Epoxide hydrolase

Overview
NameEpoxide hydrolase
Smed IDSMED30014891
Length (bp)1486
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Epoxide hydrolase (SMED30014891) t-SNE clustered cells

Violin plots show distribution of expression levels for Epoxide hydrolase (SMED30014891) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epoxide hydrolase (SMED30014891) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epoxide hydrolase (SMED30014891) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014891

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014891SMESG000002805.1 dd_Smed_v4_5113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014891SMESG000002805.1 dd_Smed_v4_5113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epoxide hydrolase vs. Ensembl Human
Match: EPHX1 (epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3401])

HSP 1 Score: 315.464 bits (807), Expect = 2.430e-102
Identity = 170/415 (40.96%), Postives = 258/415 (62.17%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            S+    ++  D  + +L  R+     +  L DS F YGFN++YL  +I +W N++ W+     +N++ H+ T I+GL IHFIHVK P + +     P+L++HGWPGSF+EFYK+IP L +  +   ++++ FE+ICPS+ GYG+S+A+   GF+  A + I + LM RL    +FYIQGGD+G++I   M+++ P  V G+H+NM  + L +F  LT + +G      +  L++ ++++LYP  E +     R  GY  +Q T+P T+G  L+DSP GLAAYI+EKF  WT+    ++   DGGLE  K S D++LTNVM+Y+ T +I SS RFYKE L +    +K  ++ + VP G + FP EL   P K    KY  +  ++YM  GGHFAA EEPELL++DI  F+ ++E 
Sbjct:   47 SIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGF-QEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALV-LSNFSTLT-LLLGQRFGRFLG-LTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLE--DGGLER-KFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLER 454          
BLAST of Epoxide hydrolase vs. Ensembl Human
Match: EPHX1 (epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3401])

HSP 1 Score: 315.464 bits (807), Expect = 2.430e-102
Identity = 170/415 (40.96%), Postives = 258/415 (62.17%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            S+    ++  D  + +L  R+     +  L DS F YGFN++YL  +I +W N++ W+     +N++ H+ T I+GL IHFIHVK P + +     P+L++HGWPGSF+EFYK+IP L +  +   ++++ FE+ICPS+ GYG+S+A+   GF+  A + I + LM RL    +FYIQGGD+G++I   M+++ P  V G+H+NM  + L +F  LT + +G      +  L++ ++++LYP  E +     R  GY  +Q T+P T+G  L+DSP GLAAYI+EKF  WT+    ++   DGGLE  K S D++LTNVM+Y+ T +I SS RFYKE L +    +K  ++ + VP G + FP EL   P K    KY  +  ++YM  GGHFAA EEPELL++DI  F+ ++E 
Sbjct:   47 SIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGF-QEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALV-LSNFSTLT-LLLGQRFGRFLG-LTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLE--DGGLER-KFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLER 454          
BLAST of Epoxide hydrolase vs. Ensembl Human
Match: EPHX1 (epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3401])

HSP 1 Score: 315.464 bits (807), Expect = 2.430e-102
Identity = 170/415 (40.96%), Postives = 258/415 (62.17%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            S+    ++  D  + +L  R+     +  L DS F YGFN++YL  +I +W N++ W+     +N++ H+ T I+GL IHFIHVK P + +     P+L++HGWPGSF+EFYK+IP L +  +   ++++ FE+ICPS+ GYG+S+A+   GF+  A + I + LM RL    +FYIQGGD+G++I   M+++ P  V G+H+NM  + L +F  LT + +G      +  L++ ++++LYP  E +     R  GY  +Q T+P T+G  L+DSP GLAAYI+EKF  WT+    ++   DGGLE  K S D++LTNVM+Y+ T +I SS RFYKE L +    +K  ++ + VP G + FP EL   P K    KY  +  ++YM  GGHFAA EEPELL++DI  F+ ++E 
Sbjct:   47 SIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGF-QEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALV-LSNFSTLT-LLLGQRFGRFLG-LTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLE--DGGLER-KFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLER 454          
BLAST of Epoxide hydrolase vs. Ensembl Human
Match: EPHX1 (epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3401])

HSP 1 Score: 99.3673 bits (246), Expect = 5.940e-24
Identity = 46/118 (38.98%), Postives = 72/118 (61.02%), Query Frame = 2
Query:  164 NSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLI 514
               S+    ++  D  + +L  R+     +  L DS F YGFN++YL  +I +W N++ W+     +N++ H+ T I+GL IHFIHVKP  + +     P+L++HGWPGSF+EFYK+I
Sbjct:   44 EDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKII 161          
BLAST of Epoxide hydrolase vs. Ensembl Human
Match: EPHX1 (epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3401])

HSP 1 Score: 70.8626 bits (172), Expect = 3.798e-14
Identity = 32/89 (35.96%), Postives = 51/89 (57.30%), Query Frame = 2
Query:  164 NSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKP 430
               S+    ++  D  + +L  R+     +  L DS F YGFN++YL  +I +W N++ W+     +N++ H+ T I+GL IHFIHVKP
Sbjct:   44 EDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKP 132          
BLAST of Epoxide hydrolase vs. Ensembl Celegans
Match: W01A11.1 (Epoxide hydrolase [Source:UniProtKB/TrEMBL;Acc:Q23068])

