UPF0489 protein C5orf22 homolog

Overview
NameUPF0489 protein C5orf22 homolog
Smed IDSMED30014907
Length (bp)1856
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UPF0489 protein C5orf22 homolog (SMED30014907) t-SNE clustered cells

Violin plots show distribution of expression levels for UPF0489 protein C5orf22 homolog (SMED30014907) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UPF0489 protein C5orf22 homolog (SMED30014907) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UPF0489 protein C5orf22 homolog (SMED30014907) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014907

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014907SMESG000061073.1 PL08008A2G08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Human
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 111.694 bits (278), Expect = 1.205e-25
Identity = 56/146 (38.36%), Postives = 82/146 (56.16%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            R+   + V++VE H  VL  ++R IGSK +P SN+  LH+D+HPDL I  +     +   + L  E SIENWI PAVYAGH  HVIW  P++  Q+ +     + +G       + V   D YF+++G Y   D +EN+   +L V
Sbjct:   12 RRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVIWFHPTWAQQIREG-RHHFLVGKDTSTTTIRVTSTDHYFLSDGLYVPEDQLENQKPLQLDV 156          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Human
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 97.0561 bits (240), Expect = 4.063e-23
Identity = 48/118 (40.68%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDR-----ISKEYNIGFIEDGK 453
            R+   + V++VE H  VL  ++R IGSK +P SN+  LH+D+HPDL I  +     +   + L  E SIENWI PAVYAGH  HVIW  P++  Q+ +      + K+ +   I  GK
Sbjct:   12 RRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVIWFHPTWAQQIREGRHHFLVGKDTSTTTIRTGK 129          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Human
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 97.0561 bits (240), Expect = 4.063e-23
Identity = 48/118 (40.68%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDR-----ISKEYNIGFIEDGK 453
            R+   + V++VE H  VL  ++R IGSK +P SN+  LH+D+HPDL I  +     +   + L  E SIENWI PAVYAGH  HVIW  P++  Q+ +      + K+ +   I  GK
Sbjct:   12 RRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVIWFHPTWAQQIREGRHHFLVGKDTSTTTIRTGK 129          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Human
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 97.0561 bits (240), Expect = 4.063e-23
Identity = 48/118 (40.68%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDR-----ISKEYNIGFIEDGK 453
            R+   + V++VE H  VL  ++R IGSK +P SN+  LH+D+HPDL I  +     +   + L  E SIENWI PAVYAGH  HVIW  P++  Q+ +      + K+ +   I  GK
Sbjct:   12 RRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVIWFHPTWAQQIREGRHHFLVGKDTSTTTIRTGK 129          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Human
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 82.4185 bits (202), Expect = 6.969e-18
Identity = 46/127 (36.22%), Postives = 64/127 (50.39%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSST-------RKTILDHPQILLN------------------------ESSIENWIFPAVYAGHIDHVIWMRPSFCNQL 402
            R+   + V++VE H  VL  ++R IGSK +P SN+  LH+D+HPDL I  +        ++T+     IL +                        E SIENWI PAVYAGH  HVIW  P++  Q+
Sbjct:   12 RRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFDKETLFGDHWILTSISAFSPLPYAVLVEIYDEDSGFHRELSIENWIMPAVYAGHFSHVIWFHPTWAQQI 138          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Fly
Match: MESR6 (gene:FBgn0036846 transcript:FBtr0075026)

HSP 1 Score: 119.783 bits (299), Expect = 1.764e-28
Identity = 67/193 (34.72%), Postives = 106/193 (54.92%), Query Frame = 1
Query:  130 INVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSN----------FILDIDLDTFAPVNPFHE 678
            I VFIV+ HN+VL  ++R   ++ +P  N  L+H+D+HPDL I      +     + +LNE SIENWI P +YAGH + V+W++ S+C QL      ++ +G  +D  ++ VD    YFI +G+YC ++ +++    +L V             +D + + +N N          F+LDIDLD F+  NPF E
Sbjct:   97 IPVFIVDYHNDVLEFIYRCFATRHLPLQNNTLVHFDSHPDLVIPRHIAASSTYQKETMLNELSIENWIMPTLYAGHFNRVVWLKNSWCQQLPTG-RHDFKVGQKDD--RIGVDCPLDYFIADGNYCTTEDLQDAKSVELQV-------------HDADNESLNPNEFLTEKDAKGFVLDIDLDFFSTSNPFLE 273          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Fly
Match: MESR6 (gene:FBgn0036846 transcript:FBtr0330090)

