slc46a-3

Overview
Nameslc46a-3 (AKN21695.1)
Smed IDSMED30014908
Length (bp)3535
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc46a-3 (SMED30014908) t-SNE clustered cells

Violin plots show distribution of expression levels for slc46a-3 (SMED30014908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014908SMESG000065064.1 Contig2006GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014908SMESG000065064.1 dd_Smed_v4_7847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc46a-3 vs. Ensembl Human
Match: SLC46A3 (solute carrier family 46 member 3 [Source:HGNC Symbol;Acc:HGNC:27501])

HSP 1 Score: 86.2705 bits (212), Expect = 8.126e-17
Identity = 107/419 (25.54%), Postives = 176/419 (42.00%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYG-LTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNM-----KPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGL 1462
            VEP +    FA  +   +  Q++Y R+     N T  + +    C +   S      +++Q+  S F + + +   I  +++       SD YGR+   ++   G    SV   L  Y+ +P    I   TF G   G Y       F+Y+ D+   H  +T RIA +  ++ +   +  LSSGY I    +   FL   V+  + LIY LF + D  P+ + S  N+     +    ++ +   L      + R    L +  +I + F  +G      L   Y +  P+C   + IG YG     A  L + L   + + C  D+ +  + +   M      AFA++ L  F+A    L +   F   R  LSK  +STEQG LF  +  +ET+ G +T V           TFNG+
Sbjct:    6 VEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLI-ASTFIGAFCGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGD--PVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFIL---YELDSPLCWNEVFIG-YGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETL-GGVTAV----------STFNGI 406          
BLAST of slc46a-3 vs. Ensembl Human
Match: SLC46A3 (solute carrier family 46 member 3 [Source:HGNC Symbol;Acc:HGNC:27501])

HSP 1 Score: 86.2705 bits (212), Expect = 8.301e-17
Identity = 108/418 (25.84%), Postives = 179/418 (42.82%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYG-LTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMK-PIMAVWKQL---TSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGL 1462
            VEP +    FA  +   +  Q++Y R+     N T  + +    C +   S      +++Q+  S F + + +   I  +++       SD YGR+   ++   G    SV   L  Y+ +P    I   TF G   G Y       F+Y+ D+   H  +T RIA +  ++ +   +  LSSGY I    +   FL   V+  + LIY LF + D  P+ + S  N+       +K L   T +   +    R   +  +L  +I  F+ V  ++ + +   Y +  P+C   + IG YG     A  L + L   + + C  D+ +  + +   M      AFA++ L  F+A    L +   F   R  LSK  +STEQG LF  +  +ET+ G +T V           TFNG+
Sbjct:    6 VEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLI-ASTFIGAFCGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGD--PVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFIL--YELDSPLCWNEVFIG-YGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETL-GGVTAV----------STFNGI 406          
BLAST of slc46a-3 vs. Ensembl Human
Match: SLC46A1 (solute carrier family 46 member 1 [Source:HGNC Symbol;Acc:HGNC:30521])

HSP 1 Score: 82.8037 bits (203), Expect = 1.032e-15
Identity = 98/436 (22.48%), Postives = 188/436 (43.12%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYR--VGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEIN---SHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFL----MMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            VEPL+    FA ++Q  +  Q++++R    + YN T           +  G S++     +QE+    SH+ + +++G  +  + ++     +SD  GRR + ++   G+ +++++ +  +     +  F+       L G +  +++  F+ VAD S   +RT R+A +   I +   +ASL  G+ +    Y  PF  +        +Y  F     + + K     +  + + I+ ++     +A   +K  ++ ++ S+ + ++   +        D+ T Y +S P+C  S  IG YG        L + L+  +L  C +D  V  + L F +   +  AFAT     F   G   LS    P  R  LSK  + TEQGALF  +  + ++       +    Y  TL    G  F+      L+  +L+
Sbjct:   25 VEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGT----------RQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLY-----VAPAPEKSRKHLALYSLAIFVVITVH----FGAQDILTLYELSTPLCWDSKLIG-YGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNFMKGFPFLLGAGLLLIPAVLI 440          
BLAST of slc46a-3 vs. Ensembl Human
Match: SLC46A2 (solute carrier family 46 member 2 [Source:HGNC Symbol;Acc:HGNC:16055])

HSP 1 Score: 64.6994 bits (156), Expect = 6.165e-10
Identity = 94/431 (21.81%), Postives = 178/431 (41.30%), Query Frame = 2
Query:  302 YRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMIT-----TYRYFVPFLASTVAAFLCLIYPLFLMMD----SKPISDLSKVN-MKPIMAVWKQLT------SLATVHKKQSRNESILSILVLIIFA---FYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHV 1537
            Y  G++  + A   T     +  S S      D+ Q   S+F ++ +L   ++ +L+A      SDRY R++   +   G  +  +  LL +   WP+          GL G ++   S   +  +  S  G R+ R+  + +M+ +  F  S++SG++       + +  +    S   A   L+Y L ++      +KP  +L  V+ +   +  ++ L         A  H             + ++F     Y++  +  VD+   +++  P+    +Q+G YG+     I + + L   + +RCF D  +I++ ++   +  L +AF       +IA    L +       R  +SK  K +  G +F  L L   + G +T  L    YQ T+  F G       CF+L +F+  +  IP S V
Sbjct:   36 YDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAAALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVG-YGMAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDMFVG------SCFALSSFLSFLAIIPISIV 459          
BLAST of slc46a-3 vs. Ensembl Human
Match: SLC46A1 (solute carrier family 46 member 1 [Source:HGNC Symbol;Acc:HGNC:30521])

HSP 1 Score: 60.077 bits (144), Expect = 1.783e-8
Identity = 77/353 (21.81%), Postives = 158/353 (44.76%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYR--VGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEIN---SHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFL----MMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFAT-SPL 1258
            VEPL+    FA ++Q  +  Q++++R    + YN T           +  G S++     +QE+    SH+ + +++G  +  + ++     +SD  GRR + ++   G+ +++++ +  +     +  F+       L G +  +++  F+ VAD S   +RT R+A +   I +   +ASL  G+ +    Y  PF  +        +Y  F     + + K     +  + + I+ ++     +A   +K  ++ ++ S+ + ++   +        D+ T Y +S P+C  S  IG YG        L + L+  +L  C +D  V  + L F +   +  AFAT +PL
Sbjct:   25 VEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGT----------RQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLY-----VAPAPEKSRKHLALYSLAIFVVITVH----FGAQDILTLYELSTPLCWDSKLIG-YGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPL 357          
BLAST of slc46a-3 vs. Ensembl Fly
Match: CG42514 (gene:FBgn0260388 transcript:FBtr0300656)

HSP 1 Score: 58.9214 bits (141), Expect = 2.004e-8
Identity = 109/499 (21.84%), Postives = 202/499 (40.48%), Query Frame = 2
Query:  137 NEDQNKNS------QKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYR-VGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELL-AIYYLWPITTFIYMETF-YGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLAS-----TVAAFLCLIYPLFLMMDSKPISDLSKVNMKPI--MAVW-----KQL--TSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILN-------IVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAF---------PFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQT-FNGLVFIFIGCFSLVAFILLI 1513
            N + N+NS      ++  E+       +  +  +   VEP +  Y FA ++ + V Q F  Y+   +  N T        +C   +   +++   K    N+ FL   ++ + +  I+ A F   FSDR GR+L  L+   G F  S + ++ A    WP+   IY  T    LTGA   + +  F+Y++D S    RT R+  + ++     +++++  G  + ++ ++  F  S     TV A L  +  ++ +   K  +   + +++ +     W     KQ    SLA + K +  +     I++L+  A Y      G      YL  Y +      +  Y           ++A+ L   L   +L   + D  +I         F    A + + L  + AT ++LL   A          P  R   SK   ++E+G +F  L + +     I+ V     Y++T  T   G VFI      +  F++++
Sbjct:   22 NSEDNENSASGTVREQRDEAAGRTVLQWAWHVVKSTSVEPTMFLYMFAFMITSVVEQNFFLYKSCRVNRNFTEE------ICRNLNKPENEEFRTKAMLTNAWFLQWENISAHVFPIILALFLGSFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVI-----YLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDFFDKQHVKDSLAVLVKPRKGHRRSFLIILLVSMALYTFQRDEG-----QYLYMYTLGKFDWDVSAYSNFKTFKSSAYVIAMLLAVPLMNKILG--WRDTTII---------FIGTWAHSIARLFFYFATNTDLLYAGAVVCSLGPIVGPMIRAMTSKIVPTSERGKVFALLSVCDNAVPFISGVCYSQLYRRTQNTNHGGNVFILTIATQIAVFVMIL 493          
BLAST of slc46a-3 vs. Ensembl Fly
Match: CG42514 (gene:FBgn0260388 transcript:FBtr0300655)

HSP 1 Score: 58.9214 bits (141), Expect = 2.004e-8
Identity = 109/499 (21.84%), Postives = 202/499 (40.48%), Query Frame = 2
Query:  137 NEDQNKNS------QKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYR-VGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELL-AIYYLWPITTFIYMETF-YGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLAS-----TVAAFLCLIYPLFLMMDSKPISDLSKVNMKPI--MAVW-----KQL--TSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILN-------IVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAF---------PFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQT-FNGLVFIFIGCFSLVAFILLI 1513
            N + N+NS      ++  E+       +  +  +   VEP +  Y FA ++ + V Q F  Y+   +  N T        +C   +   +++   K    N+ FL   ++ + +  I+ A F   FSDR GR+L  L+   G F  S + ++ A    WP+   IY  T    LTGA   + +  F+Y++D S    RT R+  + ++     +++++  G  + ++ ++  F  S     TV A L  +  ++ +   K  +   + +++ +     W     KQ    SLA + K +  +     I++L+  A Y      G      YL  Y +      +  Y           ++A+ L   L   +L   + D  +I         F    A + + L  + AT ++LL   A          P  R   SK   ++E+G +F  L + +     I+ V     Y++T  T   G VFI      +  F++++
Sbjct:   22 NSEDNENSASGTVREQRDEAAGRTVLQWAWHVVKSTSVEPTMFLYMFAFMITSVVEQNFFLYKSCRVNRNFTEE------ICRNLNKPENEEFRTKAMLTNAWFLQWENISAHVFPIILALFLGSFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVI-----YLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDFFDKQHVKDSLAVLVKPRKGHRRSFLIILLVSMALYTFQRDEG-----QYLYMYTLGKFDWDVSAYSNFKTFKSSAYVIAMLLAVPLMNKILG--WRDTTII---------FIGTWAHSIARLFFYFATNTDLLYAGAVVCSLGPIVGPMIRAMTSKIVPTSERGKVFALLSVCDNAVPFISGVCYSQLYRRTQNTNHGGNVFILTIATQIAVFVMIL 493          
BLAST of slc46a-3 vs. Ensembl Fly
Match: CG42514 (gene:FBgn0260388 transcript:FBtr0300657)

HSP 1 Score: 58.9214 bits (141), Expect = 2.393e-8
Identity = 109/499 (21.84%), Postives = 202/499 (40.48%), Query Frame = 2
Query:  137 NEDQNKNS------QKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYR-VGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELL-AIYYLWPITTFIYMETF-YGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLAS-----TVAAFLCLIYPLFLMMDSKPISDLSKVNMKPI--MAVW-----KQL--TSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILN-------IVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAF---------PFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQT-FNGLVFIFIGCFSLVAFILLI 1513
            N + N+NS      ++  E+       +  +  +   VEP +  Y FA ++ + V Q F  Y+   +  N T        +C   +   +++   K    N+ FL   ++ + +  I+ A F   FSDR GR+L  L+   G F  S + ++ A    WP+   IY  T    LTGA   + +  F+Y++D S    RT R+  + ++     +++++  G  + ++ ++  F  S     TV A L  +  ++ +   K  +   + +++ +     W     KQ    SLA + K +  +     I++L+  A Y      G      YL  Y +      +  Y           ++A+ L   L   +L   + D  +I         F    A + + L  + AT ++LL   A          P  R   SK   ++E+G +F  L + +     I+ V     Y++T  T   G VFI      +  F++++
Sbjct:   20 NSEDNENSASGTVREQRDEAAGRTVLQWAWHVVKSTSVEPTMFLYMFAFMITSVVEQNFFLYKSCRVNRNFTEE------ICRNLNKPENEEFRTKAMLTNAWFLQWENISAHVFPIILALFLGSFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVI-----YLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDFFDKQHVKDSLAVLVKPRKGHRRSFLIILLVSMALYTFQRDEG-----QYLYMYTLGKFDWDVSAYSNFKTFKSSAYVIAMLLAVPLMNKILG--WRDTTII---------FIGTWAHSIARLFFYFATNTDLLYAGAVVCSLGPIVGPMIRAMTSKIVPTSERGKVFALLSVCDNAVPFISGVCYSQLYRRTQNTNHGGNVFILTIATQIAVFVMIL 491          
BLAST of slc46a-3 vs. Ensembl Fly
Match: CG15890 (gene:FBgn0030576 transcript:FBtr0073939)

HSP 1 Score: 55.4546 bits (132), Expect = 2.566e-7
Identity = 83/374 (22.19%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  479 FYSVFSDRYGRRL-MFLIPGTGIFVKSVLELLAIYYLW-PITTFIYMET-FYGLTGAYNFVISLG-FSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVW---KQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMS-YPICMTSIQIGLYGI----LNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQG---ALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKK 1555
            F+  +SDR+ RR    LIP  G F+  V  +L +Y+   P+      E  F  L+G + F + +G FSY+AD +    RT RI  + +  ++G  +    SG ++    ++  F  S     +  +Y  F + + +   + S    K ++A +   + +     V  K+  N+    +++L+I     +G + G ++   YL + +    + ++   +        ++ +    G+ +  LN    D +V VL     +  +   AFAT P   ++     + + +AF   R   +K     E G   +LFG   + E +   +   +    Y  TL+   G  F+  G  +L  F + IF   Y   +  R+ 
Sbjct:  153 FWGSWSDRHRRRKPCILIPVVGEFLGVVGLMLCVYFEQAPMEAAALTEAIFPSLSGGW-FTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAFVYGFFFLEEPQSRPEKS-AEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHG-EMAVTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCVGILSHKLN--IDDALVGVLSSTSKILSSFVYAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFG---VAEALMPMVFAPMYTTLYAATLRVLPGAFFLLGGGLTL--FSVFIFLWMYRFQVRQRRN 516          
BLAST of slc46a-3 vs. Ensembl Fly
Match: CG15890 (gene:FBgn0030576 transcript:FBtr0339769)

