Small nuclear ribonucleoprotein E

Overview
NameSmall nuclear ribonucleoprotein E
Smed IDSMED30014896
Length (bp)362
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small nuclear ribonucleoprotein E (SMED30014896) t-SNE clustered cells

Violin plots show distribution of expression levels for Small nuclear ribonucleoprotein E (SMED30014896) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small nuclear ribonucleoprotein E (SMED30014896) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small nuclear ribonucleoprotein E (SMED30014896) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014896

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014896SMESG000036643.1 dd_Smed_v4_741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014896SMESG000036643.1 dd_Smed_v4_741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014896SMESG000036643.1 dd_Smed_v4_741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014896SMESG000036643.1 dd_Smed_v4_741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014896SMESG000036643.1 dd_Smed_v4_741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Human
Match: SNRPE (small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:HGNC:11161])

HSP 1 Score: 127.102 bits (318), Expect = 6.688e-39
Identity = 58/89 (65.17%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Human
Match: SNRPE (small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:HGNC:11161])

HSP 1 Score: 75.485 bits (184), Expect = 6.430e-19
Identity = 36/49 (73.47%), Postives = 42/49 (85.71%), Query Frame = 3
Query:  150 MRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 49          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 42.3578 bits (98), Expect = 6.589e-6
Identity = 17/50 (34.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query:  153 RIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
             ++GI+ GFD +MN+V+D+ VE    SG +  IG ++++G++I ++++ +
Sbjct:   18 HVQGILRGFDPFMNLVIDECVEMA-TSGQQNNIGMVVIRGNSIIMLEALE 66          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 42.3578 bits (98), Expect = 8.440e-6
Identity = 17/50 (34.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query:  153 RIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
             ++GI+ GFD +MN+V+D+ VE    SG +  IG ++++G++I ++++ +
Sbjct:   26 HVQGILRGFDPFMNLVIDECVEM-ATSGQQNNIGMVVIRGNSIIMLEALE 74          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 41.9726 bits (97), Expect = 8.579e-6
Identity = 17/49 (34.69%), Postives = 36/49 (73.47%), Query Frame = 3
Query:  156 IEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
            ++GI+ GFD +MN+V+D+ VE    SG +  IG ++++G++I ++++ +
Sbjct:   15 VQGILRGFDPFMNLVIDECVEMA-TSGQQNNIGMVVIRGNSIIMLEALE 62          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Celegans
Match: snr-6 (Probable small nuclear ribonucleoprotein E [Source:UniProtKB/Swiss-Prot;Acc:Q9XTU6])

HSP 1 Score: 111.309 bits (277), Expect = 5.069e-33
Identity = 49/85 (57.65%), Postives = 63/85 (74.12%), Query Frame = 3
Query:   45 GSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSC 299
             +R  NK M+QP+N+IFR+ Q +TRVQ WLYE    R+EG I+GFDE+MNVV D+A E +MK+    KIGRI+LKGD ITLI + 
Sbjct:    2 STRKLNKVMVQPVNLIFRYLQNRTRVQIWLYEDVTHRLEGYIIGFDEFMNVVFDEAEEVNMKTKGRNKIGRILLKGDNITLIHAA 86          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Celegans
Match: snr-7 (Probable small nuclear ribonucleoprotein G [Source:UniProtKB/Swiss-Prot;Acc:Q9N4G9])

HSP 1 Score: 43.1282 bits (100), Expect = 1.361e-6
Identity = 18/50 (36.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query:  147 NMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            N R+ GI+ GFD +MN+V+D+AVE + K G    +G  +++G+++ +++ 
Sbjct:   24 NRRVSGILRGFDPFMNMVIDEAVE-YQKDGGSVNLGMTVIRGNSVVIMEP 72          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Celegans
Match: lsm-5 (U6 snRNA-associated Sm-like protein LSm5 [Source:UniProtKB/TrEMBL;Acc:O18694])