HSP 1 Score: 109.768 bits (273), Expect = 4.129e-25
Identity = 67/207 (32.37%), Postives = 106/207 (51.21%), Query Frame = 1
Query:  130 INVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYA--------------GHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSN----------FILDIDLDTFAPVNPFHE 678
            I VFIV+ HN+VL  ++R   ++ +P  N  L+H+D+HPDL I      +     + +LNE SIENWI P +YA              GH + V+W++ S+C QL      ++ +G  +D  ++ VD    YFI +G+YC ++ +++    +L V             +D + + +N N          F+LDIDLD F+  NPF E
Sbjct:   97 IPVFIVDYHNDVLEFIYRCFATRHLPLQNNTLVHFDSHPDLVIPRHIAASSTYQKETMLNELSIENWIMPTLYAEIENNVKGQIKKFYGHFNRVVWLKNSWCQQLPTG-RHDFKVGQKDD--RIGVDCPLDYFIADGNYCTTEDLQDAKSVELQV-------------HDADNESLNPNEFLTEKDAKGFVLDIDLDFFSTSNPFLE 287          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Zebrafish
Match: C2H5orf22 (zgc:56556 [Source:NCBI gene;Acc:393302])

HSP 1 Score: 98.5969 bits (244), Expect = 1.801e-21
Identity = 51/143 (35.66%), Postives = 80/143 (55.94%), Query Frame = 1
Query:  130 INVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDIN--DLYFINEGSYCNSDAIENKVKFKLSV 552
            + V+IVE H+ V+  ++R IGS+ IP   IK++H D+HPDL I  +     +   + LL E SIENWI P VYAGH+ HV W+ P +  Q+ +    ++ +   +D     + +   D YF+++  Y   D +EN  +  L V
Sbjct:   13 LPVWIVEDHHEVVQHIYRAIGSRHIPMKGIKMVHLDSHPDLLIPVNMPADTVYDKETLLRELSIENWIMPMVYAGHVSHVAWLHPYWAQQIRE---GQHCMCVGKDSSTTTIRVTSKDDYFLSDALYVPLDHLENPKELHLHV 152          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Xenopus
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 71.633 bits (174), Expect = 1.406e-12
Identity = 47/148 (31.76%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSN-IKLLHYDAHPDLGISSSTR-KTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            RK + + V++VE H++V  +  R I  + +P S   + LH+  HP   I       ++LD  + L +E SIENWI P VYAGH   VIW+ P +  Q+ +     + +G  +    + V   D YF+++G Y   + +E+     L V
Sbjct:   10 RKYNNLPVWVVEDHHDVRRMAVRLITREAVPVSGRAQFLHFHIHPLNSIPLRIPCDSVLDK-EFLKSELSIENWIMPVVYAGHFSQVIWIHPCWAQQIKEG-RHCFLVGKDKSTTTIRVTSTDDYFLSDGLYVPEEQLESPKSLHLDV 155          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Xenopus
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 57.3806 bits (137), Expect = 3.983e-8
Identity = 43/152 (28.29%), Postives = 68/152 (44.74%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVL------NILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            RK + + V++VE H++VL      ++L       KI Y  I + ++D H                      E SIENWI P VYAGH   VIW+ P +  Q+ +     + +G  +    + V   D YF+++G Y   + +E+     L V
Sbjct:   10 RKYNNLPVWVVEDHHDVLHAKDILDVLGVKYLLDKITY--IHITYFDCH----------------------ELSIENWIMPVVYAGHFSQVIWIHPCWAQQIKEG-RHCFLVGKDKSTTTIRVTSTDDYFLSDGLYVPEEQLESPKSLHLDV 136          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Xenopus
Match: C5orf22 (chromosome 5 open reading frame 22 [Source:HGNC Symbol;Acc:HGNC:25639])

HSP 1 Score: 57.3806 bits (137), Expect = 4.733e-8
Identity = 43/152 (28.29%), Postives = 68/152 (44.74%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVL------NILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            RK + + V++VE H++VL      ++L       KI Y  I + ++D H                      E SIENWI P VYAGH   VIW+ P +  Q+ +     + +G  +    + V   D YF+++G Y   + +E+     L V
Sbjct:   10 RKYNNLPVWVVEDHHDVLHAKDILDVLGVKYLLDKITY--IHITYFDCH----------------------ELSIENWIMPVVYAGHFSQVIWIHPCWAQQIKEG-RHCFLVGKDKSTTTIRVTSTDDYFLSDGLYVPEEQLESPKSLHLDV 136          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Mouse
Match: 6030458C11Rik (RIKEN cDNA 6030458C11 gene [Source:MGI Symbol;Acc:MGI:1925127])