HSP 1 Score: 55.4546 bits (132), Expect = 2.566e-7
Identity = 83/374 (22.19%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  479 FYSVFSDRYGRRL-MFLIPGTGIFVKSVLELLAIYYLW-PITTFIYMET-FYGLTGAYNFVISLG-FSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVW---KQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMS-YPICMTSIQIGLYGI----LNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQG---ALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKK 1555
            F+  +SDR+ RR    LIP  G F+  V  +L +Y+   P+      E  F  L+G + F + +G FSY+AD +    RT RI  + +  ++G  +    SG ++    ++  F  S     +  +Y  F + + +   + S    K ++A +   + +     V  K+  N+    +++L+I     +G + G ++   YL + +    + ++   +        ++ +    G+ +  LN    D +V VL     +  +   AFAT P   ++     + + +AF   R   +K     E G   +LFG   + E +   +   +    Y  TL+   G  F+  G  +L  F + IF   Y   +  R+ 
Sbjct:  153 FWGSWSDRHRRRKPCILIPVVGEFLGVVGLMLCVYFEQAPMEAAALTEAIFPSLSGGW-FTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAFVYGFFFLEEPQSRPEKS-AEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHG-EMAVTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCVGILSHKLN--IDDALVGVLSSTSKILSSFVYAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFG---VAEALMPMVFAPMYTTLYAATLRVLPGAFFLLGGGLTL--FSVFIFLWMYRFQVRQRRN 516          
BLAST of slc46a-3 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 118.627 bits (296), Expect = 1.490e-27
Identity = 111/434 (25.58%), Postives = 204/434 (47.00%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGT-RTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            +R + +EP++  Y FAS M   ++QQ++Y R+ + I N T P       C   S S+   + +++Q+  S F M   L S I S++       +SD+ GR++  ++P  G  + ++  L   ++   +   I       L G    ++   FSYVAD    G  +T R+A V +MI + A VAS+S+GY +    +  PF  S +   + L+Y +F++ +++ I D S+  +    A+     S+ ++    SR  + + +L++I F+  +     G+ + T Y ++ P+C T I +G YG     +I + + +   + + C  ++ +  + ++      L   FA + L  F+     + +   FP  R  +SK    +EQGALF  +   ET+    +       Y  T+    G VF+      L+   LL
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYRRLWLEITNSTYPVSENTSQCAANS-SNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSFLTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNLLYAIFILEETRVI-DRSE-TLACCQALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVG-YGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFSRIYAATVAWCPGFVFLLGAGLCLIPMSLL 431          
BLAST of slc46a-3 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 118.242 bits (295), Expect = 1.521e-27
Identity = 111/434 (25.58%), Postives = 204/434 (47.00%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGT-RTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            +R + +EP++  Y FAS M   ++QQ++Y R+ + I N T P       C   S S+   + +++Q+  S F M   L S I S++       +SD+ GR++  ++P  G  + ++  L   ++   +   I       L G    ++   FSYVAD    G  +T R+A V +MI + A VAS+S+GY +    +  PF  S +   + L+Y +F++ +++ I D S+  +    A+     S+ ++    SR  + + +L++I F+  +     G+ + T Y ++ P+C T I +G YG     +I + + +   + + C  ++ +  + ++      L   FA + L  F+     + +   FP  R  +SK    +EQGALF  +   ET+    +       Y  T+    G VF+      L+   LL
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYRRLWLEITNSTYPVSENTSQCAANS-SNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSFLTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNLLYAIFILEETRVI-DRSE-TLACCQALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVG-YGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFSRIYAATVAWCPGFVFLLGAGLCLIPMSLL 431          
BLAST of slc46a-3 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 118.242 bits (295), Expect = 1.521e-27
Identity = 111/434 (25.58%), Postives = 204/434 (47.00%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGT-RTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            +R + +EP++  Y FAS M   ++QQ++Y R+ + I N T P       C   S S+   + +++Q+  S F M   L S I S++       +SD+ GR++  ++P  G  + ++  L   ++   +   I       L G    ++   FSYVAD    G  +T R+A V +MI + A VAS+S+GY +    +  PF  S +   + L+Y +F++ +++ I D S+  +    A+     S+ ++    SR  + + +L++I F+  +     G+ + T Y ++ P+C T I +G YG     +I + + +   + + C  ++ +  + ++      L   FA + L  F+     + +   FP  R  +SK    +EQGALF  +   ET+    +       Y  T+    G VF+      L+   LL
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYRRLWLEITNSTYPVSENTSQCAANS-SNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSFLTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNLLYAIFILEETRVI-DRSE-TLACCQALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVG-YGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFSRIYAATVAWCPGFVFLLGAGLCLIPMSLL 431          
BLAST of slc46a-3 vs. Ensembl Zebrafish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 108.227 bits (269), Expect = 5.180e-24
Identity = 111/433 (25.64%), Postives = 204/433 (47.11%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRV-----GIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGH---GTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSK--PISDLSKVN--------MKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIF 1474
            +EP +  Y FA  M   ++QQ++Y R+     G IY     +++L+   + +S  S       +Q+  S FL+   L   I S+++A     +SD  GR++  + P  G  + ++  +L   + + +   +      GL G    +I   F+YVAD  G    G +T R+A + +++ +   +ASL +G+ I    +  PFL +     + L+Y L ++ +S   P S +S  +        ++   A+  +L  +  +    +R  +++ +L+L  FAF+ +    G  +   Y ++ P+C + + +G YG     AI L +    A+L+RC  D  +I+L L+   A  +  AFA + L  F+     LLS    P  R  +SK    +EQGA+F  +  +E +   ++  +    Y  TL  F+G  F+ 
Sbjct:    7 IEPAVGLYAFAMFMFYPLLQQYVYRRLWFELSGFIYT----SESLS---HCSSNHSYITLHQAVQKETSLFLLHSELCFLIPSLISALLLVSYSDYCGRKVAIVPPLVGEALHALSYVLVSRFSFSLNYLLASSFMSGLMGGPPTLIGGCFAYVADLCGEDLEGQKTVRMARLDMILGVLTGLASLCTGFFIKAAGFTWPFLTAVFLHLINLLYVLVVLKESLVLPNSAVSTSSPSASEAPRLRQTQALTTRLQGVYLLFAASNRRRNVVLLLMLAAFAFFKLALQGGWSIFILYELNTPLCWSEVFVG-YGSALSTAIYLVSFAGVALLSRCLPDAYIILLGLMSVAAGLIMAAFAKTTLLMFLVRLPLLLSIMPTPVLRSMMSKIVSGSEQGAMFACVAFVEMLSVGVSFTVFNSIYAATLSWFSGFSFLL 431          
BLAST of slc46a-3 vs. Ensembl Zebrafish
Match: slc46a1 (solute carrier family 46 member 1 [Source:NCBI gene;Acc:393255])

HSP 1 Score: 107.457 bits (267), Expect = 8.862e-24
Identity = 113/465 (24.30%), Postives = 193/465 (41.51%), Query Frame = 2
Query:  140 EDQNKNSQKCYESTPVEYKTYKTNFR-------------RFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQE----INSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYP-LFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNV--GEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIF 1474
            ED + ++    +S  V+ +T    FR                 VEP++    F+ ++Q  +  Q+++ R+         ++ + +   +T G +     D LQ     + +H+ + I+LG  +  +        +SDR GRRL+ +IP  G+ V++ + L  +Y   P+  F+      GL+G +N +++  F+YVAD S  G+RT R+A +   + +    AS+  G       Y  PF           +Y  LF+     P       + +   AV +  +S A   ++        S L L IF F+ V    +   DL   Y +S P+C     IG YG        L +      +  C  D  V ++ L   M   + ++ A +    F   G   L  ++ P  R  LSK     EQGALF  +  +E +C  ++  +    Y  TL    G  F+F
Sbjct:    2 EDSDTSAILAEDSESVDSRTVCCCFRVTENKAPPPCSCPLSVTVEPVMFLSTFSIVLQAPLCTQYLWDRL---------SEDVGYNGTKTGGCNASTVHDPLQTEVETLTAHWSLYINLGGFLVGLFMVILLGSWSDRAGRRLVLIIPSLGLAVQAAVYLTVMYLKLPVFWFLIGRICSGLSGDFNAILAGCFAYVADTSERGSRTFRVAILEACLGLAGMFASIIGGQWRRAQGYINPFWLVLATNLTAALYAYLFVPETVTPDPQARLFSTRHHQAVCRLYSSDAPPGRR--------SKLWLYIFCFFLVVTVHLGCSDLYVLYELSAPLCWGPELIG-YGSAAKHLAYLTSLTGLRAMQCCLEDSWVALVGLTSNMVGLVVISVADTTALMFTGYGLCFLFMASTPVLRSKLSKLVDPAEQGALFASVACVEGLCSLVSSGVFNALYPATLHFMKGFPFVF 448          
BLAST of slc46a-3 vs. Ensembl Xenopus
Match: slc46a1 (solute carrier family 46 (folate transporter), member 1 [Source:NCBI gene;Acc:100145771])

HSP 1 Score: 100.523 bits (249), Expect = 2.285e-21
Identity = 101/425 (23.76%), Postives = 182/425 (42.82%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFL----MMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESI----LSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYG--ILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIF 1474
            VEP+L    FA  +Q  +  Q+++ R+         N T    C      S      +++ + SH+ + I+LG  +  + +      +SD+ GRR +   P  G+ +++ L L+ +Y    +  F+      G++G +N +++  F+Y+AD S   +RT R+A +   + I   VAS+  G+      Y  PF           +Y  F     + D KP    +  +       ++    L TV  + +R   +    L++LV++         M   +L   Y +SYP+C  S  IG YG    ++  ++  AGL   +   C +D  V  +  I  ++  + ++ A++    F   G    + +  P  R  LSK  +  EQGALF  +  +E +   +   +    Y  TL    G  F+F
Sbjct:   34 VEPVLFLSMFALALQGPLTTQYLWDRLSADIGF---NGTRILDCTVNGSKSTGALQQEVETLTSHWSLYINLGGFLVGLFSVMLLGPWSDKVGRRPVLFFPCIGLALQAALYLVVMYQELHVAYFLIGRFISGISGDFNMILAGCFAYIADVSDRQSRTFRVAILEACLGIAGMVASIIGGHWRKAQGYINPFWLVFAVNLFTAVYVYFCVEESVKDKKPARLFTHRH-------YQTFFRLFTVSGENNRRRKLCLYSLALLVVVTV------HMGAKNLFVLYELSYPLCWDSDLIG-YGSAAEHLTYLSSLAGLR--LFQLCLADSWVAEMGFISNISGLVVISLASTTPVMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSVACVEGLSYLLATAVFNSLYPATLHFMQGFPFLF 439          
BLAST of slc46a-3 vs. Ensembl Xenopus
Match: SLC46A3 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:100492828])

HSP 1 Score: 97.4413 bits (241), Expect = 1.965e-20
Identity = 101/436 (23.17%), Postives = 193/436 (44.27%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTD-------KLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTR-TCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLAT----VHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAF 1501
            VEP++  Y FAS     ++QQ++Y R+ I         +  F+        + +++D       ++Q+  S F   + L + I S++ A     + DR+GR+   L+P  G  +  ++     ++  P+          G  G +   I   FSYVAD S    +   RIAFV +++ + + +A ++SGY I    +   FL   +   + + Y  F + ++   S+  +    P+++  +  T L T    + +  S  + ++  L+L+ F  Y +     V L T Y +  P+C  S+ +G +G        +G+     + +RC  D  ++ + +   +   + +AF+T+ +A  +     L +    P  R  +SK     EQGALF  +  +E++ G +T  +    Y  T+  F G  F+      L+ F
Sbjct:   20 VEPVVAIYCFASFFTFPLIQQYVYSRMLI------EGSSDGFINGNNISHCETNQSDPAYIHQKEVQKRASLFSSTLDLSALIPSLVMALILVSYGDRHGRKASILLPCLGALLSVLIYCAIAFFTLPLAVLYLSYVISGFMGGFATFIGGCFSYVADLSKDAQKKNIRIAFVDMVLGVSSGLAGIASGYFIRELGFNWSFLIPGLLHIINICYICFFLEETVQRSEFQQ----PVLSK-EGFTELFTGVFLLFRNASCKKRVVLTLLLLAFMLYLLANFGAVSLFTLYELDAPLCWDSVLVG-WGSAFSTFCFVGSFFGVYLFSRCLKDAYIVFIGMTSWIGGIILVAFSTTTIAMMLVRIPLLFAAMPLPVLRSIMSKVVLENEQGALFACIACLESITGVLTITIFSAVYAATVMWFPGFSFLLSAGICLLPF 443          
BLAST of slc46a-3 vs. Ensembl Xenopus
Match: ENSXETT00000010895.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:96277190:96281426:-1 gene:ENSXETG00000001477.1 transcript:ENSXETT00000010895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 3.274e-15
Identity = 93/403 (23.08%), Postives = 173/403 (42.93%), Query Frame = 2
Query:  362 NRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYM-----ITTYRYFVPFLASTVAAFLCLIYPLFL--MMDSKPISDLSKVNMKPIMAVWKQL--TSLATVHKKQSRNESI-----LSILVLIIFAF-----YNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLI 1513
            N+T  SS+  + D LQ+  S+F ++ ++   +  +L+A   +  SD+   ++   +P TG  +  +  L  I + WPI        F GLTG +    +   ++ +  S    R+ ++  + ++  +  F  SL SGY+     I  ++  +    ST     C++Y +F+  M D++   +        I    ++   +  A ++ K + N +I      S   +II  F     YN+   +  D+   +++  P+    +++G YG        + + L   + ++CF DL +I+  +I      L MAF       +IA    L S    P  R  +SK  K +  G +F  L +   V    +       YQ TL  F+G  F+    FS + F+ +I
Sbjct:   42 NQTIISSNSSRDDDLQKAISNFYIIYNVVMGMTPLLSAYILAKISDKTSTKVTICVPLTGYLISRMFLLFVILFEWPIEVIFGSAAFNGLTGWFTTYWAGVMAWASLASTESKRSLKLIIIELVYGLAGFAGSLVSGYIFVHLNINKHQGTILASCSTGCYAFCVLYSIFILKMPDAETCLEERNTEGSSINEASQESINSDCALLNDKPTNNTAINPSDVASSKCVIICMFVSAIVYNIAVTATDDVINVFVLKKPLNWGPVEVG-YGNAAAYMTYITSFLGVYIFSKCFGDLGLIITGMISFSCGILIMAFVRWTYLYYIARAVMLFSLITTPTIRSIISKHVKGSSYGQVFVVLQMAIEVIAVSSSAGFNKLYQATLDWFSGFCFLV---FSALGFLSII 440          
BLAST of slc46a-3 vs. Ensembl Xenopus
Match: ENSXETT00000010934.1 (thymic stromal cotransporter homolog [Source:NCBI gene;Acc:100487203])

