTSNATYIDEMYQAWQKDPSSVHV---------------SWDAYFKNMSNPKIPATKAFQAPPS-ISNFPQ--------GTEAAPLGTAMTGSVDENVSI--HLKVQLLCRAYQVRGHLKAHIDPLGISFGSNKNNPVPPELTLDYYGFSKHDLDKEINLGPGI-LPRFAR--DGKSKMSLKEIVDHLEKLYCSSYGVQYTHIPSKQKCDWLRERIEIPEPYQYTVDQKRQILDRLTWATSFESFLSTKFPNDKRFGLEGLESVVPGIKTLVDRSVELGVEDIVLGMAHRGRLNVLSNVVRKPNESIFSEFKGSSARDDIEGSGDVKYHLGMNYQRPT-TSGKYVNLSLVANPSHLESQDPVVLGRTRALLHAKNDLKEKTKALGVLLHGDAAFAGQGVVYETMGFLTLPEYSTGGTIHVITNNQIGFTTDPRFARSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKA-KDYVPSQREWLTAAWEGF---KSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILKNRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAVLHDQQSE-AIYTPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFP--SEEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLSEFT-EGGFQWIIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRE--SLGDKTTAFLKIEQLHPFPFAQLRDSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLK-ETDKYKDFKVRYCGRNPSGAVAAGSKSLHLAEEDAFLK 1008          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Yeast
Match: PDA1 (E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex; catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA; phosphorylated; regulated by glucose; PDH complex is concentrated in spots within the mitochondrial matrix, often near the ERMES complex and near peroxisomes [Source:SGD;Acc:S000000980])

HSP 1 Score: 54.299 bits (129), Expect = 6.336e-8
Identity = 46/141 (32.62%), Postives = 64/141 (45.39%), Query Frame = 1
Query: 1285 PVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFT 1707
            P+  G  +A QY N+D     A S  L+GD A   QG VFE+F+++ L +      +    NN+ G  T    +RSS       R    P   VN  D  AV   SK A +W       +V++   YR  GH+ M +P  T
Sbjct:  192 PLGAGLAFAHQYKNED-----ACSFTLYGDGA-SNQGQVFESFNMAKLWNLPV---VFCCENNKYGMGT--AASRSSAMTEYFKRGQYIPGLKVNGMDILAVYQASKFAKDWCLSGKGPLVLEYETYRYGGHS-MSDPGTT 320          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Nematostella
Match: EDO37169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGK7])

HSP 1 Score: 1249.57 bits (3232), Expect = 0.000e+0
Identity = 610/989 (61.68%), Postives = 734/989 (74.22%), Query Frame = 1
Query:  244 MYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTI----EEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGG-GAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKET-AIRNREWLDSPWDGFF-DNKDPMKIPITGVDESVLQHIGKVVSSVPE-NFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAI 3186
            MY SWLE+P SVH+               SW+ YF  VS G   GQA+ PPP     +                  ++     VDQS I    E+HLAV ++IRSYQ RGH  + LDPLGIL ADL++  P +L ++++         E  LDKVFRLP +T IGG  A  LTLR+I+ RLE  YC H+G+++MFI +  KCDWIR+KFE PG    + +EKR ++ARL+RST FE FLA+KWS+EKRFGLEGC+VL+P+MK +ID SS+LGVES  +GMPHRGRL+VLANVCRKPLEQ+F QFD  LEPSDEGSGDVKYHLGMSH+R+NR  NK+I++AV ANPSHLEAV+PV+QGKT AEQ+Y  D +GK+ MSI+LHGDAAF GQGVV+ETFHLS LP Y+T GTIHIVVNNQIGFTTDPR +RSS YCTDVA+V +APIFHVNADDPEAV+YV KVAAEWR EF+KDVVIDLVCYRR GHNE D PMFTQPLMYK+I  Q  VLN Y EKLI E +V+S + QEEI KY+KICEEA++ AK E   ++NR+WLDSPW GFF  N +   I  TG+    ++HIGK  S+ P+ +F IH GL+R LK R   +S    +WA+GEA AFGSLL  GIHVRLSGQDVERGTFSHRH +LH QEKD +++ PLN+L A QA ++V NSSLSEYAVLGFELGFS T+P +L++WEAQFGDFNNTAQCIIDQFI+SGQ KWVRQ+GLVMLLPHGYEGMGPEHSSAR ERFLQMSNDD D+ PP GE FEV QL   NW V+NC+TPA+MFH LRRQ+ + FRKPL+  TPKSLLRL  A+S  DEM   T F+R+IP+ G A+ENPEKV K++LC+GK+YYEL KER +R L + IAI R+EQISPFP+DLL  E +KY  A + W QEE KNMG W YV PR+   +       +  KISY GR  SA+ A GNK  H  E  + ++ A+
Sbjct:    1 MYASWLEDPKSVHR---------------SWDAYFRNVSLGKPPGQAYYPPPVLGKPV----------------AVATAMPSAVDQSNITAIVEDHLAVYSMIRSYQIRGHRKAMLDPLGILEADLNEDTPPDLKMEYWGLG------EQDLDKVFRLPNSTFIGGESATALTLRDIVDRLEKTYCHHVGLDFMFIPEKYKCDWIRKKFEMPGHDVLTRDEKRTLLARLVRSTGFEGFLARKWSSEKRFGLEGCDVLVPAMKAIIDKSSELGVESVVMGMPHRGRLDVLANVCRKPLEQIFTQFDPTLEPSDEGSGDVKYHLGMSHQRLNRGTNKIIQLAVVANPSHLEAVNPVVQGKTKAEQFYRGDARGKEVMSILLHGDAAFSGQGVVYETFHLSALPHYTTHGTIHIVVNNQIGFTTDPRYSRSSAYCTDVAKVVDAPIFHVNADDPEAVMYVCKVAAEWRAEFNKDVVIDLVCYRRNGHNEGDNPMFTQPLMYKRIAKQTQVLNSYSEKLIAEGIVTSAEVQEEIAKYEKICEEAFIEAKSEKRVLKNRDWLDSPWKGFFPKNYEVTAIKPTGITLDRIKHIGKTFSTPPDGDFKIHGGLRRILKARADLLSNGYVDWAMGEALAFGSLLMEGIHVRLSGQDVERGTFSHRHHILHCQEKDKLLYCPLNDLSADQAVYTVCNSSLSEYAVLGFELGFSMTNPYALIVWEAQFGDFNNTAQCIIDQFISSGQDKWVRQTGLVMLLPHGYEGMGPEHSSARPERFLQMSNDDPDFFPPEGELFEVNQLMSANWLVLNCSTPASMFHALRRQMAMDFRKPLVIFTPKSLLRLEAARSHVDEMADGTSFRRIIPDEGPASENPEKVRKLLLCTGKIYYELFKERSKRGLTEDIAITRLEQISPFPFDLLKAEAHKYRNAEIVWAQEEPKNMGYWGYVRPRLETTVG------KAGKISYAGRATSASTATGNKHQHTSEQEELIKNAL 946          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Nematostella
Match: EDO27159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA13])