HSP 1 Score: 105.916 bits (263), Expect = 7.099e-24
Identity = 59/157 (37.58%), Postives = 87/157 (55.41%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKE-YNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMC 582
            R+   + V++VE H  VL  ++R IGSK +P SNI  LH D+HPDL I  +     +   + L  E SIENWI PAVYAGH   VIW+ P++  Q+  R  K  + +G       + V   D YF+++G +   D +EN+   +L V  +   +T+C
Sbjct:   12 RRYTKLPVWVVEDHQEVLPFIYRAIGSKHLPDSNISFLHLDSHPDLLIPVNMPADTVFDKEALFGELSIENWIMPAVYAGHFSQVIWLHPTWAQQI--REGKHCFLVGKDISTTTIRVTSTDSYFLSDGLFVPEDQLENRRPLQLDVILVE-PYTLC 165          
BLAST of UPF0489 protein C5orf22 homolog vs. UniProt/SwissProt
Match: sp|Q5R5W9|CE022_PONAB (UPF0489 protein C5orf22 homolog OS=Pongo abelii OX=9601 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.423e-25
Identity = 57/146 (39.04%), Postives = 82/146 (56.16%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            R+   + V++VE H  VL  ++R IGSK +P SNI  LH+D+HPDL I  +     +   + L  E SIENWI PAVYAGH  HVIW  P++  Q+ +     + +G       + V   D YF+++G Y   D +EN+   +L V
Sbjct:   12 RRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNISFLHFDSHPDLLIPVNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVIWFHPAWAQQIREG-RHHFLVGKDTSTTTIRVTSTDHYFLSDGLYVPEDQLENQKPLQLDV 156          
BLAST of UPF0489 protein C5orf22 homolog vs. UniProt/SwissProt
Match: sp|Q49AR2|CE022_HUMAN (UPF0489 protein C5orf22 OS=Homo sapiens OX=9606 GN=C5orf22 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 5.785e-25
Identity = 56/146 (38.36%), Postives = 82/146 (56.16%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            R+   + V++VE H  VL  ++R IGSK +P SN+  LH+D+HPDL I  +     +   + L  E SIENWI PAVYAGH  HVIW  P++  Q+ +     + +G       + V   D YF+++G Y   D +EN+   +L V
Sbjct:   12 RRYPKLPVWVVEDHQEVLPFIYRAIGSKHLPASNVSFLHFDSHPDLLIPVNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVIWFHPTWAQQIREG-RHHFLVGKDTSTTTIRVTSTDHYFLSDGLYVPEDQLENQKPLQLDV 156          
BLAST of UPF0489 protein C5orf22 homolog vs. UniProt/SwissProt
Match: sp|Q8BGC1|CE022_MOUSE (UPF0489 protein C5orf22 homolog OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 4.965e-23
Identity = 59/157 (37.58%), Postives = 87/157 (55.41%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKE-YNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMC 582
            R+   + V++VE H  VL  ++R IGSK +P SNI  LH D+HPDL I  +     +   + L  E SIENWI PAVYAGH   VIW+ P++  Q+  R  K  + +G       + V   D YF+++G +   D +EN+   +L V  +   +T+C
Sbjct:   12 RRYTKLPVWVVEDHQEVLPFIYRAIGSKHLPDSNISFLHLDSHPDLLIPVNMPADTVFDKEALFGELSIENWIMPAVYAGHFSQVIWLHPTWAQQI--REGKHCFLVGKDISTTTIRVTSTDSYFLSDGLFVPEDQLENRRPLQLDVILVE-PYTLC 165          
BLAST of UPF0489 protein C5orf22 homolog vs. UniProt/SwissProt
Match: sp|Q28H30|CE022_XENTR (UPF0489 protein C5orf22 homolog OS=Xenopus tropicalis OX=8364 GN=TEgg058p12.1 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.235e-21
Identity = 53/146 (36.30%), Postives = 83/146 (56.85%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            RK + + V++VE H++VL  ++R IGSK +P SNI  +H+D+HPDL I  +     +   + L +E SIENWI P VYAGH   VIW+ P +  Q+ +     + +G  +    + V   D YF+++G Y   + +E+     L V
Sbjct:   10 RKYNNLPVWVVEDHHDVLPFIYRAIGSKHLPVSNISFIHFDSHPDLLIPVNMPADTVFDKESLFSELSIENWIMPVVYAGHFSQVIWIHPCWAQQIKEG-RHCFLVGKDKSTTTIRVTSTDDYFLSDGLYVPEEQLESPKSLHLDV 154          
BLAST of UPF0489 protein C5orf22 homolog vs. UniProt/SwissProt
Match: sp|Q6PAE6|CE022_XENLA (UPF0489 protein C5orf22 homolog OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.675e-21
Identity = 54/147 (36.73%), Postives = 82/147 (55.78%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYN-IGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            RK   + V++VE H++VL  ++R IGSK +P SNI  +H D+HPDL I  +     +   + L +E SIENWI P VYAGH   V+W+ P +  Q+ +   K Y  +G  +    + V   D YF+++G Y   + +E+     L V
Sbjct:   10 RKYSSLPVWVVEDHHDVLPFIYRAIGSKHLPVSNISFIHLDSHPDLLIPVNMPADTVFDKESLFSELSIENWIMPVVYAGHFSQVVWIHPCWAQQIKE--GKHYFLVGKDKSTTTIRVTSTDDYFLSDGLYVPEEQLESPKSLHLDV 154          
BLAST of UPF0489 protein C5orf22 homolog vs. TrEMBL
Match: A0A4Z2DY24 (UPF0489 protein C5orf22 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010477 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.873e-58
Identity = 121/310 (39.03%), Postives = 173/310 (55.81%), Query Frame = 1
Query:  127 PINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLITNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSIGHEIADS--MSSDRQNQLGRLKQFLTQIQFGIIPIN-------YEALKLFTLLSSIIGSLFCNWLL 1029
            PI+V +VE+HN  LN ++R IGSK +P+S +KLLH+D+HPD+GI       IL  P+ L+ + SIENWI P +YAGH+DHVIWM P +  QL +R    Y+IG     K++VV I + YF N+G +C  + I + VKF L+V PIH T+T+CR C DI   L+N +FILDIDLDTF+  NPF   FT  Q  +I  +Y                  P P  L     P    D      P   + H ++ +  +++ R+ QL RL Q+++    G IP +       YE ++   L+ S+    F + +L
Sbjct:    4 PISVIVVERHNEALNYIYRAIGSKTVPFSGLKLLHFDSHPDMGIPDVDCSEILRDPEQLMRKLSIENWITPMIYAGHVDHVIWMHPKWSRQLLNRKPTCYSIGEDLCTKRLVVGIPEPYFYNDGVFCMEEDISSPVKFGLTVAPIHETNTLCRVCTDIICVLLNQSFILDIDLDTFSTQNPFSNMFTEEQFEIIDRLYA----------------PPPPLTL--CLSPKDLED------PAVIVAHGMSSAHVLNAARKRQLARLSQWISCWDRGTIPSSENFILFPYELVEFSRLILSLTEQKFSSMIL 289          
BLAST of UPF0489 protein C5orf22 homolog vs. TrEMBL
Match: A0A183S076 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 2.437e-58
Identity = 98/190 (51.58%), Postives = 130/190 (68.42%), Query Frame = 1
Query:  127 PINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQ 696
            PI+V +VE+HN VLN ++R IGSK I +S +KLLH+D+HPD+GI       IL  P+ L+ + SIENWI P +YAGH+DHVIWM P++  QL +R    Y+IG     K++VV I + YF N+G +C  + I + VKF L+V PIH T+T+CR C DI   L+N +FILDIDLDTF+  NP   KFT  Q
Sbjct:    4 PISVVVVERHNEVLNYIYRAIGSKTISFSGLKLLHFDSHPDMGIPDVDCSEILRDPEQLMKKLSIENWITPMIYAGHVDHVIWMHPTWSRQLLNRKPTCYSIGEDLCTKRLVVGIPESYFYNDGVFCMEEDISSPVKFGLTVAPIHETNTLCRVCTDIICVLLNQSFILDIDLDTFSTQNPLSNKFTEEQ 193          
BLAST of UPF0489 protein C5orf22 homolog vs. TrEMBL
Match: A0A4Z2DXU7 (UPF0489 protein C5orf22 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010477 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.703e-57
Identity = 121/310 (39.03%), Postives = 173/310 (55.81%), Query Frame = 1
Query:  127 PINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLITNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSIGHEIADS--MSSDRQNQLGRLKQFLTQIQFGIIPIN-------YEALKLFTLLSSIIGSLFCNWLL 1029
            PI+V +VE+HN  LN ++R IGSK +P+S +KLLH+D+HPD+GI       IL  P+ L+ + SIENWI P +YAGH+DHVIWM P +  QL +R    Y+IG     K++VV I + YF N+G +C  + I + VKF L+V PIH T+T+CR C DI   L+N +FILDIDLDTF+  NPF   FT  Q  +I  +Y                  P P  L     P    D      P   + H ++ +  +++ R+ QL RL Q+++    G IP +       YE ++   L+ S+    F + +L
Sbjct:    4 PISVIVVERHNEALNYIYRAIGSKTVPFSGLKLLHFDSHPDMGIPDVDCSEILRDPEQLMRKLSIENWITPMIYAGHVDHVIWMHPKWSRQLLNRKPTCYSIGEDLCTKRLVVGIPEPYFYNDGVFCMEEDISSPVKFGLTVAPIHETNTLCRVCTDIICVLLNQSFILDIDLDTFSTQNPFSNMFTEEQFEIIDRLYA----------------PPPPLTL--CLSPKDLED------PAVIVAHGMSSAHVLNAARKRQLARLSQWISCWDRGTIPSSENFILFPYELVEFSRLILSLTEQKFSSMIL 289          