HSP 1 Score: 79.7221 bits (195), Expect = 9.860e-15
Identity = 87/399 (21.80%), Postives = 169/399 (42.36%), Query Frame = 2
Query:  362 NRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYM---ITTYRYFVPFLAS-TVAAFL-CLIYPLFLMMDSKPISDLSKVNM-KPIMAVWKQLT------------SLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFI 1504
            N+T  SS+    + LQ+  S+F ++ +    +  +L+A F +  SD+  R++   +P TG  +  +  L  I + WPI          GLTG +    +   ++ +  S    R+ ++  + ++  +  F  SL+SG++   I    +    LAS ++  ++ C++Y  F++    P +   + N    I    K+ +            SL T+++   R    + I + I    YN+      D+   +++  P+    + +G YG        + + L   + + C  DL +I++ +I      L MAF       ++A    + S    P  R  +SK  + +  G +F  L L   V    +   +   YQ TL  ++G  F+    FS + F+
Sbjct:   35 NQTINSSNISSDEALQKAISNFYIVYNSIMGLGPLLSAYFLAKISDKINRKITICVPLTGYLISRMFLLFVILWDWPIEVMFGSAALNGLTGWFTAYWAGVMAWASLASTESKRSIKLIIIELVYGLAGFAGSLASGHIFVHININHHQGAILASCSLGCYVFCVLYSTFVLKIPSPETGCIETNEGTTINETQKEDSEYTERSRLLGDKSLQTLNQPHQRTTKFILISIFISVILYNIAAGGAEDVINVFVLKKPLSWGPVDVG-YGNAATYINYITSFLGVYVFSMCVGDLGLIIIGMISFSCGILIMAFVQWTYLYYVARAVMMFSLIPTPIIRSLISKHVQESLYGKVFAVLQLAIGVVYVSSSAGLNKLYQATLDWYSGFCFLL---FSTLGFL 429          
BLAST of slc46a-3 vs. Ensembl Xenopus
Match: ENSXETT00000010952.1 (thymic stromal cotransporter homolog [Source:NCBI gene;Acc:100487203])

HSP 1 Score: 79.7221 bits (195), Expect = 1.111e-14
Identity = 87/399 (21.80%), Postives = 169/399 (42.36%), Query Frame = 2
Query:  362 NRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYM---ITTYRYFVPFLAS-TVAAFL-CLIYPLFLMMDSKPISDLSKVNM-KPIMAVWKQLT------------SLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFI 1504
            N+T  SS+    + LQ+  S+F ++ +    +  +L+A F +  SD+  R++   +P TG  +  +  L  I + WPI          GLTG +    +   ++ +  S    R+ ++  + ++  +  F  SL+SG++   I    +    LAS ++  ++ C++Y  F++    P +   + N    I    K+ +            SL T+++   R    + I + I    YN+      D+   +++  P+    + +G YG        + + L   + + C  DL +I++ +I      L MAF       ++A    + S    P  R  +SK  + +  G +F  L L   V    +   +   YQ TL  ++G  F+    FS + F+
Sbjct:   35 NQTINSSNISSDEALQKAISNFYIVYNSIMGLGPLLSAYFLAKISDKINRKITICVPLTGYLISRMFLLFVILWDWPIEVMFGSAALNGLTGWFTAYWAGVMAWASLASTESKRSIKLIIIELVYGLAGFAGSLASGHIFVHININHHQGAILASCSLGCYVFCVLYSTFVLKIPSPETGCIETNEGTTINETQKEDSEYTERSRLLGDKSLQTLNQPHQRTTKFILISIFISVILYNIAAGGAEDVINVFVLKKPLSWGPVDVG-YGNAATYINYITSFLGVYVFSMCVGDLGLIIIGMISFSCGILIMAFVQWTYLYYVARAVMMFSLIPTPIIRSLISKHVQESLYGKVFAVLQLAIGVVYVSSSAGLNKLYQATLDWYSGFCFLL---FSTLGFL 429          
BLAST of slc46a-3 vs. Ensembl Mouse
Match: Slc46a3 (solute carrier family 46, member 3 [Source:MGI Symbol;Acc:MGI:1918956])

HSP 1 Score: 83.5741 bits (205), Expect = 4.418e-16
Identity = 99/426 (23.24%), Postives = 177/426 (41.55%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKT-------DKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYG-LTGAYNFVISLGFSYVADRSG-HGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKK-QSRNESILSILV--LIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFI 1471
            +EP +L   FA  +   +  Q++Y R      I        F  N      D++K+       +++Q+  S F + + + + I  +++       SD +GR+L  ++   G    +    +  Y+  P+   I   TF G L G Y       F+Y+ D+   +  R  RIA +  M+ +   +  LSSGY I    +   +  + +   + L Y LF + D    S    V M  I ++         + K   S+ +++L +L+  L+I+ F  +G      + T Y +  P+C   + IG    L  V+  L + L   + + C  D+ +  + +   M      AF  + L  F+     + +       R  LSK   STEQGALF  +  +ET+ G  +       Y  T+  + G +F+
Sbjct:    6 IEPAILLNAFAMTLTIPLTAQYVYRR------IWEETGNYTFASNSNGSECDQNKSSSIFAFREEVQKKASLFNLQVEMSALIPGLVSTFMLLASSDNHGRKLPMVLSSLGSLGTNTWLCMMSYFDLPLQLLI-ASTFIGALFGNYTTFWGACFAYIVDQQKEYKHRIIRIAILDFMLGVVTGLTGLSSGYFIRELGFVWSYFITAMVLIVNLAYILFFLNDPIKESSSQIVTMSCIESLKDLFYRTYMLFKNGSSKRQALLCLLIFTLVIYFFVIIGI---SPIFTLYELGPPLCWNEVYIGYGSALGSVSF-LSSFLGIWLFSYCLKDIHIAYIGIFTTMVGMTLAAFTRTTLMMFLVRIPFIFTIMPLSVLRSMLSKVVHSTEQGALFACIAFLETLAGVTSTSAYSGIYSATVAWYPGFIFL 420          
BLAST of slc46a-3 vs. Ensembl Mouse
Match: Slc46a3 (solute carrier family 46, member 3 [Source:MGI Symbol;Acc:MGI:1918956])

HSP 1 Score: 83.5741 bits (205), Expect = 4.418e-16
Identity = 99/426 (23.24%), Postives = 177/426 (41.55%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKT-------DKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYG-LTGAYNFVISLGFSYVADRSG-HGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKK-QSRNESILSILV--LIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFI 1471
            +EP +L   FA  +   +  Q++Y R      I        F  N      D++K+       +++Q+  S F + + + + I  +++       SD +GR+L  ++   G    +    +  Y+  P+   I   TF G L G Y       F+Y+ D+   +  R  RIA +  M+ +   +  LSSGY I    +   +  + +   + L Y LF + D    S    V M  I ++         + K   S+ +++L +L+  L+I+ F  +G      + T Y +  P+C   + IG    L  V+  L + L   + + C  D+ +  + +   M      AF  + L  F+     + +       R  LSK   STEQGALF  +  +ET+ G  +       Y  T+  + G +F+
Sbjct:    6 IEPAILLNAFAMTLTIPLTAQYVYRR------IWEETGNYTFASNSNGSECDQNKSSSIFAFREEVQKKASLFNLQVEMSALIPGLVSTFMLLASSDNHGRKLPMVLSSLGSLGTNTWLCMMSYFDLPLQLLI-ASTFIGALFGNYTTFWGACFAYIVDQQKEYKHRIIRIAILDFMLGVVTGLTGLSSGYFIRELGFVWSYFITAMVLIVNLAYILFFLNDPIKESSSQIVTMSCIESLKDLFYRTYMLFKNGSSKRQALLCLLIFTLVIYFFVIIGI---SPIFTLYELGPPLCWNEVYIGYGSALGSVSF-LSSFLGIWLFSYCLKDIHIAYIGIFTTMVGMTLAAFTRTTLMMFLVRIPFIFTIMPLSVLRSMLSKVVHSTEQGALFACIAFLETLAGVTSTSAYSGIYSATVAWYPGFIFL 420          
BLAST of slc46a-3 vs. Ensembl Mouse
Match: Slc46a1 (solute carrier family 46, member 1 [Source:MGI Symbol;Acc:MGI:1098733])

HSP 1 Score: 80.8777 bits (198), Expect = 3.187e-15
Identity = 99/418 (23.68%), Postives = 179/418 (42.82%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYR--VGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVH--KKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFI 1471
            VEPL+    FA ++Q  +  Q++++R    + YN T   +     C   S      + + L    SH+ + +++G  +  +  +     +SDR GRR + ++   G+ +++V+ +  +     +  F+       L G +N +++  F+ VAD S + +RT R+A +   I +   +ASL  G+ +    Y  PF  +     +  +Y  F   ++  + +     +  +    +   S+A ++      ++   L++  L IF    V      D+ T Y +S P+C  S  IG YG        L + L   +L  C +D  V  + L F +   +  AFAT     F   G   LS    P  R  LSK    +EQGALF  +  + ++   +   +    Y  TL    G  F+
Sbjct:   25 VEPLVFLANFALVLQGPLTTQYLWHRFSTELGYNGTRHREN----CGNQSADPLMKEVETL---TSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLELHVGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALALLIVMALYAAFCFGET--VKEPKSTRLFTL----RHHRSIARLYVVPAPEKSRMHLALYSLAIFVVVTV-HFGAQDILTLYELSAPLCWDSKLIG-YGSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPATLNFMKGFPFL 427          
BLAST of slc46a-3 vs. Ensembl Mouse
Match: Slc46a2 (solute carrier family 46, member 2 [Source:MGI Symbol;Acc:MGI:1353616])

HSP 1 Score: 78.1814 bits (191), Expect = 2.266e-14
Identity = 91/407 (22.36%), Postives = 177/407 (43.49%), Query Frame = 2
Query:  392 KTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMIT-----TYRYFVPFLASTVAAFLCLIYPLFLMM--DSKPISDLSKVN-MKPIMAVWKQLTSLATVHKKQSRN-------ESILSILVLIIFA---FYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKKE 1558
            + D+ Q+  S+F ++ +L   +  +L+A      SDRY R++       G  +  +  LL +   WP+          GL G+++   S   +  +     G R+ R+  + +++ +  F  S++SG++       + +  +    S   A   L Y LF++   +SKP      V+ +  +M  ++ L       +   RN       +S    +V ++F     Y++  +  VD+   +++  P+    +Q+G YG+ +   I + + L   + +RCF D  +I++ ++   +  L +AF       +IA    L +       R  +SK  K +  G +F  L L  T+ G +T  +    YQ TL  F G  F+     S +A I+ I  + Y  V  +++ E
Sbjct:   68 QEDQQQKAISNFNIIYNLVLGLTPLLSAYGLGWLSDRYHRKISICTAMLGFLLSRIGLLLKVMLDWPVEVMYGAAALNGLCGSFSAYWSGVMALGSLGCSEGRRSVRLILIDLVLGLAGFSGSMASGHLFKQIVGHSAQGLLLTACSVGCAAFALFYSLFVLKVPESKPNKVHPTVDTVSGMMGTYRTLDPDQQDKQNVPRNPRTPGKGKSSQREVVALLFVGAIIYDLAAVGTVDVMALFVLKEPLHWNQVQLG-YGMASGYIIFITSFLGVLVFSRCFRDTTMIIIGMLSFGSGALLLAFVKETYMFYIARAIMLFALIPITTIRSAMSKLIKDSSYGKIFVILQLCLTLTGVVTSTIYNKIYQLTLDKFIGTCFVLSSFLSFLA-IVPIGVVAYKQVPRSQQGE 472          
BLAST of slc46a-3 vs. Ensembl Mouse
Match: Mfsd14b (major facilitator superfamily domain containing 14B [Source:MGI Symbol;Acc:MGI:1913881])