HSP 1 Score: 43.1282 bits (100), Expect = 1.945e-6
Identity = 24/83 (28.92%), Postives = 46/83 (55.42%), Query Frame = 3
Query:   48 SRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEK--KIGRIMLKGDAITLI 290
            S + N   + P+ +I +   +K     W+  + +  I G + GFD+Y+N+VL+D VE    +  ++  K+  I+L G+ IT++
Sbjct:    4 STSTNPNTLLPLELIDKCIGSK----IWVIMKNDKEIVGTLTGFDDYVNMVLEDVVEYENTADGKRMTKLDTILLNGNHITML 82          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Celegans
Match: lsm-5 (U6 snRNA-associated Sm-like protein LSm5 [Source:UniProtKB/TrEMBL;Acc:O18694])

HSP 1 Score: 43.1282 bits (100), Expect = 1.945e-6
Identity = 24/83 (28.92%), Postives = 46/83 (55.42%), Query Frame = 3
Query:   48 SRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEK--KIGRIMLKGDAITLI 290
            S + N   + P+ +I +   +K     W+  + +  I G + GFD+Y+N+VL+D VE    +  ++  K+  I+L G+ IT++
Sbjct:    4 STSTNPNTLLPLELIDKCIGSK----IWVIMKNDKEIVGTLTGFDDYVNMVLEDVVEYENTADGKRMTKLDTILLNGNHITML 82          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Fly
Match: SmE (gene:FBgn0261790 transcript:FBtr0079560)

HSP 1 Score: 114.39 bits (285), Expect = 3.764e-34
Identity = 51/89 (57.30%), Postives = 68/89 (76.40%), Query Frame = 3
Query:   42 QGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCDCT 308
            +G+    K M+QPIN+IFR+ Q ++RVQ WLYE  ++RIEG I+GFDEYMN+VLDDA E ++K+   + +GRIMLKGD ITLIQ+   T
Sbjct:    4 KGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITLIQNVSPT 92          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Fly
Match: SNRPG (gene:FBgn0261791 transcript:FBtr0112993)

HSP 1 Score: 46.595 bits (109), Expect = 9.895e-8
Identity = 20/49 (40.82%), Postives = 35/49 (71.43%), Query Frame = 3
Query:  156 IEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
            + GI+ GFD +MNVVLDD VE   K  ++  IG ++++G++I ++++ D
Sbjct:   27 VTGILRGFDPFMNVVLDDTVE-ECKDNTKNNIGMVVIRGNSIVMVEALD 74          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Fly
Match: SNRPG (gene:FBgn0261791 transcript:FBtr0074377)

HSP 1 Score: 46.595 bits (109), Expect = 9.895e-8
Identity = 20/49 (40.82%), Postives = 35/49 (71.43%), Query Frame = 3
Query:  156 IEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
            + GI+ GFD +MNVVLDD VE   K  ++  IG ++++G++I ++++ D
Sbjct:   27 VTGILRGFDPFMNVVLDDTVE-ECKDNTKNNIGMVVIRGNSIVMVEALD 74          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Zebrafish
Match: snrpe (small nuclear ribonucleoprotein polypeptide E [Source:NCBI gene;Acc:393979])

HSP 1 Score: 125.946 bits (315), Expect = 1.115e-38
Identity = 57/89 (64.04%), Postives = 70/89 (78.65%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+  WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMK+ + K +GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRISVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Zebrafish
Match: snrpe (small nuclear ribonucleoprotein polypeptide E [Source:NCBI gene;Acc:393979])

HSP 1 Score: 83.9593 bits (206), Expect = 2.910e-22
Identity = 44/90 (48.89%), Postives = 53/90 (58.89%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSC 299
            MAYR   +   K M+QPIN+IFR+ Q                      GFDEYMN+VLDDA E HMK+ + K +GRIMLKGD ITL+QS 
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQN---------------------GFDEYMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 69          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Zebrafish
Match: snrpe (small nuclear ribonucleoprotein polypeptide E [Source:NCBI gene;Acc:393979])