HSP 2 Score: 70.0922 bits (170), Expect = 9.766e-9
Identity = 41/98 (41.84%), Postives = 60/98 (61.22%), Query Frame = 1
Query: 1378 QYEDDIMYWHYLFSSCGFEWNDEHDSLPHRPMPDNASFQDSL-DDLTSLLNRLHSPIMITIARSAEDGYIRQDIVDKIQAGVIQCLEKVYANRNLNIT 1668
            Q E+++ + HYL+S C    + + + LPH     N+  Q+ L + +  LLNRLH+P MITIARS  DGY   + V  IQ G++Q L++VY    L+IT
Sbjct:  475 QNEENLNFMHYLWSGCA---DQKCNGLPHSIT--NSKEQNELCEQMEGLLNRLHNPCMITIARSVYDGYTPLNQVSDIQLGLLQMLDRVYGRNLLSIT 567          
BLAST of UPF0489 protein C5orf22 homolog vs. TrEMBL
Match: A0A4E0RAS9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_005608 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.279e-57
Identity = 116/287 (40.42%), Postives = 167/287 (58.19%), Query Frame = 1
Query:  127 PINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLITNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSIGHEIADS--MSSDRQNQLGRLKQFLTQIQFGIIPINYEALKLF 981
            PI+V IVE HN  L+ ++R IGSK+IP+S +KLLH D+HPDLGI       +   P+ LL + SIENWI P VYAGHIDHVIW+ P +  QL DR    Y +G  ++ K + +D+ + Y  ++G +C+ + + + VKF L+V PIH T+T+C+ C DI   L+N  FILDIDLDTF+  NPF E+FT  Q  LI  +Y                  P P  +     P    + Q   +P   + H +A +  +++ R+ QLGRL  +L  ++ G +P   EAL ++
Sbjct:   24 PISVVIVEAHNEALSYIYRLIGSKRIPFSGLKLLHLDSHPDLGIPEIKASEVRQDPEKLLCKVSIENWIMPMVYAGHIDHVIWLHPPWSEQLVDRKPTCYTVGESKETKLLGMDLPEPYVYDDGVFCSEEDMTSAVKFGLTVAPIHETNTLCKVCTDIVCVLLNQPFILDIDLDTFSTQNPFSERFTKEQTELINRLYA----------------PPPPLDI-----PMSISEQQ---NPTVVLAHGLACARVLNAARRRQLGRLFHWLQALELGNLP-PAEALTIW 285          