HSP 1 Score: 54.6842 bits (130), Expect = 6.664e-7
Identity = 97/425 (22.82%), Postives = 167/425 (39.29%), Query Frame = 2
Query:  470 TAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGL---TGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTY------RYFVPFLASTVA----AFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFY-NVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMA---FATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVL---MLYFYQKTLQTFN----------------GLVFIFIGCFSLVAFILLIFTIPY---SHVLDNRKKEKG*NIKTGPSHLACLRIHQFICD 1627
            +AP     SD +GR+   L  GT  F    + L+ I   W          ++G+   +G ++   S+ F+YVAD +    R+    +V        F ASL S   I TY         V  +A+ VA     F+ +  P  L    +P S  ++++       WKQ    A++ KK  ++ ++L I + +  ++    G+ S   L    ++ +        I + GIL+IVA      +  + L R   +   ++L L F M   LQ+A   F +     + A     +S   FP     +S+  +S +QG   G +  I  +C  +   L   + Y +   L                    G  F+F  C  L++F++ +F   Y   S V  +     G ++ T P   +   I   + D
Sbjct:   98 SAPLIGALSDVWGRKPFLL--GTVFFTCFPIPLMRINPWW----------YFGMISVSGVFSVTFSVIFAYVADFTQEHERSTAYGWVS-----ATFAASLVSSPAIGTYLSANYGDSLVVLVATLVALLDICFILIAVPESLSEKIRPASWGAQIS-------WKQADPFASL-KKVGKDSTVLLICITVFLSYLPEAGQYSSFFLYLRQVIGFGSVKIVAFIAMVGILSIVAQT----VFLSKLMRSLGNKNTVLLGLGFQM---LQLAWYGFGSQAWMMWAAGTVAAMSSITFPAVSALISRNAESDQQGVAQGIVTGIRGLCNGLGPALYGFIFYMFHVELSELGPKLNSDDDPLQGAFIPGPPFLFGACIVLMSFLVALFIPEYRKTSGVQKHNNSTSG-SLSTPPERGSDEDIEPLLQD 489          
BLAST of slc46a-3 vs. UniProt/SwissProt
Match: sp|Q5F4B8|S46A3_CHICK (Solute carrier family 46 member 3 OS=Gallus gallus OX=9031 GN=SLC46A3 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.083e-33
Identity = 116/431 (26.91%), Postives = 203/431 (47.10%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGII-YNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFY-GLTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQ-LTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLV 1495
            R+   VEP++  Y FAS + + V+QQFIY ++    YN TA +   +  C R   S        +QE  S F M + L  ++ S++ A       D  GR+   ++P  G  +  +   +  Y+ WP T+ +++ TF  GL G+    +  GF+Y+AD+      +T RIA + ++  + + +A LSSGY +    +   F  +++   + +IY  F + D+  IS+  +          K+  + +  + K     + IL I++L IF  Y      G  L T Y +  P+C T + IG YG     +I+L + L   + ++C  D+ ++ + +   +   +  AFA + L  F+    +L S    P  R  LSK    +EQGA+F  +  +E + G I+  +    Y  T+  F+G  F+      L+
Sbjct:    2 RKVLLVEPVIFIYIFASSLTSPVVQQFIYRKLWEEEYNSTAISSDNSSHCERNKSSPTYVMEKAIQEKTSFFNMQLDLTGAVPSLIVAFIIVANGDHQGRKKSLVLPSIGALIADIFLTIVSYFSWP-TSVLFLATFISGLFGSMATFLGGGFAYIADQCHDEKQKTTRIAVIDLIFGVVSGLAGLSSGYFLREMGFTWTFATASLLHVVNIIYITFFLQDTVHISEFQQQAPLSYKEHLKETFSGVYMLFKTAPSKKRILIIVLLFIFMTYLFTMFGGSSLFTLYELDEPLCWTEVYIG-YGAAAFTSISLTSFLGVYLFSKCLKDIYIVFIGIFSYIGGIVMAAFAKTTLLMFLVRVPSLFSIMPIPVLRSMLSKVVLPSEQGAVFACIACLEVLTGTISLSVFNVIYAATVAWFSGFSFLLSASLCLI 430          
BLAST of slc46a-3 vs. UniProt/SwissProt
Match: sp|Q7ZWG6|PCFT_DANRE (Proton-coupled folate transporter OS=Danio rerio OX=7955 GN=slc46a1 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.389e-22
Identity = 111/463 (23.97%), Postives = 192/463 (41.47%), Query Frame = 2
Query:  140 EDQNKNSQKCYESTPVEYKTYKTNFR-------------RFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQE----INSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYP-LFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIF 1474
            ED + ++    +S  V+ +T    FR                 VEP++    F+ ++Q  +  Q+++ R+         ++ + +   +T G +     D LQ     + +H+ + I+LG  +  +        +SDR GRRL+ +IP  G+ V++ + L  +Y   P+  F+      GL+G +N +++  F+YVAD S  G+RT R+A +   + +    AS+  G       Y  PF           +Y  LF+     P       + +   AV +  +S A   ++     S L + +L  F    V  +   DL   Y +S P+C     IG YG        L +      +  C  D  V ++ L   M   + ++ A +    F   G   L  ++ P  R  LSK     EQGALF  +  +E +C  ++  +    Y  TL    G  F+F
Sbjct:    2 EDSDTSAILAEDSESVDSRTVCRCFRVTENKAPPPCSCPLSVTVEPVMFLSTFSIVLQAPLCTQYLWDRL---------SEDVGYNGTKTGGCNASTVHDPLQTEVETLTAHWSLYINLGGFLVGLFMVILLGSWSDRAGRRLVLIIPSLGLAVQAAVYLTVMYLKLPVFWFLIGRICSGLSGDFNAILAGCFAYVADTSERGSRTFRVAILEACLGLAGMFASIIGGQWRRAQGYINPFWLVLATNLTAALYAYLFVPETVTPDPQARLFSTRHHQAVCRLYSSDAPPGRR-----SKLWLYILCFFLVVTV-HLGCSDLYVLYELSAPLCWGPELIG-YGSAAKHLAYLTSLTGLRAMQCCLEDSWVALVGLTSNMVGLVVISVADTTALMFTGYGLCFLFMASTPVLRSKLSKLVDPAEQGALFASVACVEGLCSLVSSGVFNALYPATLHFMKGFPFVF 448          
BLAST of slc46a-3 vs. UniProt/SwissProt
Match: sp|Q6DCX5|PCFT_XENLA (Proton-coupled folate transporter OS=Xenopus laevis OX=8355 GN=slc46a1 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.539e-20
Identity = 98/421 (23.28%), Postives = 183/421 (43.47%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFL----MMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESIL--SILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYG--ILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVF 1468
            VEP++    FA  +Q  +  Q+++ R+         N T    C      S   +  +++ + +H+ + I+LG  +  + +      +SD+ GRR + ++P  G+ +++ + LL +Y    +  F+      G++G +N +++  F+Y+AD S   +RT R+A +   + I   VAS+  G+      Y  PF           +Y  F     + D KP    +  +       ++    L TV  + +R   +   S+ +L++   +    M   +L   Y +SYP+C  S  IG YG    ++  ++  AGL   +   C +D  V  +  I  ++  + ++ A++    F   G    + +  P  R  LSK  +  EQGALF  +  +E +   +   L    Y  TL    G  F
Sbjct:   27 VEPVIFLSMFALALQGPLATQYLWDRLSADIGF---NGTRTVGCAMNGSKSAGPEQQEVETLTAHWSLYINLGGFLVGLFSVMLLGPWSDKVGRRPVLMLPCIGLALQAAVYLLVMYQELHVGYFLIGRFISGISGDFNMILAGCFAYIADVSDRQSRTFRVAVLEACLGIAGMVASIIGGHWRKAQGYINPFWLVFAVNLFTALYVYFCVEESVKDKKPARLFTHRH-------YQSFFRLFTVQGENNRRRKLFLYSLALLVVVTVH----MGAKNLFVLYELSYPLCWDSDLIG-YGSAAEHLTYLSSLAGLR--LFQLCLADSWVAEMGFISNISGLVVISLASTTPIMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSVACVEGLSFLLATGLFNSLYPATLHFMKGFPF 430          
BLAST of slc46a-3 vs. UniProt/SwissProt
Match: sp|A5D7V7|S46A3_BOVIN (Solute carrier family 46 member 3 OS=Bos taurus OX=9913 GN=SLC46A3 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.969e-16
Identity = 105/418 (25.12%), Postives = 170/418 (40.67%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDK-----TDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYG-LTGAYNFVISLGFSYVADRSGHGT-RTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGL 1462
            VEP++    FA  + + +  Q++Y R   I+  T  N ++A   N +  + +K        +++Q+  S F + + +   I  +++   +   SD  GR+   ++   G    S    L  Y+  PI   I   TF G L G Y   +   F+Y+ D+      RT RIA +  +  + + +  LSSGY I    +   FL  TVA F+ LIY L  + DS   S    +++               + K  S  +  L  L+L     Y    +    +   Y +  P+C   + IG    L  V     + L   + + C  D+ +  +     M      AFA + L  F+     L +       R  +SK   STEQG +F  L  +ET+ G IT V           TFNG+
Sbjct:    6 VEPVICLSVFAVTLNSPLTTQYVYRR---IWEETG-NYSIALESNTSECAKNKSSPIFAFQEEVQKKVSLFNLEMDISGLIPGLVSTFVFLSHSDHGGRKFPLILSSVGALANSAWLCLLSYFALPIQLLI-ASTFIGALFGNYTTFLGASFAYIVDQCKEKKQRTIRIAIIDFLFGVVSGLTGLSSGYFIRGLGFVWSFLIVTVALFVNLIYILLFLEDSMKESSSQNISVSWTETFKNLFHRTYMLFKNASGEQQSLCCLLLFTMITYFFVTIGVSPIFVLYELDSPLCWDEVLIGYGSALGSVTF-FSSFLGIWLFSYCMEDIHMAFIGTFTTMVGMAMTAFARTTLMMFLVRLPFLFTVMPLSVLRSMISKVVHSTEQGTMFACLAFLETL-GGITAV----------STFNGI 406          
BLAST of slc46a-3 vs. UniProt/SwissProt
Match: sp|Q7Z3Q1|S46A3_HUMAN (Solute carrier family 46 member 3 OS=Homo sapiens OX=9606 GN=SLC46A3 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.902e-16
Identity = 107/419 (25.54%), Postives = 176/419 (42.00%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYG-LTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNM-----KPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGL 1462
            VEP +    FA  +   +  Q++Y R+     N T  + +    C +   S      +++Q+  S F + + +   I  +++       SD YGR+   ++   G    SV   L  Y+ +P    I   TF G   G Y       F+Y+ D+   H  +T RIA +  ++ +   +  LSSGY I    +   FL   V+  + LIY LF + D  P+ + S  N+     +    ++ +   L      + R    L +  +I + F  +G      L   Y +  P+C   + IG YG     A  L + L   + + C  D+ +  + +   M      AFA++ L  F+A    L +   F   R  LSK  +STEQG LF  +  +ET+ G +T V           TFNG+
Sbjct:    6 VEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLI-ASTFIGAFCGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGD--PVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFIL---YELDSPLCWNEVFIG-YGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETL-GGVTAV----------STFNGI 406          
BLAST of slc46a-3 vs. TrEMBL
Match: A0A0H3YFD5 (Slc46a-3 OS=Schmidtea mediterranea OX=79327 GN=slc46a-3 PE=2 SV=1)

HSP 1 Score: 953.355 bits (2463), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 2
Query:  116 MSTEYLVNEDQNKNSQKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKKEKG 1564
            MSTEYLVNEDQNKNSQKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFLMLISLGSSIASILTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKKEKG
Sbjct:    1 MSTEYLVNEDQNKNSQKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFLMLISLGSSIASILTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKKEKG 483          
BLAST of slc46a-3 vs. TrEMBL
Match: A0A0H3YJM6 (Slc46a-2 OS=Schmidtea mediterranea OX=79327 GN=slc46a-2 PE=2 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 4.404e-128
Identity = 219/447 (48.99%), Postives = 303/447 (67.79%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRT-SGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRK 1552
            RR   VEPL+L Y     +Q TVM Q++YYRVG   N+T  N  LA+VCNR  +G S+K+KTDKLQEI ++  M I L SSI +ILTAPFYSVFSDR+GR+LMF++PG G FVKSV+E+L I Y WP+  F+  E FYGL G +NF  SL +SY+AD S    RT R+  +G+++ +GA + SL SG  I    Y  P++ + V A LC +YP+FL+ +   I+D  K  + PI    +Q+ S+  V+  + +    L ILV ++F FY V EMSG+ L   YLMSYPICM +IQ+ ++G  N++A+NLG G++   L++ FSDL ++  CL+ G+A+ LQMAFA S    +IA  SNL SFSAFPF RG++SKR    EQGALFGGL L ETVCGAITKV+ +YFY++T + F+G+V++ +  FS++A +L++F +P    L   +
Sbjct:   39 RRCVTVEPLMLMYVVILYLQMTVMGQYVYYRVGKDLNLTT-NGNLAYVCNRNVTGGSEKEKTDKLQEIYTYNTMFIQLSSSIFTILTAPFYSVFSDRFGRKLMFILPGGGAFVKSVIEILIIVYEWPLYIFVITEGFYGLFGGFNFATSLSYSYIADISTQKERTKRMGIMGVLMGLGALLVSLVSGIWIKYRNYKEPYIFTGVVALLCFLYPIFLLKEPPKINDPKKTIISPI----EQMKSIVKVYWDKPKEYRALLILVFVLFNFYYVSEMSGLSLSGTYLMSYPICMDTIQLSIFGASNMLALNLGIGITIIFLSKFFSDLFLVFFCLLSGIAYLLQMAFAVSVTQVYIAAASNLFSFSAFPFIRGYMSKRMGPNEQGALFGGLALSETVCGAITKVITIYFYRETFRIFHGMVYLLLTGFSVIACVLILFALPIDRKLKAEE 480          
BLAST of slc46a-3 vs. TrEMBL
Match: A0A0H3YJH7 (Slc46a-4 OS=Schmidtea mediterranea OX=79327 GN=slc46a-4 PE=2 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 7.893e-82
Identity = 171/434 (39.40%), Postives = 274/434 (63.13%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRT-SGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILS--ILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFIL 1507
            R+ FGVE L+  YG   L +++VM+QFIY++V +  +    N+     CN + S +++K ++DK+Q ++ +++M ISLG SIA + T+PF+ + + R+GRR++ +  G G F+KSV E L I+  W +  FIY+ET +GLTG    + S+ FS +A+ S    R  RI    I  A+GA + S+S+GYMI TY +  PF+ +T+ +  C+ YP+F +  SKP  +  K+++KP +  + ++   A         ++ILS   +VL++F F+ VGE +  ++     MSYPICM SIQIG    L I+ +N+G  LS  +LN+  ++LVVI++CL FG+ FN+QM +A +  + +IA GSN+LS SAFPF +G+LSK T    Q  LF GL ++E   G ++K +++  YQ+TL+ +   V++ + CF+ VAF+L
Sbjct:   23 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDF-FENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIE-EKLDLKPTILEFSEIIFSA---------KNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFML 445          
BLAST of slc46a-3 vs. TrEMBL
Match: U3IKW0 (Solute carrier family 46 member 3 OS=Anas platyrhynchos platyrhynchos OX=8840 GN=SLC46A3 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.137e-32
Identity = 117/432 (27.08%), Postives = 208/432 (48.15%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGII-YNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISD---LSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLV 1495
            R+FF VEP++  Y FAS + + V+QQFIY R+    YN T  + +    C +   S    K   +QE  S F M + L +++ S++ A       DR GR+   ++P  G  +  + + L  Y+  P++         GL G+    +  GF+Y+AD       +T RIA V ++  + + +A LSSGY++    +   F  +++   + +IY +F + D+  IS+    ++V+ K ++   +  + +  + K     + IL I++L  F  Y      G  L T Y ++ P+C   + IG YG     +++L + L     ++C  D+ ++ + +   +   +  AFA + L  F+    +L      P  R  LSK    +EQGA+F  +  +E V G I+ ++    Y  T+  F+G  F+F   F L+
Sbjct:    2 RKFFFVEPVIFVYMFASYLTSPVVQQFIYRRLWEEEYNSTFISSSNTSSCEQNKSSPAYIKQKGVQEKTSLFNMQLDLTAAVPSLVVAFIIVANGDRQGRKRSLVLPSVGALIADIFQTLISYFSLPLSVLFAATFISGLFGSMATFLGGGFAYIADLCHDEKQKTTRIAVVDLIFGVVSGLAGLSSGYILREMGFTWTFGTASLLHVVNIIYIIFFLEDTVSISESQQQAQVSFKELLK--ETFSGVYMLFKTAPSKKRILIIVLLFTFMTYLFTVFGGSSLFTLYELNEPLCWNEVYIG-YGAAAFTSVSLTSFLGVYFFSKCLKDIYIVFIGIFSYVGGIVMAAFAKTTLLMFLVRVPSLFCLMPVPVLRSMLSKVVLPSEQGAVFACIACLEVVTGTISLLVFNVLYAATVAWFSGFSFLFSAGFCLI 430          
BLAST of slc46a-3 vs. TrEMBL
Match: R0JZX7 (Solute carrier family 46 member 3 (Fragment) OS=Anas platyrhynchos OX=8839 GN=Anapl_14056 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.137e-32
Identity = 117/432 (27.08%), Postives = 208/432 (48.15%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGII-YNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISD---LSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLV 1495
            R+FF VEP++  Y FAS + + V+QQFIY R+    YN T  + +    C +   S    K   +QE  S F M + L +++ S++ A       DR GR+   ++P  G  +  + + L  Y+  P++         GL G+    +  GF+Y+AD       +T RIA V ++  + + +A LSSGY++    +   F  +++   + +IY +F + D+  IS+    ++V+ K ++   +  + +  + K     + IL I++L  F  Y      G  L T Y ++ P+C   + IG YG     +++L + L     ++C  D+ ++ + +   +   +  AFA + L  F+    +L      P  R  LSK    +EQGA+F  +  +E V G I+ ++    Y  T+  F+G  F+F   F L+
Sbjct:    2 RKFFFVEPVIFVYMFASYLTSPVVQQFIYRRLWEEEYNSTFISSSNTSSCEQNKSSPAYIKQKGVQEKTSLFNMQLDLTAAVPSLVVAFIIVANGDRQGRKRSLVLPSVGALIADIFQTLISYFSLPLSVLFAATFISGLFGSMATFLGGGFAYIADLCHDEKQKTTRIAVVDLIFGVVSGLAGLSSGYILREMGFTWTFGTASLLHVVNIIYIIFFLEDTVSISESQQQAQVSFKELLK--ETFSGVYMLFKTAPSKKRILIIVLLFTFMTYLFTVFGGSSLFTLYELNEPLCWNEVYIG-YGAAAFTSVSLTSFLGVYFFSKCLKDIYIVFIGIFSYVGGIVMAAFAKTTLLMFLVRVPSLFCLMPVPVLRSMLSKVVLPSEQGAVFACIACLEVVTGTISLLVFNVLYAATVAWFSGFSFLFSAGFCLI 430          
BLAST of slc46a-3 vs. Ensembl Cavefish
Match: si:dkey-5g14.1 (solute carrier family 46 member 3-like [Source:NCBI gene;Acc:103033173])