HSP 1 Score: 76.6406 bits (187), Expect = 1.302e-19
Identity = 36/49 (73.47%), Postives = 42/49 (85.71%), Query Frame = 3
Query:  150 MRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MRIEG I+GFDEYMN+VLDDA E HMK+ + K +GRIMLKGD ITL+QS
Sbjct:    1 MRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQS 49          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Xenopus
Match: nxph4 (neurexophilin 4 [Source:Xenbase;Acc:XB-GENE-993146])

HSP 1 Score: 128.642 bits (322), Expect = 1.759e-39
Identity = 58/89 (65.17%), Postives = 72/89 (80.90%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H+K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHLKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Mouse
Match: Snrpe (small nuclear ribonucleoprotein E [Source:MGI Symbol;Acc:MGI:98346])

HSP 1 Score: 127.102 bits (318), Expect = 4.592e-39
Identity = 58/89 (65.17%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Mouse
Match: Snrpe (small nuclear ribonucleoprotein E [Source:MGI Symbol;Acc:MGI:98346])

HSP 1 Score: 103.605 bits (257), Expect = 1.006e-29
Identity = 46/76 (60.53%), Postives = 59/76 (77.63%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGR 257
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++G+
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGK 76          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Mouse
Match: Snrpe (small nuclear ribonucleoprotein E [Source:MGI Symbol;Acc:MGI:98346])

HSP 1 Score: 65.4698 bits (158), Expect = 3.677e-15
Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIIL 173
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCII 48          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Mouse
Match: Snrpg (small nuclear ribonucleoprotein polypeptide G [Source:MGI Symbol;Acc:MGI:1915261])

HSP 1 Score: 42.3578 bits (98), Expect = 5.794e-6
Identity = 17/50 (34.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query:  153 RIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
             ++GI+ GFD +MN+V+D+ VE    SG +  IG ++++G++I ++++ +
Sbjct:   26 HVQGILRGFDPFMNLVIDECVEM-ATSGQQNNIGMVVIRGNSIIMLEALE 74          
BLAST of Small nuclear ribonucleoprotein E vs. UniProt/SwissProt
Match: sp|A1XQR9|RUXE_PIG (Small nuclear ribonucleoprotein E OS=Sus scrofa OX=9823 GN=SNRPE PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.199e-38
Identity = 58/89 (65.17%), Postives = 72/89 (80.90%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR  ++   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQAQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. UniProt/SwissProt
Match: sp|P62305|RUXE_MOUSE (Small nuclear ribonucleoprotein E OS=Mus musculus OX=10090 GN=Snrpe PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.212e-38
Identity = 58/89 (65.17%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. UniProt/SwissProt
Match: sp|P62304|RUXE_HUMAN (Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.212e-38
Identity = 58/89 (65.17%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. UniProt/SwissProt
Match: sp|P62303|RUXE_CHICK (Small nuclear ribonucleoprotein E OS=Gallus gallus OX=9031 GN=SNRPE PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.212e-38
Identity = 58/89 (65.17%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. UniProt/SwissProt
Match: sp|A4FUI2|RUXE_BOVIN (Small nuclear ribonucleoprotein E OS=Bos taurus OX=9913 GN=SNRPE PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.212e-38
Identity = 58/89 (65.17%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E H K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. TrEMBL
Match: A0A401SVB9 (Small nuclear ribonucleoprotein E OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0012815 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.445e-37
Identity = 59/89 (66.29%), Postives = 72/89 (80.90%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR  ++   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMKS S K +GR+MLKGD ITL+QS
Sbjct:    1 MAYRGQAQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHMKSKSRKPLGRVMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. TrEMBL
Match: A0A401PI03 (Small nuclear ribonucleoprotein E OS=Scyliorhinus torazame OX=75743 GN=scyTo_0002157 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 7.099e-37
Identity = 59/89 (66.29%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR  +    K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMKS S K +GR+MLKGD ITL+QS
Sbjct:    1 MAYRGQAPKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHMKSKSRKPLGRVMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. TrEMBL
Match: K4G3W0 (Small nuclear ribonucleoprotein E OS=Callorhinchus milii OX=7868 GN=snrpe PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 8.935e-37
Identity = 58/89 (65.17%), Postives = 72/89 (80.90%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR  ++   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMKS + K +GR+MLKGD ITL+QS
Sbjct:    1 MAYRGQAQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHMKSKARKPLGRVMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. TrEMBL
Match: Q6GPZ6 (Small nuclear ribonucleoprotein E OS=Xenopus laevis OX=8355 GN=snrpe PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 9.234e-37
Identity = 59/89 (66.29%), Postives = 72/89 (80.90%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++RVQ WLYEQ NMRIEG I+GFDEYMN+VLDDA E H+K+ S K++GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRVQVWLYEQVNMRIEGCIIGFDEYMNIVLDDAEEIHLKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. TrEMBL
Match: A0A0B7BL15 (Small nuclear ribonucleoprotein E (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF198365 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.782e-36
Identity = 58/92 (63.04%), Postives = 72/92 (78.26%), Query Frame = 3
Query:   24 FAMAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSC 299
            F MAY+   +   K M+QPIN+IFR+ Q ++RVQ WLYEQ N+RIEG I+GFDEYMN+VLDDA E HMK+ S +++GRIMLKGD ITLIQ  
Sbjct:   21 FIMAYKAAGQKVQKVMVQPINLIFRYLQNRSRVQVWLYEQINLRIEGCIVGFDEYMNLVLDDAEEVHMKTQSRRRLGRIMLKGDNITLIQQV 112          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Cavefish
Match: ENSAMXT00000047812.1 (small nuclear ribonucleoprotein E [Source:NCBI gene;Acc:103041055])