HSP 2 Score: 68.5514 bits (166), Expect = 2.660e-8
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 1
Query: 1384 EDDIMYWHYLFSSCGFEWNDEHDSLPHRPMPDNASFQDSLDDLTSLLNRLHSPIMITIARSAEDGYIRQDIVDKIQAGVIQCLEKVYANRNLNIT 1668
            E+   +WHYL+S  G    D+ + LPH+ +      +D  +++  +LNRLH+P +ITIARS +DGY     V  +Q G++Q L++VY    L++T
Sbjct:  497 EESFSFWHYLWS--GLAGADQ-NPLPHK-VTTTKEQRDMREEIEGILNRLHNPCLITIARSTQDGYTPSHQVLDLQLGLLQTLDRVYGQELLSVT 587          
BLAST of UPF0489 protein C5orf22 homolog vs. TrEMBL
Match: A0A504YSZ6 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_11201 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 2.521e-57
Identity = 116/287 (40.42%), Postives = 166/287 (57.84%), Query Frame = 1
Query:  127 PINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLITNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSIGHEIADS--MSSDRQNQLGRLKQFLTQIQFGIIPINYEALKLF 981
            PI+V IVE HN  L+ ++R IGSK+IP+S +KLLH D+HPDLGI       I   P+ LL + SIENWI P VYAGHIDHVIW+ P +  QL DR    Y +G  ++ K + +D+ + Y  ++G +C+ + + + VKF L+V PIH T+T+C+ C DI   L+N  FILDIDLDTF+  NPF  +FT  Q  LI  +Y                  P P  +     P    + Q   +P   + H +A +  +++ R+ QLGRL  +L  ++ G +P   EAL ++
Sbjct:    4 PISVVIVEAHNEALSYIYRLIGSKRIPFSGLKLLHLDSHPDLGIPEIKASEIRQDPEKLLCKVSIENWIMPMVYAGHIDHVIWLHPPWSEQLVDRKPTCYTVGESKETKLLGMDLPEPYVYDDGVFCSEEDMTSAVKFGLTVAPIHETNTLCKVCTDIVCVLLNQPFILDIDLDTFSTQNPFSGRFTKEQTELINRLYA----------------PPPPLDI-----PMSISEQQ---NPTVVLAHGLACARVLNAARRRQLGRLFHWLQALELGNLP-PAEALTIW 265          

HSP 2 Score: 68.9366 bits (167), Expect = 2.195e-8
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 1
Query: 1384 EDDIMYWHYLFSSCGFEWNDEHDSLPHRPMPDNASFQDSLDDLTSLLNRLHSPIMITIARSAEDGYIRQDIVDKIQAGVIQCLEKVYANRNLNIT 1668
            E+   +WHYL+S  G    D+ + LPH+ +      +D  +++  +LNRLH+P +ITIARS +DGY     V  +Q G++Q L++VY    L++T
Sbjct:  477 EESFSFWHYLWS--GLAGADQ-NPLPHK-VTTTKEQRDMREEIEGILNRLHNPCLITIARSTQDGYTPSHQVLDLQLGLLQTLDRVYGQELLSVT 567          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Cavefish
Match: zgc:56556 (chromosome 17 C5orf22 homolog [Source:NCBI gene;Acc:103029945])