HSP 1 Score: 119.783 bits (299), Expect = 5.947e-28
Identity = 112/441 (25.40%), Postives = 211/441 (47.85%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAI------YYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGT-RTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPI-SDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            ++F+ VEP++  Y FA  +   ++QQ++Y R+   I N + P    +  C+ T+ S+      ++Q+  S F M   L S I S++       +SD+ GR++  ++P  G  V   L  LA+       YL  I +F+       L G    ++   FSYVAD    G  +T R+A V ++I + + VA +SSGY +    +  P + +     + L+Y +F + +S+ I S +++ N     A+ +    +  +    SR  ++L + ++ I + ++     G+ + T Y+++ P+C + I IG    L+   + + + +    L+RC  +LV++ + ++      + MAFA + L  F+     +L+   FP  R  +SK    +EQGALF  +  ++++   +        Y  T+  F G  F+      L+   LL
Sbjct:    2 KKFYFVEPVVAVYSFACFLLYPLVQQYVYRRLWQEITNTSYPALDTSSRCD-TNSSNHTSHHYEVQQAASLFSMYSELFSLIPSLIATLVLVAYSDQRGRKITIILPLVGSLVYC-LAFLAVSFFELNLYLLIIASFVS-----SLFGGIGTMLGGCFSYVADLCEDGKQKTLRMAGVDMVIGLFSGVALISSGYFLRETGFNWPLVTAGTVHLVNLLYSVFFLEESRVIESSVAEDNRTCGEAIRRLTFGIYNLFALGSRRRNVLLVFLITIISTFSFANFGGLTVVTLYVLNEPLCWSEILIGYASALS-TTVFVTSFVGVYFLSRCLPELVIVFIGMLSVFTGMVMMAFAKTTLMMFLVRIPMVLAIMPFPVLRSMMSKVVSKSEQGALFAWVAFVDSLSTNLASAAFNSVYSSTVAWFPGFAFLLAAGICLIPMALL 434          
BLAST of slc46a-3 vs. Ensembl Cavefish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 86.6557 bits (213), Expect = 3.631e-17
Identity = 107/447 (23.94%), Postives = 197/447 (44.07%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRV-----GIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVAD---RSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDL-----------SKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMA-FATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            +EP++  + F+  M   ++QQ+IY R+     G  Y  +  NQ+     + +S  ++      +Q   SHFL+   L   + S+ T+P    +SD  GR+   + P  G    +    +   +   ++  +      GL G    +    FSYVAD       G +T R+A + +++ + + + SL +G+ I    +  PFL +++   L LIY + +++   P  +L               +    A+  +L  +  +    +R    + +L+L  + FY V  M G+ +   Y ++ P+C   + +  YG      I L +    A+L+R   D  + +L L+  +A  L MA FA + L  F+     LLS    P  R  +SK   S+EQGALF  +  +E +   +   +    Y  T+  F+G  F+     +++   L+
Sbjct:    7 IEPVVGLHAFSMFMTYPLLQQYIYRRLWQQLSGHPYP-SNQNQS-----HCSSNYTNLSLQQAVQTETSHFLLQSELCFILPSLFTSPLLVSYSDYGGRKSAMVPPLLGDLFFTFHYFIVSRFSLNLSYVLAAAFLTGLLGGPTTLTGGCFSYVADYCREELAGQKTVRMARLDMVLGVLSGLGSLCTGFFIRAAGFSWPFLCASILHLLNLIY-VLIILKEPPGQNLPPSPSSPGSVIEPPRLSQAQAMTGRLQGVYLLFAASTRRRRTVLLLLLTAYIFYKVSNMGGMSIFILYELNAPLCWNEVLVS-YGSALSTLIYLSSFTGVALLSRWLPDAPIALLGLL-SIAVGLSMAAFAKTTLLMFLVRLPLLLSMMPAPVMRAMMSKLVLSSEQGALFACVAFVEMLSMGLAFPVFSSVYAATISWFSGFSFLLAAGVTIIPITLI 444          
BLAST of slc46a-3 vs. Ensembl Cavefish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 86.6557 bits (213), Expect = 3.631e-17
Identity = 107/447 (23.94%), Postives = 197/447 (44.07%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRV-----GIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVAD---RSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDL-----------SKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMA-FATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            +EP++  + F+  M   ++QQ+IY R+     G  Y  +  NQ+     + +S  ++      +Q   SHFL+   L   + S+ T+P    +SD  GR+   + P  G    +    +   +   ++  +      GL G    +    FSYVAD       G +T R+A + +++ + + + SL +G+ I    +  PFL +++   L LIY + +++   P  +L               +    A+  +L  +  +    +R    + +L+L  + FY V  M G+ +   Y ++ P+C   + +  YG      I L +    A+L+R   D  + +L L+  +A  L MA FA + L  F+     LLS    P  R  +SK   S+EQGALF  +  +E +   +   +    Y  T+  F+G  F+     +++   L+
Sbjct:    7 IEPVVGLHAFSMFMTYPLLQQYIYRRLWQQLSGHPYP-SNQNQS-----HCSSNYTNLSLQQAVQTETSHFLLQSELCFILPSLFTSPLLVSYSDYGGRKSAMVPPLLGDLFFTFHYFIVSRFSLNLSYVLAAAFLTGLLGGPTTLTGGCFSYVADYCREELAGQKTVRMARLDMVLGVLSGLGSLCTGFFIRAAGFSWPFLCASILHLLNLIY-VLIILKEPPGQNLPPSPSSPGSVIEPPRLSQAQAMTGRLQGVYLLFAASTRRRRTVLLLLLTAYIFYKVSNMGGMSIFILYELNAPLCWNEVLVS-YGSALSTLIYLSSFTGVALLSRWLPDAPIALLGLL-SIAVGLSMAAFAKTTLLMFLVRLPLLLSMMPAPVMRAMMSKLVLSSEQGALFACVAFVEMLSMGLAFPVFSSVYAATISWFSGFSFLLAAGVTIIPITLI 444          
BLAST of slc46a-3 vs. Ensembl Cavefish
Match: zgc:174356 (proton-coupled folate transporter-like [Source:NCBI gene;Acc:103039826])

HSP 1 Score: 68.1662 bits (165), Expect = 2.053e-11
Identity = 90/366 (24.59%), Postives = 155/366 (42.35%), Query Frame = 2
Query:  491 FSDRYGRRLMFLIP------GTGIFVKSVL-ELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRS--GHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKP----ISDLSKVNMKPIMAVWKQ---------LTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSY----PICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            +SDR GRR + ++P        G+ V  VL E +++Y+       I      GLTG +  +  + FSY+AD +     +RT R+A    M+ +G  V  L  G++   +     F+A        ++Y +  + D +P    +S  SK   +   +   Q           S   V +++S  +  L + +LI+  F N    + V ++T  L+ Y    P   T+   G Y    +  +  G      +L RCF ++ +  L  +F  A  + +AF+T+    F+A  +     +     R   S      EQ A+F     +E  C  +  V+    Y +TL TF G  FI +  F ++  IL+
Sbjct:   41 WSDRVGRRHVLVLPFILSLLSGGVLVAMVLVETMSVYWCLLAAGII------GLTGGHVSIFLISFSYLADITIDSSSSRTLRMAVAEAMVFVGGMVGFLLGGFLEQWFGLLEAFIAYICCHVFAILYIVLWLRDPRPFGSALSFPSKEEEEQTSSEKSQSGLFILKYAKLSFQAVFRRRSGQDR-LKLQLLILCTFIN----NLVSIETAILLLYLKYKPREFTTEMFGAYNSARMFLLGFGLLGLFPLLMRCFREMTLAKLSAVFRAASYVLLAFSTNTWMVFLAVVATPAGITQ-AVIRSLSSAIVGPDEQ-AMFSFSASVEATCILLGAVIFNGLYPQTLPTFPGFPFIIMAGFCIIVLILM 393          
BLAST of slc46a-3 vs. Ensembl Cavefish
Match: slc46a2 (solute carrier family 46 member 2 [Source:ZFIN;Acc:ZDB-GENE-170126-3])

HSP 1 Score: 62.7734 bits (151), Expect = 1.082e-9
Identity = 91/381 (23.88%), Postives = 167/381 (43.83%), Query Frame = 2
Query:  389 DKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVP---FLA--STVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGIL--NIVAIN--LGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFI 1504
            D  D  Q I ++F M+ ++ +    I+ A   +   DR  R++  ++P  G  V   L L  I   W I         +GL G ++   +   + V+  +    R+ RI    ++  +  F+ SL+SG++   Y   +     LA  S V    CL+Y  F++     +S L++  ++      +  T + + H +Q +   ++  L+ +    Y+V    GV++ + Y++  P+  ++ ++G YG    N++ I   LG  L T       S +++ ++  + G+ F   M F TS    F+ +   L +    P  R  LSK+ + T     F  L L   +    T  +    Y+ TL TF G VFI   C + ++ I
Sbjct:   34 DHQDHSQNIIANFYMIFNMLTKFVPIIPALVLARIGDRGYRKVPIVVPLVGYTVSRALLLFVILLDWRIEVMYAAPVIHGLCGGFSSYWAGVMALVSVTTSEEDRSLRIMRTELVYGMAGFLGSLASGHLFQLYSVDIKQGVVLASMSVVLYVFCLLYATFVL----KVSRLAQDGLQR-----QDSTGIISNHFQQDK---MIIALLFLSGILYDVAVGGGVEMLSIYVLKPPLAWSATEVG-YGNAAGNVIFITSFLGVKLFTRFSVSDSSMVMIGMVSFMIGIYF---MTFVTSTAMYFLRS-VMLFALIPMPTIRSLLSKQVRGTSY-MTFTCLQLSFRLASLATTPIYTKIYESTLDTFPGFVFILSSCITFLSVI 396          
BLAST of slc46a-3 vs. Ensembl Sea Lamprey
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 107.457 bits (267), Expect = 1.242e-24
Identity = 105/431 (24.36%), Postives = 201/431 (46.64%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDK-LQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAF---ATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILL 1510
            VEP++  + FA  + + + QQ+IY R G   N +  N +    C+  +GS  +D+ +K  Q   S F + + L   + ++L +    V+SD  GRRLM ++P  G  ++S++ +L +    P+          G TG Y  +++  F+Y+ D +       R+A + ++I I   + ++ SG+M+    Y   +L   +   LC+IY +  +++     D   ++++      +  T++  V      ++     L+L+ F FY + E+ G    + + M  P+C  ++ +G YG     AI + + +   +L+RC SD  +    LI    F + MA      + L  F+     + +       R  +SK    +EQG LF  +  +E + G +  V+    Y  T+  F  LVF+     +++ F++L
Sbjct:    7 VEPIVALFAFAVFLSSPLNQQYIYRRFG---NFST-NDSTGSTCS-PNGSDVEDELEKEAQAAASLFQVRLDLVGFLPAVLASLVLGVYSDTSGRRLMMILPCIGYSLESIVYILIVSLELPLPWLYLGCLLRGATGGYASILAGSFAYLTDVANPANLNMRVACLDMLIGISGGIGAVISGHMLQAMGYAFVYLCVCLILVLCIIY-VACVLEETITKD---IHVRSCTTPLRATTTVPFVQPGGPGSKRWRLALLLVAFTFYLLAEIGGSLPVSLFEMKAPLCWDALLLG-YGSAVGFAIFITSFVGVTVLSRCLSDPPI---ALIGISTFTVGMAMICGVQTTLMMFLVRLPLMFTIMPVAVMRSMMSKTVLPSEQGTLFSLVGSLELLAGIVGSVVFNNVYAVTVGWFACLVFLLSSAVAVIPFLIL 424          
BLAST of slc46a-3 vs. Ensembl Nematostella
Match: EDO42708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0P7])