HSP 1 Score: 125.946 bits (315), Expect = 9.453e-39
Identity = 57/89 (64.04%), Postives = 70/89 (78.65%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+  WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMK+ + K +GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRISVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKTLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Cavefish
Match: ENSAMXT00000034753.1 (small nuclear ribonucleoprotein E [Source:NCBI gene;Acc:103041055])

HSP 1 Score: 125.946 bits (315), Expect = 9.453e-39
Identity = 57/89 (64.04%), Postives = 70/89 (78.65%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+  WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMK+ + K +GRIMLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRISVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKTLGRIMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Cavefish
Match: ENSAMXT00000040239.1 (small nuclear ribonucleoprotein E [Source:NCBI gene;Acc:103041055])

HSP 1 Score: 95.9005 bits (237), Expect = 7.393e-27
Identity = 46/78 (58.97%), Postives = 58/78 (74.36%), Query Frame = 3
Query:   75 QPINIIFRF----FQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
             P ++ F F     + ++R+  WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMK+ + K +GRIMLKGD ITL+QS
Sbjct:   13 HPESLQFCFGTNKLKDRSRISVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKTLGRIMLKGDNITLLQS 90          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008273.1 (pep scaffold:Pmarinus_7.0:GL501209:1649:6593:-1 gene:ENSPMAG00000007487.1 transcript:ENSPMAT00000008273.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.79 bits (312), Expect = 2.333e-38
Identity = 57/87 (65.52%), Postives = 69/87 (79.31%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLI 290
            MAYR G     K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMK+ + K +GR+MLKGD ITLI
Sbjct:    1 MAYR-GQPKVQKVMVQPINLIFRYLQNRSRIQIWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHMKTKARKPLGRLMLKGDNITLI 86          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Yeast
Match: SME1 (Core Sm protein Sm E; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Smd3p, Smx3p, and Smx2p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm E [Source:SGD;Acc:S000005685])

HSP 1 Score: 93.9745 bits (232), Expect = 6.590e-27
Identity = 46/92 (50.00%), Postives = 62/92 (67.39%), Query Frame = 3
Query:   48 SRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKK-------IGRIMLKGDAITLIQSCD 302
            ++   KAM+ PIN IF F Q +T V  WL+EQ  +RI+G I+GFDE+MNVV+D+AVE  + S   K+       +G+I+LKGD ITLI S D
Sbjct:    3 NKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD 94          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Yeast
Match: LSM5 (Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA [Source:SGD;Acc:S000000948])