HSP 1 Score: 421.779 bits (1083), Expect = 1.995e-134
Identity = 256/708 (36.16%), Postives = 376/708 (53.11%), Query Frame = 1
Query:  205 SFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIM-KFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEG-SGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDP--MKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKER-EQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGF 2313
            SFLN   + +  ++Y+ +L+NP +V                 SW  +F    +G      FS P   + ++                   +  +E  ++  +++   V  +I  Y+ RGH  +  +P+        +      TL   NF L Q+     L  VF      ++    Q  TL +II  LE+ YC  IG+EYM+I D    +WI+ + +      +FS ++K+ I+ +L  +  FE FL  K+  +KRF LEGCE  IP++  +I+ +++ GVE F +GM HRGRLNVLAN+  K  + +F +FD K    D    GDVKYHLG++  R    + K I + +  NPSHLE V  V++G   A+Q  N      K + I +HGDAA  GQG+V+E   ++ L  Y T GTIH+V+NNQ+GFTT+   ARSS YCTDVA+VT +P+ HVNADD EAVV+    A ++R EF  DV IDL+ YR++GHNE DEP FTQP++YK I       + Y EKL    V+ +   +E  EKY    +E    ++K+       ++ + W GF    D   +K   T  D+  L  I K ++ +P +    S + + +  R E +       W +GE  A+GSLL  G  VR+SGQDVERGTFSHRH V+  +  +  V + LN++   +  F + NS LSEY V+GF
Sbjct:    5 SFLNAAHTAFFADLYDQYLQNPDTVEP---------------SWRSFF----QGFDFASEFSSPVEQLSAIAS---------------GGATVNENAEK--LQKEFNVLKLIEGYRTRGHLFTKTNPV-------RERRTYSPTLAIENFGLSQS----DLTTVFDAAKLVNM----QPSTLADIIKHLESVYCSSIGIEYMYIRDPKVQEWIKNRLDVNDNQPQFSTDKKKNILKKLNEAVSFETFLHTKYVGQKRFSLEGCESAIPALDALIEGAAERGVEQFVMGMAHRGRLNVLANIFGKNTQNIFSEFDGKDYDDDMYFDGDVKYHLGLTSDRTT-TSGKKINLNLAPNPSHLETVGAVIEGIARAKQDRNYPNDFSKVLPIAVHGDAAIAGQGIVYEIIQMAKLDGYKTGGTIHLVINNQVGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVVHAMLFALDYRMEFGSDVFIDLLGYRKYGHNEGDEPKFTQPILYKTIAKHKNARDIYAEKLKAAGVIDANYVKELEEKYKSDLDENLEESRKKDLTVITPFMQNEWTGFEQVSDDGMLKKVDTSFDKDKLTEIAKTITELPSDKKFISKISKIINARKEMYFETNQLYWEMGELLAYGSLLAEGYDVRISGQDVERGTFSHRHAVVKVEASEEEV-ILLNDIKDKKGNFYIYNSHLSEYGVVGF 659          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Nematostella
Match: EDO43034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZQ9])

HSP 1 Score: 350.517 bits (898), Expect = 3.868e-111
Identity = 186/374 (49.73%), Postives = 240/374 (64.17%), Query Frame = 1
Query: 2083 NWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEF-SVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAA-VQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            +WA  EA A GSLL  G H R+SGQDV RGTFSHRH +L DQ+ +  +++PLNNL   Q  F  V NS LSE  VLGFE G S  +PN L+IWEAQFGDF N AQ I+D F++SG++KW+ QSGLVMLLPHGY+G GPEHSS R+ERFLQM++  +          E      +N  +VN TTPA  FH+LR+Q++ +FRKPLI + PK LLRLP A S+  +M   T F   +P  G  + NP +V +V+ CSGK YY L+K RE+    D  AIIR+E ++PFP D + +E+ +Y  A    W QEEH+NMGAW +V PR  NL+ VKL        +YVGR   AA A G   +H  E  Q +  +  ++S
Sbjct:   27 DWATAEALALGSLLYQGFHARISGQDVGRGTFSHRHAMLIDQKTE-EMYIPLNNLREDQTGFLEVCNSHLSEEGVLGFEYGMSIENPNHLIIWEAQFGDFFNGAQIILDTFVSSGETKWLLQSGLVMLLPHGYDGAGPEHSSCRVERFLQMTDSKE----------EEADGDAVNMHIVNPTTPAQYFHLLRQQMMRNFRKPLIIVAPKLLLRLPAAMSTLHDMSPGTHF---MPVIGDTSMNPTEVRRVMFCSGKHYYSLLKRREKTGNTD-TAIIRLEALTPFPMDAIRDEMRRYPGAQEFVWSQEEHRNMGAWTFVAPRFQNLLGVKL--------AYVGRRELAAPAVGIGKLHAQEEEQVLGASFPSKS 377          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Nematostella
Match: EDO29023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4U0])

HSP 1 Score: 256.914 bits (655), Expect = 5.252e-77
Identity = 136/346 (39.31%), Postives = 200/346 (57.80%), Query Frame = 1
Query:  736 QELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQF--DSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQ-------YYNKDKQ---GKKA--MSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKI 1731
            +E TL+E+I RLE AYC  + VE   ++D N+  W+    E        +  ++ I   L+RS  F+ FL +K+   KR+  EG E ++         SS  G+    +GM HRGRLN+L  + + P+ Q+F +   +S+L P  + +GDV  HL  S   ++      + V +  NPSHLEA +PV+ GK    Q       Y  +DK    G KA    +++HGDA+F GQG+V ET  + +LP Y   GT+H++VNNQ+GFTT    ARSS Y +D+A++ + P  HVN + PE V   + +A E+R ++ KDVV+D+ CYRR+GHNE+D+P FT P MY  I
Sbjct:    7 KESTLKEVIGRLEKAYCGQLAVELHHLSDENEKLWLSDLVEKSTPCSMDNSRQKHIAKLLLRSEAFDNFLGRKFMTVKRYSGEGAESMMAFFDEFFLQSSKAGLNQVIMGMQHRGRLNLLTTILKYPVAQMFSKMKGNSELPPHVQATGDVLSHL-TSSVDLDYGGQDPLHVTMLPNPSHLEACNPVVAGKARGRQMTLKEGDYSIEDKDARIGDKASVTCLLVHGDASFAGQGIVSETLGMVNLPHYEVGGTVHLIVNNQVGFTTPADRARSSLYSSDIAKMIDCPTIHVNGNHPEEVARAAMLALEYRMKYRKDVVVDMFCYRRWGHNELDDPTFTNPAMYSVI 351          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Nematostella
Match: EDO36943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHA0])