HSP 1 Score: 100.908 bits (250), Expect = 2.334e-22
Identity = 57/161 (35.40%), Postives = 90/161 (55.90%), Query Frame = 1
Query:  130 INVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSS-TRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDR-----ISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKL------SVGPIHYTHT 576
            + V+IVE H+ V+  ++R I S+ +P S +K++H D+HPDL IS + + KT+ D  + L +E SIENWI P V+AGH+ HV W+ P +  Q+ +      + K+ + G I       V   D YF+++  Y  +D +E+     L       VG  H +HT
Sbjct:   13 LPVWIVEDHHEVVPHIYRAIASRHLPLSGVKMVHLDSHPDLLISVNMSAKTVFDK-EALFSELSIENWIMPMVFAGHVSHVAWLHPYWAQQIKEGEHYMCVGKDKSTGTIR------VTSTDDYFLSDALYVPTDQLEDSKPLHLRVVNVDPVGTSHSSHT 166          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Nematostella
Match: EDO35441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH9])

HSP 1 Score: 104.375 bits (259), Expect = 5.555e-24
Identity = 51/146 (34.93%), Postives = 84/146 (57.53%), Query Frame = 1
Query:  115 RKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSV 552
            RK   + V I E H+ VL  ++R I  + +PYS   L+H+D+HPD+ I      +++ +P  L+   SI +WI PAVYAGHID V+W++PS+C+Q+  R    + +G   +   + V   + YF+ E  Y   + +EN  + +L +
Sbjct:    3 RKYSRLPVKICENHDEVLFHIYRAIAGRYLPYSGTTLIHFDSHPDMTIPPRLSASLVFNPSELMEALSIADWILPAVYAGHIDRVVWIKPSWCDQMT-RERMTFCVGKHRESGFLRVTSTEDYFLEELLYAPMEELENVKQVELVI 147          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Medaka
Match: zgc:56556 (chromosome 17 C5orf22 homolog [Source:NCBI gene;Acc:101160589])

HSP 1 Score: 103.219 bits (256), Expect = 4.731e-23
Identity = 54/151 (35.76%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  130 INVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMC 582
            + V+IVE H++V+  ++R I S+ +P SNIK++H D+HPDL I  +     +   + L +E SIENWI P VYAGH+  V W+ P +  Q+ D   K   +G       + V   D YF+++G +   + +EN   F LSV  ++     C
Sbjct:   13 LPVWIVEDHHHVVQHIYRAIASRHLPPSNIKMIHLDSHPDLLIPVNMSADTVFEKEKLFSELSIENWIMPMVYAGHVSSVAWLHPYWAQQIRDGEQK-MCVGRDSSTTTIRVSSTDNYFLSDGLFVCEEQLENSKPFTLSVIRVNSVKPSC 162          
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Medaka
Match: zgc:56556 (chromosome 17 C5orf22 homolog [Source:NCBI gene;Acc:101160589])

HSP 1 Score: 97.8265 bits (242), Expect = 3.902e-21
Identity = 58/179 (32.40%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  130 INVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQ--------------------LGDRISKEYNIGFIEDGKKMV--------VDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMC 582
            + V+IVE H++V+  ++R I S+ +P SNIK++H D+HPDL I  +     +   + L +E SIENWI P VYAGH+  V W+ P +  Q                    LG R   E +  F   G  +V        V   D YF+++G +   + +EN   F LSV  ++     C
Sbjct:   13 LPVWIVEDHHHVVQHIYRAIASRHLPPSNIKMIHLDSHPDLLIPVNMSADTVFEKEKLFSELSIENWIMPMVYAGHVSSVAWLHPYWAQQIRDGEQKMCVGRDSSTTTIRLGQRSKVEVSCFFCNSGFSLVHAALLLCRVSSTDNYFLSDGLFVCEEQLENSKPFTLSVIRVNSVKPSC 191          
BLAST of UPF0489 protein C5orf22 homolog vs. Planmine SMEST
Match: SMESG000061073.1 (SMESG000061073.1)