HSP 1 Score: 41.2022 bits (95), Expect = 2.280e-6
Identity = 26/80 (32.50%), Postives = 45/80 (56.25%), Query Frame = 3
Query:   72 IQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVE----RHMKSGSEKKI---GRIMLKGDAITLI 290
            I P+ +I +    K  +      Q N   EG ++GFD+++NV+L+DAVE       +S +EK +   GR++L G+ I ++
Sbjct:    6 ILPLEVIDKTINQKVLIVL----QSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAIL 81          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Nematostella
Match: EDO39176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT2])

HSP 1 Score: 115.161 bits (287), Expect = 7.765e-35
Identity = 51/93 (54.84%), Postives = 72/93 (77.42%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCDCT 308
            MAY+ G +   K M+QPIN+IFR+ Q ++++Q WLYEQ NMRIEG I+GFDEYMN+VLD+A E H+K+ + K +GRI++KGD ITL+ +   +
Sbjct:    1 MAYK-GQKV-QKVMVQPINLIFRYLQNRSKIQIWLYEQVNMRIEGHIIGFDEYMNLVLDEAEEVHLKTKTRKPLGRILIKGDNITLLMNASPS 91          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Nematostella
Match: EDO48813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RII4])

HSP 1 Score: 44.669 bits (104), Expect = 2.107e-7
Identity = 21/51 (41.18%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  153 RIEGIILGFDEYMNVVLDDAVERHMKSGSEK-KIGRIMLKGDAITLIQSCD 302
             + G++ G+D +MN+VLDDAVE    SG+EK  IG ++++G++I  +++ D
Sbjct:   26 HVSGVLRGYDPFMNLVLDDAVEN--VSGNEKHAIGMVVIRGNSIVTMEALD 74          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Medaka
Match: snrpe (small nuclear ribonucleoprotein polypeptide E [Source:NCBI gene;Acc:101173384])

HSP 1 Score: 127.872 bits (320), Expect = 2.142e-39
Identity = 57/89 (64.04%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQS 296
            MAYR   +   K M+QPIN+IFR+ Q ++R+Q WLYEQ NMRIEG I+GFDEYMN+VLDDA E HMK+ + K +GR+MLKGD ITL+QS
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKPLGRVMLKGDNITLLQS 89          
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Medaka
Match: snrpe (small nuclear ribonucleoprotein polypeptide E [Source:NCBI gene;Acc:101173384])

HSP 1 Score: 83.5741 bits (205), Expect = 2.950e-22
Identity = 43/92 (46.74%), Postives = 53/92 (57.61%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCDC 305
            MAYR   +   K M+QPIN+IFR+ Q                      GFDEYMN+VLDDA E HMK+ + K +GR+MLKGD ITL+QS   
Sbjct:    1 MAYRGQGQKVQKVMVQPINLIFRYLQN---------------------GFDEYMNLVLDDAEEVHMKTKNRKPLGRVMLKGDNITLLQSVST 71          
BLAST of Small nuclear ribonucleoprotein E vs. Planmine SMEST
Match: SMESG000036643.1 (SMESG000036643.1)

HSP 1 Score: 195.667 bits (496), Expect = 2.050e-66
Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 3
Query:   30 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCDCT 308
            MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCDCT
Sbjct:    1 MAYRQGSRAGNKAMIQPINIIFRFFQTKTRVQFWLYEQCNMRIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCDCT 93          
BLAST of Small nuclear ribonucleoprotein E vs. Planmine SMEST
Match: SMESG000081731.1 (SMESG000081731.1)