HSP 1 Score: 107.842 bits (268), Expect = 5.623e-28
Identity = 50/87 (57.47%), Postives = 65/87 (74.71%), Query Frame = 1
Query: 2665 LLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQI 2925
            +LSF   L+  TPKSLLRL  A+S  DEM   T F+R+IP+ G A+ENPEKV K++LC+GK+YYEL KER +R L + IAI R+EQ+
Sbjct:    1 MLSFCVQLVIFTPKSLLRLEAARSHVDEMADGTSFRRIIPDEGPASENPEKVRKLLLCTGKIYYELFKERSKRGLTEDIAITRLEQV 87          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Medaka
Match: OGDH (2-oxoglutarate dehydrogenase, mitochondrial [Source:NCBI gene;Acc:101171674])

HSP 1 Score: 1275.38 bits (3299), Expect = 0.000e+0
Identity = 630/1052 (59.89%), Postives = 765/1052 (72.72%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGF-------PIFKNSVKNSSA-----------SAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFM-YSLPKYQYFXXXXXXXXXXXXSSLTHEIVD-QSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFD---NKDPMKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQA 3183
            M+++R  A + R L ++          PI   S  N+             ++E FLNG SS Y+EEMY +WLE+P SVHK               SW+V+F   + GA  G A+  P +    ++P+                SSL     + +  +E+HLAVQ++IR+YQ RGH+V+ LDPLGIL ADLD  +P ++              E  LDKVFRLPTTT IGG    L L+EII RLE AYC+HIGVE+MFINDL++C WIR+KFETPG+M+F+ EEKR ++AR+IRSTRFEEFL KKWSAEKRFGLEGCE LIPS+KT+ID SS+ GVE+  +GMPHRGRLNVLANV RK LEQ+FCQFDSKLE +DEGSGDVKYHLGM H+RINR+ ++ I +++ ANPSHLEAVDPV+QGKT AEQ+Y  D  GK+ MSI+LHGDAAF GQG+V+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TDVARV NAPIFHVNADDPEAV+YV KVAAEWR  F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL++Y EKLI E VVS Q+Y+EEI KYDKICEEAY  +K E  +  + WLDSPW GFF        M  P TG+ E  L HIG+V SSVP E+F IH GL R LK R + I  R  +WALGE  AFGSLLK GIHVRLSGQDVERGTFSHRH VLHDQ  D    +P+N++   QA ++V NSSLSEY VLGFELGF+   PN+L++WEAQFGDF+NTAQCIIDQFI  GQ+KWVRQ+G+V+LLPHG EGMGPEHSSAR ERFLQM NDD D +P   E F V+QL+D NW VVNC+ PAN FHV+RRQ+LL FRKPLI  TPKSLLRLPEA+SSFD+M+  T F+RLIP+ G+A E PE+V+++I C+GKVYYEL KER+ R ++  +AI R+EQ+SPFP+D +  E+ ++  A + W QEEHKN G + YV+PR+   I       R   + Y GR  +AA A GNK  HLME+ +F+  A
Sbjct:    1 MHRLRTCAARLRPLTASQAAQTVGQQRPITVASTGNTRTFQPIRCYSAPVASEPFLNGTSSNYVEEMYYAWLEDPKSVHK---------------SWDVFFRNANAGAPPGAAYQSPLSLSGLAVPQL---------------SSLVGAQPNVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSCVPTDIITSSDKLGF-YGLNESDLDKVFRLPTTTFIGGSETALPLKEIIRRLEMAYCQHIGVEFMFINDLDQCQWIRQKFETPGVMQFTPEEKRTLLARMIRSTRFEEFLQKKWSAEKRFGLEGCESLIPSLKTIIDKSSENGVENVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAVDPVVQGKTKAEQFYCGDNDGKRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCKVAAEWRATFHKDVVVDLVCYRRMGHNEMDEPMFTQPLMYKQIKKQKPVLHKYAEKLIAEGVVSRQEYEEEISKYDKICEEAYARSKDEKILHIKHWLDSPWPGFFTLDGQPKSMSCPSTGLGEEDLSHIGQVASSVPVEDFTIHGGLSRILKGRAEMIRNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHISPDQAPYTVCNSSLSEYGVLGFELGFAMASPNALILWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVMPNITEDFAVRQLYDCNWIVVNCSNPANYFHVMRRQILLPFRKPLIVFTPKSLLRLPEARSSFDDMLPGTHFQRLIPDGGVAAERPEEVKRLIFCTGKVYYELTKERKNRGMEGAVAIARMEQLSPFPFDQVKAEVERFCNADLVWCQEEHKNQGYYDYVKPRIRTTIS------RSKGVWYAGRESAAAPATGNKKAHLMELRRFLDTA 1015          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Medaka
Match: ogdhb (2-oxoglutarate dehydrogenase, mitochondrial [Source:NCBI gene;Acc:101160253])