HSP 1 Score: 1123.61 bits (2905), Expect = 0.000e+0
Identity = 546/562 (97.15%), Postives = 546/562 (97.15%), Query Frame = 1
Query:  109 MNRKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLITNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSIGHEIADSMSSDRQNQLGRLKQFLTQIQFGIIPINYEALKLFTLLSSIIGSLFCNWLLLIWIARLGMDNFINSLKRFEENVQSKSMEKNISDEENKMLLKRSKASILPDSFLRQIENIVKNERNKYIYFVLHELEAVFTQLKLQSEDCFYVNWITVGNVWNSTHRSDTVKINDDQYEDDIMYWHYLFSSCGFEWNDEHDSLPHRPMPDNASFQDSLDDLTSLLNRLHSPIMITIARSAEDGYIRQDIVDKIQAGVIQCLEKVYANRNLNITKYKAEDSYFMWPSSKKHGYQTKFVTELAPVTFRTPASADSLE 1794
            MNRKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLITNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSIGHEIADSMSSDRQNQLGRLKQFLTQIQFGIIPINYEALKLFTLLSSII                GMDNFINSLKRFEENVQSKSMEKNISDEENKMLLKRSKASILPDSFLRQIENIVKNERNKYIYFVLHELEAVFTQLKLQSEDCFYVNWITVGNVWNSTHRSDTVKINDDQYEDDIMYWHYLFSSCGFEWNDEHDSLPHRPMPDNASFQDSLDDLTSLLNRLHSPIMITIARSAEDGYIRQDIVDKIQAGVIQCLEKVYANRNLNITKYKAEDSYFMWPSSKKHGYQTKFVTELAPVTFRTPASADSLE
Sbjct:    1 MNRKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGISSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGDRISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGPIHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLITNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSIGHEIADSMSSDRQNQLGRLKQFLTQIQFGIIPINYEALKLFTLLSSII----------------GMDNFINSLKRFEENVQSKSMEKNISDEENKMLLKRSKASILPDSFLRQIENIVKNERNKYIYFVLHELEAVFTQLKLQSEDCFYVNWITVGNVWNSTHRSDTVKINDDQYEDDIMYWHYLFSSCGFEWNDEHDSLPHRPMPDNASFQDSLDDLTSLLNRLHSPIMITIARSAEDGYIRQDIVDKIQAGVIQCLEKVYANRNLNITKYKAEDSYFMWPSSKKHGYQTKFVTELAPVTFRTPASADSLE 546          
The following BLAST results are available for this feature:
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C5orf221.205e-2538.36chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
C5orf224.063e-2340.68chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
C5orf224.063e-2340.68chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
C5orf224.063e-2340.68chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
C5orf226.969e-1836.22chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MESR61.764e-2834.72gene:FBgn0036846 transcript:FBtr0075026[more]
MESR64.129e-2532.37gene:FBgn0036846 transcript:FBtr0330090[more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C2H5orf221.801e-2135.66zgc:56556 [Source:NCBI gene;Acc:393302][more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C5orf221.406e-1231.76chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
C5orf223.983e-828.29chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
C5orf224.733e-828.29chromosome 5 open reading frame 22 [Source:HGNC Sy... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
6030458C11Rik7.099e-2437.58RIKEN cDNA 6030458C11 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R5W9|CE022_PONAB4.423e-2539.04UPF0489 protein C5orf22 homolog OS=Pongo abelii OX... [more]
sp|Q49AR2|CE022_HUMAN5.785e-2538.36UPF0489 protein C5orf22 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8BGC1|CE022_MOUSE4.965e-2337.58UPF0489 protein C5orf22 homolog OS=Mus musculus OX... [more]
sp|Q28H30|CE022_XENTR1.235e-2136.30UPF0489 protein C5orf22 homolog OS=Xenopus tropica... [more]
sp|Q6PAE6|CE022_XENLA1.675e-2136.73UPF0489 protein C5orf22 homolog OS=Xenopus laevis ... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DY241.873e-5839.03UPF0489 protein C5orf22 isoform 1 OS=Schistosoma j... [more]
A0A183S0762.437e-5851.58Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A4Z2DXU71.703e-5739.03UPF0489 protein C5orf22 isoform 2 OS=Schistosoma j... [more]
A0A4E0RAS92.279e-5740.42Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A504YSZ62.521e-5740.42Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:565562.334e-2235.40chromosome 17 C5orf22 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO354415.555e-2434.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:565564.731e-2335.76chromosome 17 C5orf22 homolog [Source:NCBI gene;Ac... [more]
zgc:565563.902e-2132.40chromosome 17 C5orf22 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of UPF0489 protein C5orf22 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061073.10.000e+097.15SMESG000061073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014907 ID=SMED30014907|Name=UPF0489 protein C5orf22 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1856bp
TGTTTCTTAATTATAAATAATTATTAATTTTATTTTATTAGTAAATATAC
TAGTGATACTTATTCCTAATTGGATTTTTTATCTATATCTTATTAGAAAT
TATTATATATGAATCGAAAACCAGATCCTATTAATGTTTTTATTGTAGAG
CAGCATAACAATGTACTTAATATTTTACACAGAGGAATAGGTAGTAAAAA
AATCCCATATTCAAATATAAAATTGTTGCATTATGATGCACATCCAGATT
TAGGAATATCATCTTCTACCAGAAAAACAATTTTAGATCATCCTCAAATT
TTGTTGAATGAATCTAGTATAGAAAATTGGATATTTCCTGCAGTTTACGC
AGGGCACATAGATCATGTGATATGGATGCGTCCTTCATTTTGTAATCAAT
TAGGTGATAGAATATCGAAAGAATATAATATTGGATTTATCGAAGATGGT
AAAAAGATGGTAGTTGATATAAATGATCTTTATTTTATAAACGAAGGAAG
TTATTGTAACAGTGATGCAATTGAAAACAAGGTGAAATTTAAGTTATCTG
TCGGCCCAATTCACTATACGCATACAATGTGCCGATTTTGCTATGATATT
AATATTCAATTAATGAACTCCAATTTTATTCTCGATATCGACCTAGACAC
TTTTGCTCCCGTTAATCCCTTTCATGAAAAATTTACTGCAATGCAAGAAT
CGCTAATCACAAATATATATGGAGTTGTAAAGAACGAAATCGCATCCAAA
GCACTGGAGGAATTAAAGAATCAGCCATACCCTTTCCGACTCAAACATGT
CCGTTACCCAGCCAAAAAATGCGACGGCCAAATACCCAGTTCTCCCAAAG
GTAGTATTGGACATGAAATCGCTGACTCGATGTCGAGTGACCGCCAGAAT
CAATTGGGCCGACTAAAACAGTTCCTTACACAGATTCAGTTCGGAATTAT
TCCAATCAATTATGAGGCTCTCAAATTGTTCACTTTACTATCGTCAATCA
TAGGTTCACTCTTTTGTAATTGGCTGTTATTAATCTGGATTGCGCGATTA
GGGATGGACAATTTCATCAATTCGTTGAAAAGGTTCGAGGAGAATGTACA
AAGCAAATCAATGGAAAAAAACATTAGTGATGAGGAAAATAAAATGTTGT
TGAAGCGCTCGAAGGCTTCAATCCTACCGGATTCATTTTTGCGGCAAATT
GAAAATATCGTCAAAAACGAGCGCAATAAATATATATATTTTGTTCTTCA
CGAGTTAGAGGCAGTTTTCACTCAACTCAAATTACAATCAGAAGATTGTT
TTTATGTAAACTGGATCACAGTGGGAAATGTGTGGAATTCTACCCATCGA
TCGGACACAGTGAAAATCAATGATGACCAATATGAAGATGACATAATGTA
TTGGCATTATTTGTTTTCTTCTTGTGGGTTCGAGTGGAATGATGAGCATG
ATAGCTTACCCCACAGACCGATGCCTGATAATGCTTCGTTTCAAGACTCA
TTGGACGACCTGACGTCACTATTGAATCGATTGCACAGTCCCATTATGAT
TACAATCGCCAGATCGGCCGAAGATGGCTATATTCGGCAGGATATCGTCG
ATAAAATCCAAGCTGGTGTCATTCAATGCCTGGAAAAGGTTTACGCCAAC
AGAAATCTGAATATCACCAAATACAAAGCGGAAGACTCATATTTCATGTG
GCCTAGCTCAAAGAAGCACGGATACCAGACTAAATTCGTCACGGAATTGG
CGCCTGTGACCTTTCGCACTCCAGCTTCTGCAGATAGCCTTGAAAATAAA
GATATTCTTTAAATTTTGAAATTGTGATTAAATAAATTTTTTATATATTG
AAAAAA
back to top