HSP 1 Score: 46.9802 bits (110), Expect = 5.568e-8
Identity = 21/50 (42.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query:  153 RIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
            R++GI+ GFD +MN+VL++AVE   K   E  IG I+++G++I+++++ D
Sbjct:   26 RVKGIMRGFDPFMNIVLENAVEID-KDNQEVNIGTIVIRGNSISILEAVD 74          
BLAST of Small nuclear ribonucleoprotein E vs. Planmine SMEST
Match: SMESG000081727.1 (SMESG000081727.1)

HSP 1 Score: 46.9802 bits (110), Expect = 5.568e-8
Identity = 21/50 (42.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query:  153 RIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 302
            R++GI+ GFD +MN+VL++AVE   K   E  IG I+++G++I+++++ D
Sbjct:   26 RVKGIMRGFDPFMNIVLENAVEID-KDNQEVNIGTIVIRGNSISILEAVD 74          
The following BLAST results are available for this feature:
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRPE6.688e-3965.17small nuclear ribonucleoprotein polypeptide E [Sou... [more]
SNRPE6.430e-1973.47small nuclear ribonucleoprotein polypeptide E [Sou... [more]
SNRPG6.589e-634.00small nuclear ribonucleoprotein polypeptide G [Sou... [more]
SNRPG8.440e-634.00small nuclear ribonucleoprotein polypeptide G [Sou... [more]
SNRPG8.579e-634.69small nuclear ribonucleoprotein polypeptide G [Sou... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snr-65.069e-3357.65Probable small nuclear ribonucleoprotein E [Sourc... [more]
snr-71.361e-636.00Probable small nuclear ribonucleoprotein G [Sourc... [more]
lsm-51.945e-628.92U6 snRNA-associated Sm-like protein LSm5 [Source:... [more]
lsm-51.945e-628.92U6 snRNA-associated Sm-like protein LSm5 [Source:... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SmE3.764e-3457.30gene:FBgn0261790 transcript:FBtr0079560[more]
SNRPG9.895e-840.82gene:FBgn0261791 transcript:FBtr0112993[more]
SNRPG9.895e-840.82gene:FBgn0261791 transcript:FBtr0074377[more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
snrpe1.115e-3864.04small nuclear ribonucleoprotein polypeptide E [Sou... [more]
snrpe2.910e-2248.89small nuclear ribonucleoprotein polypeptide E [Sou... [more]
snrpe1.302e-1973.47small nuclear ribonucleoprotein polypeptide E [Sou... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nxph41.759e-3965.17neurexophilin 4 [Source:Xenbase;Acc:XB-GENE-993146... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Snrpe4.592e-3965.17small nuclear ribonucleoprotein E [Source:MGI Symb... [more]
Snrpe1.006e-2960.53small nuclear ribonucleoprotein E [Source:MGI Symb... [more]
Snrpe3.677e-1558.33small nuclear ribonucleoprotein E [Source:MGI Symb... [more]
Snrpg5.794e-634.00small nuclear ribonucleoprotein polypeptide G [Sou... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1XQR9|RUXE_PIG1.199e-3865.17Small nuclear ribonucleoprotein E OS=Sus scrofa OX... [more]
sp|P62305|RUXE_MOUSE3.212e-3865.17Small nuclear ribonucleoprotein E OS=Mus musculus ... [more]
sp|P62304|RUXE_HUMAN3.212e-3865.17Small nuclear ribonucleoprotein E OS=Homo sapiens ... [more]
sp|P62303|RUXE_CHICK3.212e-3865.17Small nuclear ribonucleoprotein E OS=Gallus gallus... [more]
sp|A4FUI2|RUXE_BOVIN3.212e-3865.17Small nuclear ribonucleoprotein E OS=Bos taurus OX... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A401SVB93.445e-3766.29Small nuclear ribonucleoprotein E OS=Chiloscyllium... [more]
A0A401PI037.099e-3766.29Small nuclear ribonucleoprotein E OS=Scyliorhinus ... [more]