HSP 1 Score: 1244.95 bits (3220), Expect = 0.000e+0
Identity = 604/1015 (59.51%), Postives = 750/1015 (73.89%), Query Frame = 1
Query:  154 GFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFF---DNKDPMKIPITGVDESVLQHIGKVVSSVP-ENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAI 3186
            G P     +K ++A   SF NG  S Y+EEMY +WLE+P SVHK               SW+VYF   + G+++G  +  PP+ M    + Q+    +    P+V          +  +E+HLAVQ++IR+YQ RGH+++ LDPLGI   D DD+ P  + L+  N  L+ +     +D++FR+P TT IGG    LTLREII RLE AYC+HIGVE+MFIND+ +C WIR++FETPGIM+F+ EEKR ++AR+IRSTRFEEFL +KWS+EKRFGLEGCE LIP++KT+ID SS  GVES  +GMPHRGRLNVLANV RK L+Q+FCQFDSKLE +DEGSGDVKYHLGM HKR+NR+++K I +++ ANPSHLEAVDPV+QGKT AEQ+Y+ D +GKK M I+LHGDAAF GQGVV+ETFHLSDLPSY+T GT+H+VVNNQIGFTTDPR+ARSSPY TD+ARV NAPIFHVN DDPEAV+YV  VAA+WRN F KDVV+DLVCYRR GHNEMDEPMFTQPLMYK+I  Q  VL ++ EKLITE VV++Q+Y+E+I  YDKICE+AY  +K E  +  + WLDSPW  FF        M  P TG+ E  L HIG + +SVP E+F IH GL R LK R   +++R+ +WAL E  AFGSLLK G+HVRLSGQDVERGTFSHRH VLHDQ  D  + +P+N +   QA ++V NS LSEY+VLGFELGF+   PN+LV+WEAQFGDFNNTAQCIIDQFI+SGQ+KWVRQ+G+V+LLPHG EGMGPEHSS R ERFLQM NDD D  P   E F   QL+D NW VVNC+TPAN FHVLRRQ+LLSFRKPL+  TPKSLLR PEAKSSFD+M+  T F+R+I + G A   PE V++V+LC+GKVYYEL +ER  R L   IA+IR+EQ+SPFP+DL+  E +++  A + W QEEHKN G + YV+PR+   +    P      I Y GR P+AA A GNK  H+ E+ + +  A+
Sbjct:   33 GTPPSARFLKTTAAPEPSF-NGTGSNYVEEMYAAWLEDPRSVHK---------------SWDVYFQNATAGSSMGVTYQSPPS-MSGSSEGQFAVQPLVGAQPSV----------EKLVEDHLAVQSLIRAYQVRGHHMAQLDPLGISCVDFDDT-PCPIGLQ--NVGLDSS----SMDRMFRIPKTTFIGGKESVLTLREIIRRLEMAYCQHIGVEFMFINDVEQCQWIRQRFETPGIMQFTVEEKRTLLARMIRSTRFEEFLQRKWSSEKRFGLEGCESLIPALKTIIDRSSQNGVESVIMGMPHRGRLNVLANVVRKDLDQIFCQFDSKLEAADEGSGDVKYHLGMYHKRMNRVSDKQITISLMANPSHLEAVDPVVQGKTKAEQFYSGDSEGKKVMPILLHGDAAFAGQGVVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDIARVVNAPIFHVNGDDPEAVMYVCGVAADWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIKKQKGVLQKFAEKLITEGVVTTQEYEEQIAAYDKICEDAYAHSKDEKILHIKHWLDSPWPDFFTLDGQPKTMSCPSTGISEDELNHIGSIAASVPMEDFTIHGGLSRILKGRSIMVAQRVCDWALAEYMAFGSLLKQGVHVRLSGQDVERGTFSHRHHVLHDQNVDKRICIPMNFISPDQASYTVCNSPLSEYSVLGFELGFAMASPNALVLWEAQFGDFNNTAQCIIDQFISSGQAKWVRQNGIVLLLPHGLEGMGPEHSSGRPERFLQMCNDDPDVFPKPSEDFAEHQLYDCNWIVVNCSTPANYFHVLRRQMLLSFRKPLVIFTPKSLLRHPEAKSSFDDMLPGTHFQRIIVDNGPAGARPESVKRVVLCTGKVYYELTRERRNRGLDGDIAVIRIEQLSPFPFDLVKSETDRFPNAELVWCQEEHKNQGYYDYVKPRLQTTVGYSRP------IWYAGREPAAAPATGNKQAHVCELQRLLDTAL 1007          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Medaka
Match: dhtkd1 (dehydrogenase E1 and transketolase domain containing 1 [Source:NCBI gene;Acc:101175318])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 338/916 (36.90%), Postives = 509/916 (55.57%), Query Frame = 1
Query:  502 STIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFD--SKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKD---------KQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKY-----DKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGL-KRSLKEREQFISERMA-NWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEF-SVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAA-VQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAIS 3189
            S + +   +  ++ +Y+  GH  + ++PL +    + D++P            E N     +    +     H G  +Q L   E+   LE AYC  + VE   ++ L + +W   +FE    M FS EE+R +   ++ S  F+ FLA K++  KR+G EG E ++     +   ++  GV    +GMPHRGRLN+L  + R P E +F +    S+   +    GDV  HL  S   ++    + + V +  NPSHLEA++PV QGKT A Q   K+         + G + + + +HGD +F GQG+V ET  LS+LP Y   G+IH++VNNQ+G+TT     RSS YC+DV ++ N  + HVN D  E V+  +++A +++  + KDV++DL+CYR++GHNE+DEP FT P MYK I S+ ++ + Y E+LI+E  +S  +  +   +Y     DK+     + +   T ++ R      W    + +  +    TGV   +LQ +G     + E+  +HS L K  ++ R Q + E    +W+  EA AFGSLL  G ++R+SGQDV RGTFS RH ++  Q+ +   ++PLN++   Q  +  V NS LSE AVLGFE G S   P  L IWEAQFGDF N AQ I D FI+ G++KW+ Q G+V+LLPHGY+G GPEHSS R+ERFLQ+ +  ++ +              +N  VVN TTPA  FH+LRRQ++ +FRKPLI + PK+LLR   A SS  E+   T F+ ++ ++ ++ ++   V+KV+LCSGK YY L+K+R+  +     A+IRVE++ PFP + L +EL KY+ A    W QEE +NMG W +V PR    +  KL          V RP   A A G   +H  +    +    S
Sbjct:   52 SALNQDHGLARLVEAYRTHGHKAAKINPL-LPDKPVADTVP------------EINMLTDSVTGTLQTSGLRHFGK-SQALA-EEVRAYLEKAYCGPMSVETGQLSSLEEKEWFSDRFEELKSMTFSPEERRQLAKIMLESQEFDHFLATKFATVKRYGGEGAESMMGFFHELFQQAAKSGVTDVVLGMPHRGRLNLLTGLLRFPPELMFRKMRGLSEFPETSPAIGDVLSHL-TSSVELDFGAERPLHVTMLPNPSHLEAINPVAQGKTRARQQLRKEGDYSPEDDAQPGDQVVCLQVHGDGSFTGQGIVPETLTLSNLPHYRVGGSIHLIVNNQVGYTTPSDRGRSSLYCSDVGKMVNCAVIHVNGDHAEEVLRATRLAVDYQRRYRKDVILDLICYRQWGHNELDEPFFTNPAMYKIIRSRKSIPDSYSEQLISEGQMSEAERDQIKSRYYGMLNDKL-SNMTLYSPPPTNLQGR------WGDLVEPQAKVTTWDTGVPVPLLQFVGAKSVDIAEHIQMHSHLVKTHVQARLQKLEEGTKLDWSTAEALAFGSLLCQGFNIRISGQDVGRGTFSQRHAMVVCQDTN-DTYIPLNHISPQQTGYLEVCNSPLSEEAVLGFEYGMSIAQPKLLPIWEAQFGDFFNGAQIIFDTFISGGEAKWLLQCGMVILLPHGYDGAGPEHSSCRMERFLQLCDSKEEGV----------DSDCVNMAVVNPTTPAQYFHLLRRQMIRNFRKPLIVVGPKTLLRFSGAVSSLAELAPGTCFRPVLGDSSVSADS---VQKVVLCSGKHYYALLKQRDSSAANQNTALIRVEELCPFPLEALQQELKKYTNAKEFIWSQEEPQNMGPWSFVAPRFEKQLACKL--------RLVSRPALPAPAVGIGTLHHQQTEAILNATFS 922          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000041277.1 (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101174054])