HSP 1 Score: 108.227 bits (269), Expect = 9.979e-25
Identity = 97/446 (21.75%), Postives = 196/446 (43.95%), Query Frame = 2
Query:  206 TNFRRFFGVEP--LLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSD--------KDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQ-TFNGLVFIFIGCFSLVAFILL 1510
             NF++     P  ++  Y +   M   V+QQ++Y R+       A ++   +  ++ +G  +        +    ++Q + S+  + I + +++ S++ +     ++D  GRR    +P  G  ++S++ +L +Y+ WPI       +  GL G++  +I    +Y+AD +    R+ R+A +  M+  GA V+ L+SG  I  Y + +P+        L  I  + ++ +S+P  D+  +  K      + L ++  V+            L+ +     N+       +   +++  P+C +   +G    L  ++I +GA L   +L R  S + +  + ++  MA  +   F+T     F+   + L      P  RG +S+     EQGALF  +  +E +C      L    Y  +L+  F G VF      + + FIL+
Sbjct:    2 VNFQKLKWRTPEIVVFLYAYGLFMHVPVIQQYVYSRI-------AKSKGFPYDAHKKTGCGNITILNATMQHIEQEVQSLASYVHLGIVMFAALPSVVMSLLIGSWTDSRGRRPALFLPALGSTLESIVVILVMYFEWPIYVLFVGASINGLCGSFTTIIMGTMAYIADTTHEDQRSLRLAILEFMVFFGAMVSQLTSGLWIEKYSFIIPYWFILSCLSLSCILVIAIVPESRP-PDV--IQNKTAFCSCRSLQNVYKVYMTPREGGRRNLFLLTLSSGVTNLILQGVAGVIVLFVLHTPLCFSPKLVGYLSALRYLSIGVGAVLGIKVLGRWLSVINISRVGMLSTMASYILFGFSTKIFIVFLVPFAGLFMGCVVPILRGIMSRIVSQDEQGALFSAVASLEMLCHLCGTFLFNSLYPASLKFHFPGFVFFLGAIITWIPFILI 437          
BLAST of slc46a-3 vs. Ensembl Nematostella
Match: EDO32892 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS4])

HSP 1 Score: 100.138 bits (248), Expect = 4.025e-22
Identity = 108/436 (24.77%), Postives = 197/436 (45.18%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRV----GIIY--NITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDS--KPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNL-----LSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQT-FNGLVFIFIGCFSLV 1495
            VEP++  Y F  ++   V+QQ+I+ R+    G+ Y  N T    T   +    S     +   ++Q   S+  M + L  S  S+L A     +SDR GRR    +P  G  V+S + L+ +Y+  P+T  +  E   G  G +  ++   FSY+AD +    R  R+  +  +  I   ++ L+SG+ I    +  P+    +     L+Y  F++ +S  K + + SKV +  +      + ++  +  K SR+   ++I  ++I     V  +    +   Y +  P+C  +I IG Y  L+     +GA L    L  C S+  ++ + ++  ++  + MAF TS    F+  G +L     L     P  R  +SK   +  QGALF  +  +ET+C  +  ++    Y  +++    GL F+ +    L+
Sbjct:    5 VEPVIFCYAFGIILHVPVIQQYIHQRLSEGKGLTYEYNNTDSRTTCEPIQMANSSEETLELQKEVQAEASYMQMGLVLSVSTPSLLVALLLGAWSDRAGRRRAMAMPIFGSAVESAIILVIMYFELPVTFLLLAEFINGSCGFFPTMVLSVFSYIADITEESQRAFRLGILEAIAFISGMLSHLTSGWWINNLGFRAPYWLLLILNTFALLYVTFILPESRAKHVMEKSKVRVLSL----DHIRAIVMIFTK-SRDPQRMTIF-MVISGLMIVSSIGFGSVFVLYALDRPLCCNAILIGYYLGLSFFVQAVGAVLGLKYLRLCLSETALMQVGMVSIISSLVVMAFVTSKKTLFV--GKSLPFVACLGGVPTPTIRAMMSKMVDADGQGALFAAVASLETLCTLLGALVFNSIYPYSIRIGLKGLSFMVMAWLMLI 432          
BLAST of slc46a-3 vs. Ensembl Nematostella
Match: EDO38916 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBG4])

HSP 1 Score: 95.1301 bits (235), Expect = 2.027e-20
Identity = 98/437 (22.43%), Postives = 192/437 (43.94%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRV----GIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSK-PISDLSK---VNMKPIMAVWKQLTSLATVHKKQSRNESILSIL--VLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQ-TFNGLVFIFIGCFSLVAFIL 1507
            +EP++  Y +  LM   V+QQF+Y ++    G  Y+   P+            S+  +   ++Q   ++  + I++  S+ SI+ +     +SD +GR+   L+P  G  +++V  L+ +Y    +          G +G    ++    +Y+AD +    R  R+A +  ++  G  V+ L+SG  I    +  P+        +   Y +FL+ +++ P  +  K    + K +  +WK    + +  +   R   +L  L   L   A   VG      + T Y++  P+C ++  +G +  +  + +  GA      L +   +L +  L L+  +   +   F+T+    FI     LL+ +  P F+G LS+     EQGALF  +  +ET+C  I  + +   Y   L+    G+VF  +   SL+  ++
Sbjct:    1 IEPVIFLYVYGILMHGPVIQQFVYSKIAKQKGFFYD---PSSHTGCGNETRYNSTLHNLEQEVQATAAYVQIGITMFESLPSIVLSLMVGSWSDCHGRKPAILLPVIGSMLEAVCVLIVMYCDLDVYVLFIGALLNGCSGYLPTLLMGIMAYIADSTDESQRALRLAIMEALVFTGGMVSQLTSGLWIDKLGFTGPYWFIFGCLVIAFFYTIFLVPETRFPDENTEKSRFFSCKTLKRIWK----VYSTPRDGGRKNMLLLTLNDALTQVAIQGVGP-----VMTLYILHSPLCFSADDLGYFSAVRFLVMGFGAVFGLKFLVKWIDELSISRLGLLTTIGTYVLFGFSTTRAMVFIVGAVGLLNGAVAPVFKGMLSRIVSRDEQGALFSFVASLETLCSFIGALTLSSMYPAFLKHDLPGMVFFLVAIVSLIPLLV 425          
BLAST of slc46a-3 vs. Ensembl Nematostella
Match: EDO48562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIS8])

HSP 1 Score: 88.1965 bits (217), Expect = 5.887e-18
Identity = 107/452 (23.67%), Postives = 194/452 (42.92%), Query Frame = 2
Query:  197 TYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTS-GSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLI----IFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIG--LYGILNIVAIN--LGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTF-----NGLVFIFIGCFSLVAFILL 1510
            ++  N  R   VE  + FY    +++  V+QQ++Y R      I   N +   +C+     S+ +   D +QE  S +++  +L   + ++LTA     +SD+ GR+ + LI   G  V + + L  +Y   P+   I      G+ G Y  ++    +Y+AD +    R  ++A +  +  +   +   SSG  I    Y   F        +  IY LF + +S P     ++         +Q+ S+  V+ K+     IL +L L+    +FA Y V       L   Y   YP+C ++  +G  L  +L + A    LG  L + M    ++   +  L LI G+     + F+ +    F++  +NL S    P  R  +S+     EQGALF  L  +E++    ++++    Y  ++         G+ F      +++ FILL
Sbjct:    9 SWLKNPHRAVTVEITIFFYIAGMILELPVLQQYLYERAAKELKIN--NTSNTTICSPNDLNSTGQSANDAVQEKASQYILAYNLALQLPAVLTACLLGTWSDKNGRKPLMLIVAFGAIVDASVALFTVYTDGPLYPLIIGGGINGVMGFYPTMVLALLAYIADTTPSKRRAIKLAVLEALAFLSGTLGHFSSGIYIHHLGYKATFWGILSLHLINFIYLLFFLPESMP---KQRIEQSGKCLTLEQVKSVYMVYLKKRDGRWILCVLSLLSVFFLFAQYIV-----TTLGVLYGKRYPLCWSAELVGYFLGTLLCVKAFGAVLGIWLGSLMKLTNYTAAQIGTLFLIAGLTM---IGFSQTTFLMFMSCVANLFSGVPQPCIRAQMSQMVGKEEQGALFAILASLESLTNFTSQLIFNPLYAWSIANVAWKYAAGIPFFVNAGIAVIPFILL 447          
BLAST of slc46a-3 vs. Ensembl Nematostella
Match: EDO48913 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHU0])

HSP 1 Score: 77.411 bits (189), Expect = 1.629e-14
Identity = 107/435 (24.60%), Postives = 187/435 (42.99%), Query Frame = 2
Query:  212 FRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRV----GIIY-NITAPNQTLAFVCNRTSGSSDKDKTDKLQEIN-----SHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVP--FLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNE--SILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQ-TFNGLVFI 1471
             R+  GVEP++  Y         +M  +IY R+    G  Y N+T   +     C   +  +  D   KL EI      S  ++   + +++ +   APF   ++D+ GR+   +I  TG  V+++L LL ++   P+ T I      GL+G+ N ++    SY+AD         R A +   + I   V+ L+SG  I  + + +P  FL   + A L   Y +FL+ +++   + SKV +    ++ K    + T      R     IL+ L + I A    G       Q  +++  P+C     IG Y         LG  +  ++L +C ++L ++ +  I  M+  L  AF+      F+    +       P F    SK     +QG+LF  + ++ T+   +   L    Y  +L+  F GLVF+
Sbjct:   32 LRQRLGVEPVVFIYFVWVFKMIPIMNIYIYSRISEDKGFPYMNLTNGEEG----CGAENHGNATDDRLKLLEIEVQTETSSLILYYIIAATMTTFFIAPFMGPYTDKKGRKPGLVIALTGAMVETILTLLILHLKLPLWTMIVGAFINGLSGSINTILLSVMSYIADSVSPERLGFRYAVMQFTMFIAGTVSQLTSGLWINNFGFKIPVWFLLGCLCAILA--YVIFLLEETRIPENKSKVRLFDPSSI-KVFIRVFTKDYDAGRKNLYMILTFLGINILATVGTGTA-----QLLFVLLRPLCWAPSLIGYYLAYKYFTGGLGGAVMISLLKKCLNELNIVRVGYISVMSGLLLFAFSDRTWMVFLGPAVSFARGVTDPIFLDMSSKIVSQDDQGSLFAVVGILSTIGELVGTSLFNNIYPMSLRFGFPGLVFV 454          
BLAST of slc46a-3 vs. Ensembl Medaka
Match: slc46a1 (solute carrier family 46 member 1 [Source:NCBI gene;Acc:101170694])

HSP 1 Score: 111.694 bits (278), Expect = 3.332e-25
Identity = 117/453 (25.83%), Postives = 201/453 (44.37%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQE----INSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPF---LASTVAAFLCLIYPLFLMMDSK-PISDLSKVNMKPIMAVWKQLTSLAT-VHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFT--IPYSHVLDNRKK 1555
            VEP+L    FA ++Q  ++ Q+++ R+         +  L +  +R S  +  +  D LQ+    + +H+ + I+LG     +L  P    +SD  GRR + ++P  G+ +++ + L+ +Y   P+  F+      GL+G +N +++  F+YVAD S   +RT R+A +   + +   +AS+  G       Y  PF   LA+ +A+ L   Y   ++ +S  P      +  +   AVW+  ++  + +   +S     L +  L  F    V   S  +L   Y +S P+C  S  IG YG        L + L   ++  C  D  V ++ L   +   L  + A S    F   G   L  +  P  R  LSK    +EQG+LF  +  +ET+C  +   +    Y  TL    G  F+F       A +LLI    I     LD R++
Sbjct:   55 VEPVLFLSTFALVLQAPLVTQYLWDRI---------SDELGYNGSRRSECNSSEPADPLQKQVETLTAHWNLYINLGGFSVGLLVVPLLGSWSDLAGRRTVLILPNLGLALQAAVYLVVMYLKLPVAYFLVGRLLSGLSGDFNAILAGCFAYVADISDRKSRTFRVAVLEACLGLAGILASIIGGQWRRAQGYINPFWLVLATNLASAL---YASLVVRESVLPDPSAKLLTTRHHKAVWRLYSTGGSGIDGDRSFCRCKLWLYSLCFFVVVTVHSGSR-ELYVLYELSPPLCWGSALIG-YGSAAQNLAYLTSLLGLRIMQLCLEDSWVALVSLASNIIGLLVFSVADSTQLMFTGYGLCFLFMAVTPVLRSKLSKLVDPSEQGSLFASVACVETLCYLVGSGIFNSLYPATLYFMRGFTFLF------AAILLLIPAGIIGTLQCLDQRRE 487          
BLAST of slc46a-3 vs. Ensembl Medaka
Match: slc46a1 (solute carrier family 46 member 1 [Source:NCBI gene;Acc:101170694])

HSP 1 Score: 110.538 bits (275), Expect = 6.103e-25
Identity = 110/431 (25.52%), Postives = 192/431 (44.55%), Query Frame = 2
Query:  230 VEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQE----INSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPF---LASTVAAFLCLIYPLFLMMDSK-PISDLSKVNMKPIMAVWKQLTSLAT-VHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLV 1495
            VEP+L    FA ++Q  ++ Q+++ R+         +  L +  +R S  +  +  D LQ+    + +H+ + I+LG     +L  P    +SD  GRR + ++P  G+ +++ + L+ +Y   P+  F+      GL+G +N +++  F+YVAD S   +RT R+A +   + +   +AS+  G       Y  PF   LA+ +A+ L   Y   ++ +S  P      +  +   AVW+  ++  + +   +S     L +  L  F    V   S  +L   Y +S P+C  S  IG YG        L + L   ++  C  D  V ++ L   +   L  + A S    F   G   L  +  P  R  LSK    +EQG+LF  +  +ET+C  +   +    Y  TL    G  F+F     L+
Sbjct:   26 VEPVLFLSTFALVLQAPLVTQYLWDRI---------SDELGYNGSRRSECNSSEPADPLQKQVETLTAHWNLYINLGGFSVGLLVVPLLGSWSDLAGRRTVLILPNLGLALQAAVYLVVMYLKLPVAYFLVGRLLSGLSGDFNAILAGCFAYVADISDRKSRTFRVAVLEACLGLAGILASIIGGQWRRAQGYINPFWLVLATNLASAL---YASLVVRESVLPDPSAKLLTTRHHKAVWRLYSTGGSGIDGDRSFCRCKLWLYSLCFFVVVTVHSGSR-ELYVLYELSPPLCWGSALIG-YGSAAQNLAYLTSLLGLRIMQLCLEDSWVALVSLASNIIGLLVFSVADSTQLMFTGYGLCFLFMAVTPVLRSKLSKLVDPSEQGSLFASVACVETLCYLVGSGIFNSLYPATLYFMRGFTFLFAAILLLI 442          
BLAST of slc46a-3 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:101171853])