K4G3W08.935e-3765.17Small nuclear ribonucleoprotein E OS=Callorhinchus... [more]
Q6GPZ69.234e-3766.29Small nuclear ribonucleoprotein E OS=Xenopus laevi... [more]
A0A0B7BL151.782e-3663.04Small nuclear ribonucleoprotein E (Fragment) OS=Ar... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000047812.19.453e-3964.04small nuclear ribonucleoprotein E [Source:NCBI gen... [more]
ENSAMXT00000034753.19.453e-3964.04small nuclear ribonucleoprotein E [Source:NCBI gen... [more]
ENSAMXT00000040239.17.393e-2758.97small nuclear ribonucleoprotein E [Source:NCBI gen... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008273.12.333e-3865.52pep scaffold:Pmarinus_7.0:GL501209:1649:6593:-1 ge... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SME16.590e-2750.00Core Sm protein Sm E; part of heteroheptameric com... [more]
LSM52.280e-632.50Lsm (Like Sm) protein; part of heteroheptameric co... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO391767.765e-3554.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488132.107e-741.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snrpe2.142e-3964.04small nuclear ribonucleoprotein polypeptide E [Sou... [more]
snrpe2.950e-2246.74small nuclear ribonucleoprotein polypeptide E [Sou... [more]
back to top
BLAST of Small nuclear ribonucleoprotein E vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000036643.12.050e-66100.00SMESG000036643.1[more]
SMESG000081731.15.568e-842.00SMESG000081731.1[more]
SMESG000081727.15.568e-842.00SMESG000081727.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014896 ID=SMED30014896|Name=Small nuclear ribonucleoprotein E|organism=Schmidtea mediterranea sexual|type=transcript|length=362bp
TAAATATTTAATAAATTTAAAATTTTGCTATGGCTTATAGACAAGGTTCT
CGTGCTGGAAATAAGGCTATGATACAGCCTATTAATATTATATTTCGCTT
CTTTCAAACGAAAACTCGTGTTCAGTTTTGGCTTTATGAACAATGCAATA
TGAGAATCGAAGGTATAATTCTTGGTTTTGATGAATATATGAATGTCGTG
CTTGATGATGCTGTTGAACGACATATGAAAAGTGGAAGTGAAAAAAAGAT
TGGAAGAATAATGCTTAAAGGTGACGCGATTACTCTTATTCAAAGTTGTG
ATTGTACATAATATTATTGAAAATGAAGTTGTATATATTTTAATAAATAT
ATTTAGTTTCTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005682U5 snRNP
GO:0005686U2 snRNP
GO:0046540U4/U6 x U5 tri-snRNP complex
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005683U7 snRNP
GO:0005685U1 snRNP
GO:0005687U4 snRNP
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030529intracellular ribonucleoprotein complex
GO:0034709methylosome
GO:0034715pICln-Sm protein complex
GO:0034719SMN-Sm protein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR027078snRNP-E
IPR001163LSM_dom_euk/arc
IPR010920LSM_dom_sf
Vocabulary: biological process
TermDefinition
GO:0000387spliceosomal snRNP assembly
GO:0000398mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0042633hair cycle
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001163LSM domain, eukaryotic/archaea-typeSMARTSM00651Sm3coord: 23..89
e-value: 8.5E-15
score: 65.2
IPR001163LSM domain, eukaryotic/archaea-typePFAMPF01423LSMcoord: 24..88
e-value: 1.8E-14
score: 53.2
NoneNo IPR availableGENE3DG3DSA:2.30.30.100coord: 1..91
e-value: 5.1E-34
score: 118.0
NoneNo IPR availablePANTHERPTHR11193:SF0SMALL NUCLEAR RIBONUCLEOPROTEIN Ecoord: 9..90
IPR027078Small nuclear ribonucleoprotein EPANTHERPTHR11193SMALL NUCLEAR RIBONUCLEOPROTEIN Ecoord: 9..90
IPR027078Small nuclear ribonucleoprotein ECDDcd01718Sm_Ecoord: 12..89
e-value: 5.49031E-49
score: 147.7
IPR010920LSM domain superfamilySUPERFAMILYSSF50182Sm-like ribonucleoproteinscoord: 16..90