HSP 1 Score: 56.6102 bits (135), Expect = 8.982e-8
Identity = 59/223 (26.46%), Postives = 98/223 (43.95%), Query Frame = 1
Query: 1285 PVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTD-PRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLM--YKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKI 1944
            PV  G   A  Y     QG   + + L+GD A   QG +FETF+++ L        I I  NN+ G  T   R A S+ Y     R    P   V+  D   V   ++ AAE        +V++L  YR  GH+ M +P  +       +++ S+   ++  +E+++   + S+++++E      K  EEA   A     +     LD   D  F N+ P+++
Sbjct:  175 PVGAGIALACSY-----QGNNQLCVTLYGDGA-ANQGQIFETFNMAALWKLPC---IFICENNKYGMGTAVERAAASTDY---YKRGDFIPGLRVDGMDVLCVREATRFAAEHCRAGKGPIVMELQTYRYHGHS-MSDPGVSYRTREEIQEVRSKSDPISMLKERMLANNMASAEEFKEIDIAIRKEVEEAAQFA----TLDPEPPLDELCDHIFHNEPPLEV 380          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000029291.1 (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101174054])

HSP 1 Score: 56.225 bits (134), Expect = 1.038e-7
Identity = 59/223 (26.46%), Postives = 98/223 (43.95%), Query Frame = 1
Query: 1285 PVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTD-PRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLM--YKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKI 1944
            PV  G   A  Y     QG   + + L+GD A   QG +FETF+++ L        I I  NN+ G  T   R A S+ Y     R    P   V+  D   V   ++ AAE        +V++L  YR  GH+ M +P  +       +++ S+   ++  +E+++   + S+++++E      K  EEA   A     +     LD   D  F N+ P+++
Sbjct:  182 PVGAGIALACSY-----QGNNQLCVTLYGDGA-ANQGQIFETFNMAALWKLPC---IFICENNKYGMGTAVERAAASTDY---YKRGDFIPGLRVDGMDVLCVREATRFAAEHCRAGKGPIVMELQTYRYHGHS-MSDPGVSYRTREEIQEVRSKSDPISMLKERMLANNMASAEEFKEIDIAIRKEVEEAAQFA----TLDPEPPLDELCDHIFHNEPPLEV 387          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Planmine SMEST
Match: SMESG000020522.1 (SMESG000020522.1)

HSP 1 Score: 2070.82 bits (5364), Expect = 0.000e+0
Identity = 1011/1033 (97.87%), Postives = 1011/1033 (97.87%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHK               SWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFPTVMGTPVPTVTSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNF       EPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS
Sbjct:    1 MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHK---------------SWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFPTVMGTPVPTVTSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFG------EPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 1012          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Planmine SMEST
Match: SMESG000020522.1 (SMESG000020522.1)

HSP 1 Score: 2041.54 bits (5288), Expect = 0.000e+0
Identity = 1010/1086 (93.00%), Postives = 1013/1086 (93.28%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLK-------------------HYNFALEQNFR----------------------------------EPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHK               SWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFPTVMGTPVPTVTSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLK                   H+  +L  N +                                  EPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS
Sbjct:    1 MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHK---------------SWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFPTVMGTPVPTVTSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFGMLDYNIYICTISNMHFPCSLALNNQIYVRGHFAAPLDPLGIDVINDDPKNIVYANIYKSEPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 1071          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Planmine SMEST
Match: SMESG000020522.1 (SMESG000020522.1)

HSP 1 Score: 2017.66 bits (5226), Expect = 0.000e+0
Identity = 989/1033 (95.74%), Postives = 995/1033 (96.32%), Query Frame = 1
Query:  100 MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFXXXXXXXXXXXXSSLTHEIVDQSTIEEHLAVQAIIRSYQARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 3198
            MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHK               SWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFPTVMGTPVPTVTSSLTHEIVDQSTIEEHLAVQAIIRSYQ RGH  + LDPLGI   D+ +  PK +   +   +      EPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS
Sbjct:    1 MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMYNSWLENPASVHK---------------SWNVYFSQVSKGAAVGQAFSPPPNFMYSLPKYQYFPTVMGTPVPTVTSSLTHEIVDQSTIEEHLAVQAIIRSYQVRGHFAAPLDPLGI---DVINDDPKNIVYANIYKS------EPHLDKVFRLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKEREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLLHEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS 1009          
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Planmine SMEST
Match: SMESG000062553.1 (SMESG000062553.1)