HSP 1 Score: 108.997 bits (271), Expect = 2.299e-24
Identity = 113/446 (25.34%), Postives = 203/446 (45.52%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDK-DKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKP---------IMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLI--------------FGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIF 1474
            +R + VEP++  Y F+S +   ++QQ+IY R+ + + N   P  + +  C  ++ SS++ D   ++Q+  S F M   L S+I S++       +SDR GR++  ++P  G  + +   L   ++   I   I       L G     +   F+Y+AD       RT R+A V +MI + + VA++S+GY +    +  PFL S +   L L+Y +F++ ++    +   +  +          +  V++  + L +  K       IL  L++ IF  ++   + G+ L T Y ++ P+C   + IG            G+ LST +    F+ +  +  C +               GM   + M+FA + +  FI     LLS   FP  R  +SK    +EQGALF  L  +E++   ++  +    Y  T+  + G VFI 
Sbjct:    2 KRLYLVEPVVALYAFSSFLIYPLVQQYIYRRLWLQLTNTAYPISSNSSRCAPSNSSSNQTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYASSFLTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCFAYIADLCKNERQRTLRMAGVDMMIGLLSGVAAISTGYFLRAAGFNWPFLTSLLCQCLTLLYAIFILEETVKAPNEGDIFDESTRRHALKYMVCGVYQTFSGLTSKCK-------ILLALMMFIFTSFSFAYVGGISLVTLYELNEPLCWNEVLIGY-----------GSALSTTVFLTSFAGVAALTYCRVPQLLIILLGILSVASGM---ILMSFAKTTVLMFIVRIPMLLSIMPFPVLRSMMSKNISKSEQGALFACLSFLESLTNNVSSGVFNSIYAATVAWYPGFVFIL 426          
BLAST of slc46a-3 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:101171853])

HSP 1 Score: 108.997 bits (271), Expect = 2.299e-24
Identity = 113/446 (25.34%), Postives = 203/446 (45.52%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDK-DKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKP---------IMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLI--------------FGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIF 1474
            +R + VEP++  Y F+S +   ++QQ+IY R+ + + N   P  + +  C  ++ SS++ D   ++Q+  S F M   L S+I S++       +SDR GR++  ++P  G  + +   L   ++   I   I       L G     +   F+Y+AD       RT R+A V +MI + + VA++S+GY +    +  PFL S +   L L+Y +F++ ++    +   +  +          +  V++  + L +  K       IL  L++ IF  ++   + G+ L T Y ++ P+C   + IG            G+ LST +    F+ +  +  C +               GM   + M+FA + +  FI     LLS   FP  R  +SK    +EQGALF  L  +E++   ++  +    Y  T+  + G VFI 
Sbjct:    2 KRLYLVEPVVALYAFSSFLIYPLVQQYIYRRLWLQLTNTAYPISSNSSRCAPSNSSSNQTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYASSFLTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCFAYIADLCKNERQRTLRMAGVDMMIGLLSGVAAISTGYFLRAAGFNWPFLTSLLCQCLTLLYAIFILEETVKAPNEGDIFDESTRRHALKYMVCGVYQTFSGLTSKCK-------ILLALMMFIFTSFSFAYVGGISLVTLYELNEPLCWNEVLIGY-----------GSALSTTVFLTSFAGVAALTYCRVPQLLIILLGILSVASGM---ILMSFAKTTVLMFIVRIPMLLSIMPFPVLRSMMSKNISKSEQGALFACLSFLESLTNNVSSGVFNSIYAATVAWYPGFVFIL 426          
BLAST of slc46a-3 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:HGNC Symbol;Acc:HGNC:27501])

HSP 1 Score: 99.7525 bits (247), Expect = 1.787e-21
Identity = 111/431 (25.75%), Postives = 202/431 (46.87%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGI-IYNITAPNQTLAFVCNRTSGSSDK-DKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADR-SGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKP---------IMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNL-QMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVF 1468
            +R + VEP++    F+S +   ++QQ+IY R+ + + N T P  + +  C  ++ SS++ D   ++Q+  S F M   L S+I S++       +SDR GR++  ++P  G  + +   L   ++   I   I       L G     +   ++Y+AD       RT R+A V +M  + + VA++S+GY +    +  PFL S +   L L+Y +F++ ++    +   +  +          +  V++  + L++  K       IL  L++ IF  ++   + G+ L T Y ++ P+C   + IG YG      ++L +    A L  C    ++IVL  I  +A  +  M+FA + +  FI     LLS   FP  R  +SK    +E GALF     +E +   ++  +    Y  T+  + G VF
Sbjct:    2 KRLYLVEPVVALSAFSSSLIYPLVQQYIYRRLWLQLTNTTYPISSNSSRCAPSNSSSNQTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYASSFLTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCYAYIADLCKNERQRTLRMAGVDMMSGLLSGVAAISTGYFLRAAGFNWPFLTSLLCQCLTLLYAIFILEETVKAPNEGDIFDESTRRHALKFLVCGVYQTFSGLSSKCK-------ILLALMMFIFTSFSFAFIGGISLVTLYELNKPLCWNEVLIG-YGSALSTTVSLISFAGVAALTYCRVPQLLIVLLGILSVASGMILMSFAKTTVLMFIVNIPMLLSNMPFPVLRSMMSKNISKSEHGALFACFSFLEILTINVSFGVFNSIYAATVAWYPGFVF 424          
BLAST of slc46a-3 vs. Planmine SMEST
Match: SMESG000065064.1 (SMESG000065064.1)

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 481/483 (99.59%), Postives = 482/483 (99.79%), Query Frame = 2
Query:  116 MSTEYLVNEDQNKNSQKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKKEKG 1564
            MSTEYLVNEDQNKNSQKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFLMLISLGSSIASILTAPFYSVFSDRYGRRLMFLIPG+GIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVI LCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKKEKG
Sbjct:    1 MSTEYLVNEDQNKNSQKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEINSHFLMLISLGSSIASILTAPFYSVFSDRYGRRLMFLIPGSGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIALCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRKKEKG 483          
BLAST of slc46a-3 vs. Planmine SMEST
Match: SMESG000065062.1 (SMESG000065062.1)

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 513/520 (98.65%), Postives = 517/520 (99.42%), Query Frame = -1
Query: 1862 QSAENIEERNIYMITVVDKSRVKATFDICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNENGLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTDSMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVLMMLFIWLISIVFHQDIIHMIRGTHKMEKYVAFACXXXXXXXIDGVSMFHRLSFIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFXXXXXXXXXXXXXXXXXXICLELSIIFAILLAAERKYKIVMIFFGIIVTIYLLSPLILIVLYQIKVSLGNSEMHTIFQDEEFPMRFKIPFQMFNIFFINCGTLFWDQRVTVTYVNIIISGSVVSYFILFYLSIKRSIKFLLTTSVMGYIIGVMIYFLLFLHLGTHLPSTLVXXXXXXXXXXXXITVNHQLYSLGTNKWAVSQRKEESNTEDLLLPLNALKISGDASIKIF 3421
            QSAENIEERNIYMITVVDKSR+KATFDICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNENGLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTDSMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVL+MLFIWLISIVFHQDIIHMI G HKMEKY+AFA AIAIA+LIDGVSMFHRLSFIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFFNRNNVVGNIMNIIIGIFICLELSIIFAILLAAERKYKIVMIFFGIIVTIYLLSPLILIVLYQIKVSLGNSEMHTIFQDEEFPMRFKIPFQMFNIFFINCGTLFWDQRVTVTYVNIIISGSVVSYFILFYLSIKRSIKFLLTTSVMGYIIGVMIYFLLFLHLGTHLPSTLVINICSITPGIIIITVNHQLYSLGTNKWAVSQRKEESNTEDLLLPLNALKISGDASIKIF
Sbjct:   14 QSAENIEERNIYMITVVDKSRMKATFDICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNENGLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTDSMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVLIMLFIWLISIVFHQDIIHMILGIHKMEKYIAFASAIAIAILIDGVSMFHRLSFIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFFNRNNVVGNIMNIIIGIFICLELSIIFAILLAAERKYKIVMIFFGIIVTIYLLSPLILIVLYQIKVSLGNSEMHTIFQDEEFPMRFKIPFQMFNIFFINCGTLFWDQRVTVTYVNIIISGSVVSYFILFYLSIKRSIKFLLTTSVMGYIIGVMIYFLLFLHLGTHLPSTLVINICSITPGIIIITVNHQLYSLGTNKWAVSQRKEESNTEDLLLPLNALKISGDASIKIF 533          
BLAST of slc46a-3 vs. Planmine SMEST
Match: SMESG000065062.1 (SMESG000065062.1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 348/362 (96.13%), Postives = 355/362 (98.07%), Query Frame = -1
Query: 2336 QSAENIEERNIYMITVVDKSRVKATFDICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNENGLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTDSMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVLMMLFIWLISIVFHQDIIHMIRGTHKMEKYVAFACXXXXXXXIDGVSMFHRLSFIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFXXXXXXXXXXXXXXXXXXICLELSIIFAILLAAERKYKIVMIFFGIIVTIYLLSPLILIVLYQIKVSLGNSE 3421
            QSAENIEERNIYMITVVDKSR+KATFDICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNENGLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTDSMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVL+MLFIWLISIVFHQDIIHMI G HKMEKY+AFA AIAIA+LIDGVSMFHRLSFIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFFNRNNVVGNIMNIIIGIFICLELSIIFAILLAAERKYKIVMIFFGIIVTIYLLSPLILIVLYQ+K ++   E
Sbjct:   14 QSAENIEERNIYMITVVDKSRMKATFDICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNENGLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTDSMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVLIMLFIWLISIVFHQDIIHMILGIHKMEKYIAFASAIAIAILIDGVSMFHRLSFIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFFNRNNVVGNIMNIIIGIFICLELSIIFAILLAAERKYKIVMIFFGIIVTIYLLSPLILIVLYQMKRNIEKPE 375          
BLAST of slc46a-3 vs. Planmine SMEST
Match: SMESG000065078.1 (SMESG000065078.1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.190e-124
Identity = 206/421 (48.93%), Postives = 288/421 (68.41%), Query Frame = 2
Query:  293 FIYYRVGIIYNITAPNQTLAFVCNRT-SGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFILLIFTIPYSHVLDNRK 1552
            ++YYRVG   N+T  N  LA+VCNR  +G S+K+KTDKLQEI ++  M I L SSI +ILTAPFYSVFSDR+GR+LMF++PG G FVKSV+E+L I Y WP+  F+  E FYGL G +NF  SL +SY+AD S    RT R+  +G+++ +GA + SL SG  I    Y  P++ + V A LC +YP+FL+ +   I+D  K  + PI    +Q+ S+  V+  + +    L ILV ++F FY V EMSG+ L   YLMSYPICM +IQ+ ++G  N++A+NLG G++   L++ FSDL ++  CL+ G+A+ LQMAFA S    ++A  SNL SFSAFPF RGF+SKR    EQGALFGGL L ETVCGAITKV+ +YFY++T + F+G+V++ +  FS++A +L++F +P    L   +
Sbjct:    2 YVYYRVGKDLNLTT-NGNLAYVCNRNVTGGSEKEKTDKLQEIYTYNTMFIQLSSSIFTILTAPFYSVFSDRFGRKLMFILPGGGAFVKSVIEILIIVYEWPLYIFVITEGFYGLFGGFNFATSLSYSYIADISTQKERTKRMGIMGVLMGLGALLVSLVSGIWIKYRNYKEPYIFTGVVALLCFLYPIFLLKEPPKINDPKKTIISPI----EQMKSIVKVYWDKPKEYRALLILVFVLFNFYYVSEMSGLSLSGTYLMSYPICMDTIQLSIFGASNMLALNLGIGITIIFLSKFFSDLFLVFFCLLSGIAYLLQMAFAVSVTQVYLAAASNLFSFSAFPFIRGFMSKRMGPNEQGALFGGLALSETVCGAITKVITIYFYRETFRIFHGMVYLLLTGFSVIACVLILFALPIDRKLKAEE 417          
BLAST of slc46a-3 vs. Planmine SMEST
Match: SMESG000065066.1 (SMESG000065066.1)