protein sequence of SMED30014907-orf-1

>SMED30014907-orf-1 ID=SMED30014907-orf-1|Name=SMED30014907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=568bp
MNRKPDPINVFIVEQHNNVLNILHRGIGSKKIPYSNIKLLHYDAHPDLGI
SSSTRKTILDHPQILLNESSIENWIFPAVYAGHIDHVIWMRPSFCNQLGD
RISKEYNIGFIEDGKKMVVDINDLYFINEGSYCNSDAIENKVKFKLSVGP
IHYTHTMCRFCYDINIQLMNSNFILDIDLDTFAPVNPFHEKFTAMQESLI
TNIYGVVKNEIASKALEELKNQPYPFRLKHVRYPAKKCDGQIPSSPKGSI
GHEIADSMSSDRQNQLGRLKQFLTQIQFGIIPINYEALKLFTLLSSIIGS
LFCNWLLLIWIARLGMDNFINSLKRFEENVQSKSMEKNISDEENKMLLKR
SKASILPDSFLRQIENIVKNERNKYIYFVLHELEAVFTQLKLQSEDCFYV
NWITVGNVWNSTHRSDTVKINDDQYEDDIMYWHYLFSSCGFEWNDEHDSL
PHRPMPDNASFQDSLDDLTSLLNRLHSPIMITIARSAEDGYIRQDIVDKI
QAGVIQCLEKVYANRNLNITKYKAEDSYFMWPSSKKHGYQTKFVTELAPV
TFRTPASADSLENKDIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR024131UPF0489
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024131Uncharacterised protein family UPF0489PFAMPF12640UPF0489coord: 10..182
e-value: 8.9E-34
score: 117.3
IPR024131Uncharacterised protein family UPF0489PANTHERPTHR13225MISEXPRESSION SUPPRESSOR OF RAS 6coord: 3..212
coord: 379..525
NoneNo IPR availableTMHMMTMhelixcoord: 290..312