HSP 1 Score: 508.064 bits (1307), Expect = 9.942e-164
Identity = 319/848 (37.62%), Postives = 462/848 (54.48%), Query Frame = 1
Query:  754 EIIHRLENAYCRHIGVEYMFINDLNKCDWIRRKFETPGIMKFSDEEKRL---IMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVLIPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQ---FDSKLEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQGKTYAE---------QYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRGTIHIVVNNQIGFTTD-PRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYVSKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTVLNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLDSP------------W-DGFFDNKDPMKIPI--TGVDESVLQHIGKVVSSVPENFNIHSGLKRSLKERE--QFISERMAN--WALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVLHDQEKDLVVHVPLN-----NLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSLVIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEHSSARLERFLQMSNDDQDYIPPFGEHFEVQQLHD-INWFVVNCTTPANMFHVLRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIATENPEKVEKVILCSGKVYYELMKERERRSL---QDRIAIIRVEQISPFPYDLLHEELNKYSEA-AVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISYVGRPPSAAAAAGNKFIHLMEI 3162
            EII  L   YC  +  EY+ IN L + +W   +F      ++ + E R+    +  + RS  F+ FLAKK+   KR+  EG E +I  +K +   ++ L + +  I M HR R NVL  +   P    F +   F          +GD   H   S   +++     + +++  NPSHLEA  PV  GK  ++          Y    + G K + I +HGDA+  GQG+V E+  ++D P++S  G+IH+V+NN++GFTT+ P   ++    TD+++V NAPI HVNA     V   + +A ++RN F KD+ I+++ +R++GHNE+D+P  TQP+MY KI S  ++  ++ + LI E+ V SQ         D+I ++   +   ET + N+++LD+P            W D    + D   + +  TG+D   L  IGK    +P NF +H  + R   +R      +++  N  WA  E+ A GS+L  G + R+SGQDV RGTFSHRH +  DQE +    VP N     +         V+NS LSE AVLGFE+G +  +PN+L IWEAQFGDF N AQ +ID ++ S ++KW+ Q+GLV+LLPHGY+G GPEHSS RLERFLQ+++             E Q   D IN  V+N TTPA  FH LRRQ++  FR+PL+  +PK LLR P A SS  +    T F  +IP++ I +   E +  V+LCSGK YY L    E       Q R AIIR+EQ++PFP   +H+E+ KY  A    W QEE +NMGAW ++  R+ NL+ + L         Y GR   A  A G   IH  EI
Sbjct:  102 EIISTLSKIYCTDVSAEYLHINSLEEREWFSDRFARRD--EYYNIENRIKFEYLKLINRSESFDLFLAKKFQHVKRYSGEGVESIIIFLKEIFSIAAYLKITNIVIAMAHRSRNNVLVTLLNYPPILYFRKMMGFSEFPNFVKFATGDTFSHFFNSMDYVSKTGFP-VHISLIPNPSHLEANIPVCAGKVRSKMQTLYEGDYSYKEYSRNGDKVLGIFIHGDASIYGQGIVCESLIMTDSPNFSIGGSIHVVINNKLGFTTETPNGIKN---VTDISKVINAPIIHVNAYKVLDVAKAAMLAMDYRNIFRKDIFINIIGHRKWGHNELDDPTITQPIMYSKIASTKSISEEFTKSLIDEQCVLSQ---------DEILKD---IKHWETKL-NKDFLDAPDHEPHLLTFKAQWADQNILDLDVKSLAVYNTGLDIEKLIEIGKNSVFIPHNFKVHHNVHRVHIQRRLSNLNADKTNNIDWATAESLAVGSILVEGKNCRISGQDVGRGTFSHRHFIFVDQENNKHC-VPFNICSWSDSLIKPGNLEVANSILSEEAVLGFEIGMAMDNPNNLYIWEAQFGDFFNGAQILIDTYLGSAETKWMLQNGLVLLLPHGYDGAGPEHSSCRLERFLQLTDSS-----------ETQCDSDLINLHVINPTTPAQYFHALRRQLVRPFRRPLVIASPKLLLRSPLAISSLTDFENGTFFHHVIPDSSINSS--ETINTVLLCSGKHYYTLKTFLETSVTLDDQKRFAIIRIEQLAPFPICEIHQEIVKYKNAKKFIWCQEEPRNMGAWQFINSRIQNLLGINL--------KYSGRKELATPAVGITNIHKKEI 908          
The following BLAST results are available for this feature:
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OGDHL0.000e+059.73oxoglutarate dehydrogenase like [Source:HGNC Symbo... [more]
OGDH0.000e+058.65oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc... [more]
OGDH0.000e+057.98oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc... [more]
OGDH0.000e+058.27oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc... [more]
OGDH0.000e+057.77oxoglutarate dehydrogenase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogdh-10.000e+058.252-oxoglutarate dehydrogenase, mitochondrial [Sour... [more]
ogdh-10.000e+061.992-oxoglutarate dehydrogenase, mitochondrial [Sour... [more]
ogdh-10.000e+061.992-oxoglutarate dehydrogenase, mitochondrial [Sour... [more]
ogdh-20.000e+037.57Probable 2-oxoglutarate dehydrogenase E1 component... [more]
ogdh-20.000e+037.57Probable 2-oxoglutarate dehydrogenase E1 component... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nc73EF0.000e+059.31gene:FBgn0010352 transcript:FBtr0075267[more]
Nc73EF0.000e+059.31gene:FBgn0010352 transcript:FBtr0075269[more]
Nc73EF0.000e+059.50gene:FBgn0010352 transcript:FBtr0075266[more]
Nc73EF0.000e+059.50gene:FBgn0010352 transcript:FBtr0075268[more]
Nc73EF0.000e+059.50gene:FBgn0010352 transcript:FBtr0075264[more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogdhb0.000e+059.18oxoglutarate (alpha-ketoglutarate) dehydrogenase b... [more]
ogdhl0.000e+060.78oxoglutarate dehydrogenase like [Source:ZFIN;Acc:Z... [more]
ogdha0.000e+060.54oxoglutarate (alpha-ketoglutarate) dehydrogenase a... [more]
ogdha0.000e+060.34oxoglutarate (alpha-ketoglutarate) dehydrogenase a... [more]
ogdha0.000e+060.24oxoglutarate (alpha-ketoglutarate) dehydrogenase a... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogdh0.000e+059.33oxoglutarate dehydrogenase [Source:NCBI gene;Acc:1... [more]
OGDHL0.000e+061.67oxoglutarate dehydrogenase like [Source:NCBI gene;... [more]
ogdh0.000e+060.59oxoglutarate dehydrogenase [Source:NCBI gene;Acc:1... [more]
OGDHL0.000e+061.05oxoglutarate dehydrogenase like [Source:NCBI gene;... [more]
ogdh0.000e+059.10oxoglutarate dehydrogenase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ogdhl0.000e+059.92oxoglutarate dehydrogenase-like [Source:MGI Symbol... [more]
Ogdhl0.000e+059.10oxoglutarate dehydrogenase-like [Source:MGI Symbol... [more]
Ogdh0.000e+059.14oxoglutarate (alpha-ketoglutarate) dehydrogenase (... [more]
Ogdh0.000e+059.14oxoglutarate (alpha-ketoglutarate) dehydrogenase (... [more]
Ogdh0.000e+058.76oxoglutarate (alpha-ketoglutarate) dehydrogenase (... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULD0|OGDHL_HUMAN0.000e+059.732-oxoglutarate dehydrogenase-like, mitochondrial O... [more]
sp|Q5R9L8|OGDHL_PONAB0.000e+060.192-oxoglutarate dehydrogenase-like, mitochondrial O... [more]
sp|Q60HE2|ODO1_MACFA0.000e+058.782-oxoglutarate dehydrogenase, mitochondrial OS=Mac... [more]
sp|Q5RCB8|ODO1_PONAB0.000e+058.782-oxoglutarate dehydrogenase, mitochondrial OS=Pon... [more]