HSP 1 Score: 288.886 bits (738), Expect = 1.785e-86
Identity = 173/434 (39.86%), Postives = 275/434 (63.36%), Query Frame = 2
Query:  215 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRT-SGSSDKDKTDKLQEINSHFXXXXXXXXXXXXXXTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILS--ILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFIL 1507
            R+ FGVE L+  YG   L +++VM+QFIY++V +  +    N+     CN + S +++K ++DK+Q ++ +++M ISLG SIA + T+PF+ + + R+GRR++ +  G G F+KSV E L I+  W +  FIY+ET YGLTG    + S+ FS +A+ S    R  RI    I  A+GA + S+S+GYMI TY +  PF+ +T+ +  C+ YP+F +  SKP  +  K+++KP +  + ++   A         ++ILS   +VL++F F+ VGE +  ++    LMSYPICM SIQIG    L I+ +N+G  LS  +LN+  ++LVVI++CL FG+ FN+QM +A +  + +IA GSN+LS SAFPF +G+LSK T    Q  LF GL ++E   G ++K +++  YQ+TL+ +   V++ + CF+ VAF+L
Sbjct:   23 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDF-FENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLYGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIE-EKLDLKPTILEFSEILFSA---------KNILSSFTVVLLMFGFFYVGETAASEILYYILMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFML 445          
The following BLAST results are available for this feature:
BLAST of slc46a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC46A38.126e-1725.54solute carrier family 46 member 3 [Source:HGNC Sym... [more]
SLC46A38.301e-1725.84solute carrier family 46 member 3 [Source:HGNC Sym... [more]
SLC46A11.032e-1522.48solute carrier family 46 member 1 [Source:HGNC Sym... [more]
SLC46A26.165e-1021.81solute carrier family 46 member 2 [Source:HGNC Sym... [more]
SLC46A11.783e-821.81solute carrier family 46 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc46a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc46a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG425142.004e-821.84gene:FBgn0260388 transcript:FBtr0300656[more]
CG425142.004e-821.84gene:FBgn0260388 transcript:FBtr0300655[more]
CG425142.393e-821.84gene:FBgn0260388 transcript:FBtr0300657[more]
CG158902.566e-722.19gene:FBgn0030576 transcript:FBtr0073939[more]
CG158902.566e-722.19gene:FBgn0030576 transcript:FBtr0339769[more]
back to top
BLAST of slc46a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC46A31.490e-2725.58si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
SLC46A31.521e-2725.58si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
SLC46A31.521e-2725.58si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
slc46a35.180e-2425.64solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
slc46a18.862e-2424.30solute carrier family 46 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc46a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc46a12.285e-2123.76solute carrier family 46 (folate transporter), mem... [more]
SLC46A31.965e-2023.17solute carrier family 46 member 3 [Source:NCBI gen... [more]
ENSXETT00000010895.13.274e-1523.08pep primary_assembly:Xenopus_tropicalis_v9.1:1:962... [more]
ENSXETT00000010934.19.860e-1521.80thymic stromal cotransporter homolog [Source:NCBI ... [more]
ENSXETT00000010952.11.111e-1421.80thymic stromal cotransporter homolog [Source:NCBI ... [more]
back to top
BLAST of slc46a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc46a34.418e-1623.24solute carrier family 46, member 3 [Source:MGI Sym... [more]
Slc46a34.418e-1623.24solute carrier family 46, member 3 [Source:MGI Sym... [more]
Slc46a13.187e-1523.68solute carrier family 46, member 1 [Source:MGI Sym... [more]
Slc46a22.266e-1422.36solute carrier family 46, member 2 [Source:MGI Sym... [more]
Mfsd14b6.664e-722.82major facilitator superfamily domain containing 14... [more]
back to top
BLAST of slc46a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F4B8|S46A3_CHICK2.083e-3326.91Solute carrier family 46 member 3 OS=Gallus gallus... [more]
sp|Q7ZWG6|PCFT_DANRE1.389e-2223.97Proton-coupled folate transporter OS=Danio rerio O... [more]
sp|Q6DCX5|PCFT_XENLA3.539e-2023.28Proton-coupled folate transporter OS=Xenopus laevi... [more]
sp|A5D7V7|S46A3_BOVIN1.969e-1625.12Solute carrier family 46 member 3 OS=Bos taurus OX... [more]
sp|Q7Z3Q1|S46A3_HUMAN3.902e-1625.54Solute carrier family 46 member 3 OS=Homo sapiens ... [more]
back to top
BLAST of slc46a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFD50.000e+0100.00Slc46a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJM64.404e-12848.99Slc46a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJH77.893e-8239.40Slc46a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
U3IKW01.137e-3227.08Solute carrier family 46 member 3 OS=Anas platyrhy... [more]
R0JZX71.137e-3227.08Solute carrier family 46 member 3 (Fragment) OS=An... [more]
back to top
BLAST of slc46a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-5g14.15.947e-2825.40solute carrier family 46 member 3-like [Source:NCB... [more]
slc46a33.631e-1723.94solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
slc46a33.631e-1723.94solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
zgc:1743562.053e-1124.59proton-coupled folate transporter-like [Source:NCB... [more]
slc46a21.082e-923.88solute carrier family 46 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc46a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc46a31.242e-2424.36solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc46a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc46a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427089.979e-2521.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328924.025e-2224.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389162.027e-2022.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485625.887e-1823.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489131.629e-1424.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc46a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc46a13.332e-2525.83solute carrier family 46 member 1 [Source:NCBI gen... [more]
slc46a16.103e-2525.52solute carrier family 46 member 1 [Source:NCBI gen... [more]
si:dkey-5g14.12.299e-2425.34solute carrier family 46 member 3 [Source:NCBI gen... [more]
si:dkey-5g14.12.299e-2425.34solute carrier family 46 member 3 [Source:NCBI gen... [more]
si:dkey-5g14.11.787e-2125.75solute carrier family 46 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc46a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065064.10.000e+099.59SMESG000065064.1[more]
SMESG000065062.10.000e+098.65SMESG000065062.1[more]
SMESG000065062.10.000e+096.13SMESG000065062.1[more]
SMESG000065078.11.190e-12448.93SMESG000065078.1[more]
SMESG000065066.11.785e-8639.86SMESG000065066.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014908
GenBankAKN21695.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014908 ID=SMED30014908|Name=slc46a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3535bp
TAATAATGTAAATTATATAATAATTTAAATTTTAAATATATGAAAAAATA
AAGCCGTAATATTTTTTATTTATATCGAAGAATTTATTAATATTTTTATA
ATATTAACAATCTTTATGTCAACAGAATATTTAGTAAACGAAGACCAGAA
TAAAAATAGCCAAAAATGTTATGAGTCTACTCCAGTAGAATATAAAACAT
ATAAAACTAATTTTCGTCGGTTTTTTGGAGTTGAACCACTTCTATTATTC
TATGGATTTGCATCATTAATGCAAACCACTGTAATGCAACAGTTCATTTA
TTACCGAGTAGGAATTATTTATAACATAACGGCACCAAACCAAACTTTGG
CATTTGTCTGTAATCGCACAAGTGGCTCATCTGACAAAGACAAAACTGAT
AAATTGCAAGAAATAAATTCTCATTTCCTAATGTTAATATCATTAGGCTC
ATCAATCGCATCGATTTTAACGGCTCCATTCTACTCCGTATTTTCAGACA
GATACGGAAGACGCCTTATGTTTTTGATACCCGGAACTGGGATATTTGTA
AAATCAGTACTGGAATTGCTGGCTATTTATTATTTGTGGCCTATAACGAC
ATTTATCTATATGGAGACATTTTATGGATTAACTGGAGCTTACAATTTCG
TCATTTCTCTTGGATTTAGTTACGTTGCTGATCGCAGCGGCCATGGAACG
CGTACTTGTAGAATAGCTTTTGTTGGAATAATGATCGCCATTGGAGCTTT
TGTGGCCTCTTTATCGTCGGGTTATATGATAACAACCTACCGATATTTCG
TGCCGTTTCTAGCCAGCACGGTTGCAGCATTTTTATGTTTAATTTATCCT
CTCTTTCTCATGATGGATTCCAAACCAATCAGTGATCTATCGAAAGTAAA
CATGAAACCTATAATGGCAGTCTGGAAACAATTGACAAGTTTAGCTACTG
TTCACAAGAAACAATCACGAAATGAGTCTATTCTCAGTATATTAGTTTTG
ATTATCTTTGCATTCTATAATGTGGGTGAAATGTCGGGCGTCGACCTTCA
GACTCCATATTTGATGTCATATCCAATATGCATGACATCGATTCAGATCG
GATTGTACGGAATATTGAATATCGTTGCAATAAATCTGGGAGCCGGACTG
TCAACGGCGATGCTTAATCGATGTTTCAGTGATCTGGTCGTGATAGTTCT
CTGTTTAATTTTTGGGATGGCGTTCAATTTACAAATGGCTTTTGCAACAT
CGCCATTAGCAGCATTCATCGCTACAGGATCCAATCTTCTGTCTTTCAGT
GCTTTTCCATTTTTCAGAGGGTTTCTCTCTAAAAGAACCAAATCTACAGA
GCAAGGTGCATTATTTGGAGGTTTAGTGTTAATAGAAACTGTATGTGGTG
CCATAACAAAGGTACTAATGCTCTATTTTTATCAGAAAACCCTTCAAACA
TTCAATGGATTGGTATTTATTTTTATCGGCTGTTTCTCATTAGTGGCATT
CATTTTGCTCATTTTCACAATACCTTACAGTCATGTCCTTGACAACAGAA
AAAAAGAAAAGGGGTGAAATATAAAAACTGGTCCAAGTCATTTGGCATGC
CTTCGAATCCATCAATTCATTTGTGATTGAAACACATTTTCTCATTTCAA
AAATAATGCTTGAATATTTTTTTATTTGATTAATTAATTGATCATTATTT
TATTATTTTCCTCACGATTTCAATTTTTGTTAGTTTTCATAATACTACCA
AATTTTCGGTGCATCCTTTATCAATTTCAAATAATGAATTATTACAATTA
TATTGATAACATAACAAGTAAGGGATAATTATGCAATATAAATCAACTGA
TGAAGCATTCAGAAAATCTTAATAGAAGCGTCACCGGAAATCTTTAATGC
ATTCAAGGGTAGAAGTAAGTCTTCAGTATTCGATTCTTCTTTCCTTTGAG
ACACAGCCCATTTATTTGTACCGAGGCTGTACAATTGGTGATTCACGGTT
ATTATGATGATTCCTGGGGTAATGGAACAAATGTTTATAACTAGTGTTGA
TGGCAAATGGGTACCCAGATGCAGAAACAGTAGGAAATAAATCATTACTC
CTATGATATACCCCATAACTGACGTAGTTAATAGAAATTTTATCGAGCGT
TTGATTGATAGGTAAAATAAAATGAAGTATGAGACCACAGATCCGGATAT
AATGATGTTGACGTAAGTAACAGTCACCCTTTGATCCCAAAACAAGGTAC
CACAATTTATAAAGAAGATATTGAACATTTGAAACGGAATTTTGAATCTC
ATTGGAAATTCTTCGTCTTGGAATATTGTGTGCATTTCAGAGTTGCCGAG
AGAGACTTTGATCTGATAAAGGACAATTAGTATCAATGGTGAGAGTAGGT
AAATTGTAACAATAATTCCAAAGAAGATCATCACAATTTTGTATTTACGT
TCCGCTGCTAAGAGTATTGCGAATATAATTGACAGTTCCAAACAAATAAA
TATCCCAATAATAATGTTCATAATATTTCCAACCACATTATTTCTGTTGA
AAAACCATAACGAACAAAAGATTGCGCCCAAAAAACATAGAATGAGAAAT
TTCAAATCGTCATTTTTCAATCTAATTTTTCTCAAATCCCATTTGCAATC
TCTGTACCAGGTCACATTTTGCACAAGAAATCGAAGAAAGAATCCTATGG
AATGAGCACCGAAAAGACAAAATAGACCAATATTTATCCATATGAAAGAC
AACCTGTGAAACATCGAAACTCCGTCGATGAGAAGAGCTATGGCGATCGC
ACAAGCGAATGCGACATATTTCTCCATTTTGTGGGTGCCACGAATCATAT
GTATAATATCCTGGTGGAACACAATCGAAATCAACCAGATAAATAACATC
ATCAGCACCATCAGCACCCCTGCCACAAAGCAAGCCAGGATCTGATATAA
GTTATTAGTAAGCATTTGTCCTGAATAGATCCCGATCATGTGCGAGTTAA
TCTCGCTAAGCTTTAGACCATCTAAGAAAACCTTTTTCTCCACTAGCATA
ATCATTGAATCCGTGAAATTTATTAATAGATAATTCAAATCTTTGTCGAA
ATTATTTGACAAGACAACTAAGACTTTAATATTTTTATACTGGCTTAGAA
TGTTGATGTGATAGTGCATATCGCAATGGATATCCGGGCGCGCAATGACT
AAAGCCTCTGGGCCGATTTCCAGACCGTTTTCATTACAGAGATTCTCGTG
AGGAAGGCTTATTAAATTTCCGAAATATTTTGCTTCGGACTTTTTTGTCG
GAATGTTAAAGCTTTTTGACGGAGATCCAATAACGCAAATGTCAAATGTA
GCTTTCACGCGAGATTTATCCACCACCGTGATCATGTAGATATTCCTTTC
TTCGATGTTTTCTGCGGATTGGAAAAGAATCGGAAGGGTCAGGAATATTA
GAAATATCATAATAGATATACTACTTATAATTATAATGATTGAATATTGA
TATATCAATAATTATTAAATATGGCGAATAATAAA
back to top

protein sequence of SMED30014908-orf-1

>SMED30014908-orf-1 ID=SMED30014908-orf-1|Name=SMED30014908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=534bp
MIFLIFLTLPILFQSAENIEERNIYMITVVDKSRVKATFDICVIGSPSKS
FNIPTKKSEAKYFGNLISLPHENLCNENGLEIGPEALVIARPDIHCDMHY
HINILSQYKNIKVLVVLSNNFDKDLNYLLINFTDSMIMLVEKKVFLDGLK
LSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVLMMLFIWLISIVFHQ
DIIHMIRGTHKMEKYVAFACAIAIALLIDGVSMFHRLSFIWINIGLFCLF
GAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCS
LWFFNRNNVVGNIMNIIIGIFICLELSIIFAILLAAERKYKIVMIFFGII
VTIYLLSPLILIVLYQIKVSLGNSEMHTIFQDEEFPMRFKIPFQMFNIFF
INCGTLFWDQRVTVTYVNIIISGSVVSYFILFYLSIKRSIKFLLTTSVMG
YIIGVMIYFLLFLHLGTHLPSTLVINICSITPGIIIITVNHQLYSLGTNK
WAVSQRKEESNTEDLLLPLNALKISGDASIKIF*
back to top

protein sequence of SMED30014908-orf-2

>SMED30014908-orf-2 ID=SMED30014908-orf-2|Name=SMED30014908-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MAPHTVSINTKPPNNAPCSVDLVLLERNPLKNGKALKDRRLDPVAMNAAN
GDVAKAICKLNAIPKIKQRTITTRSLKHRLSIAVDSPAPRFIATIFNIPY
NPI*
back to top

protein sequence of SMED30014908-orf-3

>SMED30014908-orf-3 ID=SMED30014908-orf-3|Name=SMED30014908-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MSTEYLVNEDQNKNSQKCYESTPVEYKTYKTNFRRFFGVEPLLLFYGFAS
LMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRTSGSSDKDKTDKLQEI
NSHFLMLISLGSSIASILTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLE
LLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRI
AFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMM
DSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILSILVLIIFAF
YNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAML
NRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFF
RGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLV
FIFIGCFSLVAFILLIFTIPYSHVLDNRKKEKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 94..470
e-value: 5.8E-22
score: 79.9
NoneNo IPR availablePANTHERPTHR23507:SF1ZGC:174356coord: 30..472
NoneNo IPR availablePANTHERPTHR23507FAMILY NOT NAMEDcoord: 30..472
NoneNo IPR availableCDDcd17448MFS_SLC46A3coord: 39..467
e-value: 1.75639E-43
score: 156.044
NoneNo IPR availableTMHMMTMhelixcoord: 166..188
NoneNo IPR availableTMHMMTMhelixcoord: 323..345
NoneNo IPR availableTMHMMTMhelixcoord: 358..377
NoneNo IPR availableTMHMMTMhelixcoord: 134..156
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 227..249
NoneNo IPR availableTMHMMTMhelixcoord: 382..404
NoneNo IPR availableTMHMMTMhelixcoord: 289..308
NoneNo IPR availableTMHMMTMhelixcoord: 449..471
NoneNo IPR availableTMHMMTMhelixcoord: 417..439
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 105..127
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 79..426
e-value: 2.6E-13
score: 49.6
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 100..472