sp|Q68EW0|OGDHL_XENLA0.000e+061.982-oxoglutarate dehydrogenase-like, mitochondrial O... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LJA10.000e+066.20Transket_pyr domain-containing protein OS=Opisthor... [more]
A0A3Q0KF780.000e+066.732-oxoglutarate dehydrogenase OS=Schistosoma manson... [more]
A0A504Z4210.000e+064.442-oxoglutarate dehydrogenase mitochondrial OS=Fasc... [more]
A0A2C9JG620.000e+066.17Transket_pyr domain-containing protein OS=Biomphal... [more]
A0A4S2LH840.000e+064.22Transket_pyr domain-containing protein OS=Opisthor... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogdhb0.000e+059.52oxoglutarate dehydrogenase [Source:NCBI gene;Acc:1... [more]
ogdhl0.000e+061.16oxoglutarate dehydrogenase like [Source:NCBI gene;... [more]
OGDH0.000e+061.032-oxoglutarate dehydrogenase, mitochondrial [Sourc... [more]
OGDH0.000e+060.592-oxoglutarate dehydrogenase, mitochondrial [Sourc... [more]
OGDH0.000e+059.792-oxoglutarate dehydrogenase, mitochondrial [Sourc... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ogdhb0.000e+060.76oxoglutarate (alpha-ketoglutarate) dehydrogenase b... [more]
dhtkd12.862e-7136.41dehydrogenase E1 and transketolase domain containi... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
KGD10.000e+045.31Subunit of the mitochondrial alpha-ketoglutarate d... [more]
PDA16.336e-832.62E1 alpha subunit of the pyruvate dehydrogenase (PD... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO371690.000e+061.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271591.995e-13436.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430343.868e-11149.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290235.252e-7739.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369435.623e-2857.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OGDH0.000e+059.892-oxoglutarate dehydrogenase, mitochondrial [Sourc... [more]
ogdhb0.000e+059.512-oxoglutarate dehydrogenase, mitochondrial [Sourc... [more]
dhtkd10.000e+036.90dehydrogenase E1 and transketolase domain containi... [more]
ENSORLT00000041277.18.982e-826.46pyruvate dehydrogenase E1 component subunit alpha,... [more]
ENSORLT00000029291.11.038e-726.46pyruvate dehydrogenase E1 component subunit alpha,... [more]
back to top
BLAST of 2-oxoglutarate dehydrogenase mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000020522.10.000e+097.87SMESG000020522.1[more]
SMESG000020522.10.000e+093.00SMESG000020522.1[more]
SMESG000020522.10.000e+095.74SMESG000020522.1[more]
SMESG000062553.19.942e-16437.62SMESG000062553.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014911 ID=SMED30014911|Name=2-oxoglutarate dehydrogenase mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=3299bp
TTTTGAAAGTATTTAACCTTTTAAGGTAAATTTTCTGTTCAATTTATCAA
CTTAATTTTCTGTATTTAGATATTTTAGTTCATCTTGATTTATATAAATA
TGTATAAAATACGTTTGCTAGCACAAAAGCAAAGATCATTACTTTCTAAT
TATGGGTTTCCTATTTTCAAGAATTCTGTTAAAAATAGCTCAGCTAGTGC
CGAATCGTTTCTTAACGGAGGTTCATCAGTTTATATAGAAGAAATGTACA
ATTCTTGGTTAGAGAATCCTGCAAGTGTTCATAAAGTAAATTATCGATTT
GGAATTTTGGAGTATTATTACTTGCTTAAGTCTTGGAATGTTTATTTTAG
TCAAGTAAGTAAAGGAGCAGCAGTTGGGCAAGCATTTTCTCCTCCTCCAA
ACTTTATGTATAGCTTACCTAAATATCAGTATTTTCCAACTGTTATGGGT
ACACCTGTTCCAACTGTTACTAGTTCTTTGACTCATGAGATTGTTGATCA
AAGTACAATTGAAGAACATTTGGCTGTCCAAGCGATTATAAGATCATATC
AGGCTCGGGGTCATAATGTTTCAGGCTTAGATCCGCTGGGAATTTTGTCA
GCTGATTTAGACGACAGCATTCCTAAGGAGTTAACGTTAAAACATTATAA
TTTTGCATTGGAGCAAAATTTTCGTGAACCTCATCTAGACAAAGTGTTTC
GACTACCAACTACAACACATATTGGAGGAGGAGCGCAAGAACTAACCCTG
CGAGAAATCATTCATCGATTAGAAAATGCGTACTGTCGTCATATTGGAGT
GGAATACATGTTCATTAATGATCTAAATAAATGCGATTGGATACGAAGGA
AGTTTGAAACTCCCGGTATCATGAAGTTTAGTGATGAAGAAAAACGATTG
ATAATGGCTCGATTAATTCGATCTACCCGATTTGAGGAATTTCTTGCAAA
AAAATGGAGTGCGGAAAAAAGATTTGGACTTGAAGGTTGTGAAGTTTTAA
TTCCATCAATGAAAACTGTGATAGATGCGTCGAGTGATTTGGGTGTCGAA
AGCTTTAACATTGGAATGCCTCATAGGGGGCGATTAAATGTTTTAGCAAA
TGTTTGTCGTAAGCCATTAGAACAATTGTTTTGTCAATTTGATTCAAAAT
TGGAGCCAAGTGATGAAGGCAGTGGTGATGTAAAATATCATTTAGGAATG
TCTCACAAAAGGATTAACAGGATAAATAATAAAATGATTAAAGTAGCAGT
TTGTGCTAATCCCAGTCATTTAGAAGCCGTTGATCCAGTTTTGCAAGGAA
AAACTTATGCTGAGCAGTATTATAATAAGGATAAACAAGGAAAGAAAGCC
ATGAGTATCATGTTACATGGTGATGCAGCTTTCTGTGGCCAAGGTGTCGT
TTTTGAGACTTTTCATTTAAGTGATTTGCCATCTTATTCAACAAGAGGAA
CAATACATATTGTTGTCAATAATCAAATCGGATTTACAACTGATCCTCGT
GTTGCTCGATCTTCTCCATACTGTACAGATGTTGCTCGAGTAACAAATGC
ACCCATTTTCCACGTTAATGCTGATGACCCTGAGGCTGTAGTTTATGTTT
CGAAAGTTGCTGCTGAATGGCGCAATGAGTTTAGCAAAGATGTTGTCATT
GATCTTGTGTGCTATAGAAGATTTGGACATAACGAAATGGACGAGCCAAT
GTTTACTCAACCATTGATGTATAAAAAGATTCATAGCCAACCAACTGTTT
TAAATCAATATCGTGAAAAGTTAATTACAGAAAAAGTCGTATCTTCGCAG
CAATATCAAGAAGAGATTGAAAAATATGACAAAATATGCGAGGAAGCTTA
CATGCTTGCAAAAAAAGAAACTGCCATTCGAAATAGAGAGTGGCTTGATT
CGCCTTGGGATGGATTTTTTGATAATAAGGATCCAATGAAGATTCCGATA
ACGGGAGTAGACGAATCAGTTTTACAGCACATTGGCAAAGTGGTTTCTTC
TGTTCCTGAAAATTTCAATATCCATTCTGGATTGAAACGAAGTCTTAAAG
AGCGGGAACAATTTATATCTGAAAGAATGGCTAATTGGGCGTTGGGTGAA
GCATTTGCCTTCGGTAGTCTTCTGAAGCATGGTATTCATGTTCGACTAAG
TGGGCAGGATGTAGAACGGGGTACATTTTCCCATAGGCATACTGTATTAC
ATGACCAAGAAAAAGATCTAGTAGTTCATGTTCCCTTGAATAATCTTTAT
GCTGGTCAAGCAGAGTTTTCTGTCAGTAATTCATCTTTGAGTGAATATGC
TGTCCTTGGATTTGAGTTGGGATTTTCTCAGACTGACCCTAATTCACTTG
TTATTTGGGAAGCTCAATTCGGCGACTTTAACAATACTGCTCAATGTATT
ATCGATCAATTCATAGCTTCTGGGCAATCGAAATGGGTTAGACAATCAGG
ATTGGTTATGCTTTTGCCTCATGGGTATGAAGGAATGGGTCCAGAACATT
CTAGCGCACGCTTAGAAAGATTTCTTCAAATGTCAAATGATGATCAAGAT
TATATACCACCATTTGGAGAACATTTTGAAGTTCAACAATTGCATGATAT
CAACTGGTTCGTGGTCAATTGTACTACTCCGGCTAATATGTTTCATGTTC
TCCGGCGTCAAGTTTTATTGTCATTTAGGAAACCATTGATAGCAATGACT
CCTAAATCACTTCTACGTCTCCCCGAAGCTAAATCATCATTTGATGAAAT
GATTGGAGATACTAAATTCAAAAGGCTTATTCCTGAAACTGGCATAGCTA
CAGAAAATCCGGAAAAGGTAGAAAAGGTTATTTTGTGTTCAGGAAAGGTA
TATTATGAGCTTATGAAAGAAAGAGAACGTCGAAGTCTTCAAGATAGAAT
AGCAATAATACGAGTCGAACAAATATCTCCGTTTCCTTACGATTTATTAC
ACGAAGAACTGAACAAATACAGTGAAGCAGCAGTTCAGTGGGTTCAAGAA
GAGCACAAAAATATGGGTGCGTGGTTTTATGTTGAACCACGAGTGAACAA
TTTAATAAAGGTTAAACTACCCAATCACAGAAAACCAAAAATTAGTTACG
TTGGTCGACCGCCAAGTGCTGCAGCAGCTGCTGGAAACAAATTTATTCAT
TTAATGGAAATAAGTCAGTTTATGAGACAAGCTATTTCGACTAGATCTTA
GAATGATTTTTTTTAATTTCGATTAGATATACTCTATAACTAGCATGTAG
AGTTTCTTCTTTCTGTGACAATTAAATTGAAATATACATGTGCTTCTAA
back to top

protein sequence of SMED30014911-orf-1

>SMED30014911-orf-1 ID=SMED30014911-orf-1|Name=SMED30014911-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1034bp
MYKIRLLAQKQRSLLSNYGFPIFKNSVKNSSASAESFLNGGSSVYIEEMY
NSWLENPASVHKVNYRFGILEYYYLLKSWNVYFSQVSKGAAVGQAFSPPP
NFMYSLPKYQYFPTVMGTPVPTVTSSLTHEIVDQSTIEEHLAVQAIIRSY
QARGHNVSGLDPLGILSADLDDSIPKELTLKHYNFALEQNFREPHLDKVF
RLPTTTHIGGGAQELTLREIIHRLENAYCRHIGVEYMFINDLNKCDWIRR
KFETPGIMKFSDEEKRLIMARLIRSTRFEEFLAKKWSAEKRFGLEGCEVL
IPSMKTVIDASSDLGVESFNIGMPHRGRLNVLANVCRKPLEQLFCQFDSK
LEPSDEGSGDVKYHLGMSHKRINRINNKMIKVAVCANPSHLEAVDPVLQG
KTYAEQYYNKDKQGKKAMSIMLHGDAAFCGQGVVFETFHLSDLPSYSTRG
TIHIVVNNQIGFTTDPRVARSSPYCTDVARVTNAPIFHVNADDPEAVVYV
SKVAAEWRNEFSKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKKIHSQPTV
LNQYREKLITEKVVSSQQYQEEIEKYDKICEEAYMLAKKETAIRNREWLD
SPWDGFFDNKDPMKIPITGVDESVLQHIGKVVSSVPENFNIHSGLKRSLK
EREQFISERMANWALGEAFAFGSLLKHGIHVRLSGQDVERGTFSHRHTVL
HDQEKDLVVHVPLNNLYAGQAEFSVSNSSLSEYAVLGFELGFSQTDPNSL
VIWEAQFGDFNNTAQCIIDQFIASGQSKWVRQSGLVMLLPHGYEGMGPEH
SSARLERFLQMSNDDQDYIPPFGEHFEVQQLHDINWFVVNCTTPANMFHV
LRRQVLLSFRKPLIAMTPKSLLRLPEAKSSFDEMIGDTKFKRLIPETGIA
TENPEKVEKVILCSGKVYYELMKERERRSLQDRIAIIRVEQISPFPYDLL
HEELNKYSEAAVQWVQEEHKNMGAWFYVEPRVNNLIKVKLPNHRKPKISY
VGRPPSAAAAAGNKFIHLMEISQFMRQAISTRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042179KGD_C_sf
IPR011528NERD
IPR005475Transketolase-like_Pyr-bd
IPR031717KGD_C
IPR029061THDP-binding
IPR0321062-oxogl_dehyd_N
IPR001017DH_E1
IPR0116032oxoglutarate_DH_E1
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006099tricarboxylic acid cycle
GO:0055114oxidation-reduction process
GO:0006096glycolytic process
Vocabulary: molecular function
TermDefinition
GO:0016624oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0030976thiamine pyrophosphate binding
GO:0004591oxoglutarate dehydrogenase (succinyl-transferring) activity
GO:0005515protein binding
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
GO:0045252oxoglutarate dehydrogenase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005475Transketolase-like, pyrimidine-binding domainSMARTSM00861Transket_pyr_3coord: 661..874
e-value: 1.7E-48
score: 177.1
IPR005475Transketolase-like, pyrimidine-binding domainPFAMPF02779Transket_pyrcoord: 661..873
e-value: 6.0E-62
score: 208.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.12470coord: 620..897
e-value: 6.2E-163
score: 543.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.970coord: 231..596
e-value: 3.1E-156
score: 521.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.1150coord: 136..230
e-value: 3.2E-15
score: 58.1
NoneNo IPR availablePANTHERPTHR23152:SF52-OXOGLUTARATE DEHYDROGENASE-LIKE, MITOCHONDRIALcoord: 8..1030
NoneNo IPR availableCDDcd02016TPP_E1_OGDC_likecoord: 278..541
e-value: 3.47195E-172
score: 501.674
IPR0116032-oxoglutarate dehydrogenase E1 componentPIRSFPIRSF000157Oxoglu_dh_E1coord: 23..1031
e-value: 0.0
score: 1168.6
IPR0116032-oxoglutarate dehydrogenase E1 componentTIGRFAMTIGR00239TIGR00239coord: 37..1028
e-value: 0.0
score: 1030.2
IPR0116032-oxoglutarate dehydrogenase E1 componentPANTHERPTHR231522-OXOGLUTARATE DEHYDROGENASEcoord: 8..1030
IPR031717Multifunctional 2-oxoglutarate metabolism enzyme, C-terminalPFAMPF16870OxoGdeHyase_Ccoord: 878..1028
e-value: 3.4E-52
score: 176.2
IPR001017Dehydrogenase, E1 componentPFAMPF00676E1_dhcoord: 271..590
e-value: 7.0E-80
score: 268.2
IPR0321062-oxoglutarate dehydrogenase E1 component, N-terminal domainPFAMPF160782-oxogl_dehyd_Ncoord: 35..62
e-value: 2.9E-12
score: 46.0
IPR042179Multifunctional 2-oxoglutarate metabolism enzyme, C-terminal domain superfamilyGENE3DG3DSA:3.40.50.11610coord: 798..1027
e-value: 6.2E-163
score: 543.9
IPR029061Thiamin diphosphate-binding foldSUPERFAMILYSSF52518Thiamin diphosphate-binding fold (THDP-binding)coord: 656..881
IPR029061Thiamin diphosphate-binding foldSUPERFAMILYSSF52518Thiamin diphosphate-binding fold (THDP-binding)coord: 227..608