HSP 1 Score: 283.108 bits (723), Expect = 3.050e-90
Identity = 171/420 (40.71%), Postives = 250/420 (59.52%), Query Frame = 2
Query:  149 GYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDS--NFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMI-EIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKE-FLSESNEKLLKIPINVPAGIALFPHELF-RIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIK 1384
            G    +++ +    + V  S +++LK RL+N  +S S+L+   +F YGFN+  L  L D+W+N+Y WR  EA +N+F  + T I+GLQ+HF+HVKP  KS + + PIL+ HGWPG+ FEFYK IP L +        D+AFE+I PS+ GYGWSD     GF   A + +   LM RL   +KFY+QGGD+GA+I + ++K+ P  V  +H+NM+  +P  +        +G ++PS++   SKE      PF++   +     GY  LQAT+P T G  L+DSP GLAAYIIEKF  WT+  +  +   DGGL   + + DE+LT VMIY+   +I SS RFY+E FL    E L K  ++ P   A   +EL+ R P +++   Y NI  +T +   GHFAA E P+ L++ +  F+K
Sbjct:   40 GKAKPDNTEIKPFKVNVEQSVIDDLKHRLQNARISHSVLEDSDDFYYGFNSKQLLKLRDYWLNKYDWRKQEATINQFPQFKTEIEGLQVHFLHVKP-PKSYKNVKPILVAHGWPGNVFEFYKFIPLLTDPKKHGIDSDFAFEVIAPSIPGYGWSDQPKKTGFSQLACARVFRKLMLRLGY-NKFYLQGGDWGAIITSLLTKVYPQNVMALHLNMMPAMPGANALGTFYDILGWLIPSTLS--SKEIQKTHNPFSK-FGLLIVETGYMHLQATKPDTAGTSLNDSPIGLAAYIIEKFSTWTNTENRALP--DGGLNK-RFTNDELLTIVMIYWTNGNIVSSQRFYREMFLDRRCEALGKRYVSTPTAHASGLNELYDRTPIEVSRHSY-NITHYTEI-DMGHFAAFEAPKPLAQSVFKFVK 449          
BLAST of Epoxide hydrolase vs. Ensembl Celegans
Match: C45B11.6 (Epoxide hydrolase [Source:UniProtKB/TrEMBL;Acc:A4UVK7])

HSP 1 Score: 154.451 bits (389), Expect = 2.271e-41
Identity = 118/443 (26.64%), Postives = 213/443 (48.08%), Query Frame = 2
Query:  113 PDMPNVTLK--EIWGYRD--MNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND-------TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHV-NMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYF----WLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFY-KEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKL 1387
            PD P + +   + W   D   +  ++    I + +S + N K +L++     +L D+N+      +YLN L    +  + W+  +  +N F+ Y T I+GL+IHF+ V  P      +++P+L+ HG+PGSF++F+K+IP L   +         E   FE+I PSL G+ +SD     GF+  A + I+  LM RLN+ + F      +G+ +A  +S + P ++AG+H+ N    P +    L K  + +M        ++E  +      +N +       YF    +   T     G    +SPSG A YI  +   W    ++   +    L TM    DE+ T + +Y++T+++ S++      F  ES    L   + +P  ++      +R  + + E +Y N+ + + +P GG F  L++   ++EDI SF++L
Sbjct:   26 PDFPPLEIDPDDYWKLDDPEKDDDTIYSFTIDIKESEVSNFKEKLESERFLPTLYDTNY-----DNYLNELKQVLLG-FNWKQHQHFLNTFKQYKTEIEGLKIHFLRVSTPPKDKKSRVVPLLIFHGFPGSFWDFFKIIPILTNPSRHGFDFGVEEAIQFEVIVPSLPGFIFSDKPTKQGFNAIATARIIAKLMYRLNLNNYFVHGTEGYGSDVATLLSSLYPTRIAGLHLSNPFVNPTFSTFTLAKYALKAMGQKDEDRENQENRETG---KDNRDQMTDLADYFKQDKFAYPTNSQAFGAAFLNSPSGTAKYIESR---WKQLSTFFAETNLNELFTM----DEIATEIYLYWLTDTLPSALTILDSSFNFES--VWLSSQVRIPTAVSYSKQTPWRCSKDILEDRYLNLTRISELPKGGMFHHLQDGHKIAEDIFSFVEL 450          
BLAST of Epoxide hydrolase vs. Ensembl Celegans
Match: W01A11.1 (Epoxide hydrolase [Source:UniProtKB/TrEMBL;Acc:Q23068])

HSP 1 Score: 142.124 bits (357), Expect = 6.154e-39
Identity = 94/239 (39.33%), Postives = 140/239 (58.58%), Query Frame = 2
Query:  677 SKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMI-EIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKE-FLSESNEKLLKIPINVPAGIALFPHELF-RIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIK 1384
            +KFY+QGGD+GA+I + ++K+ P  V  +H+NM+  +P  +        +G ++PS++   SKE      PF++   +     GY  LQAT+P T G  L+DSP GLAAYIIEKF  WT+  +  +   DGGL   + + DE+LT VMIY+   +I SS RFY+E FL    E L K  ++ P   A   +EL+ R P +++   Y NI  +T +   GHFAA E P+ L++ +  F+K
Sbjct:    7 NKFYLQGGDWGAIITSLLTKVYPQNVMALHLNMMPAMPGANALGTFYDILGWLIPSTLS--SKEIQKTHNPFSK-FGLLIVETGYMHLQATKPDTAGTSLNDSPIGLAAYIIEKFSTWTNTENRALP--DGGLNK-RFTNDELLTIVMIYWTNGNIVSSQRFYREMFLDRRCEALGKRYVSTPTAHASGLNELYDRTPIEVSRHSY-NITHYTEI-DMGHFAAFEAPKPLAQSVFKFVK 237          
BLAST of Epoxide hydrolase vs. Ensembl Fly
Match: Jheh1 (gene:FBgn0010053 transcript:FBtr0086625)

HSP 1 Score: 273.478 bits (698), Expect = 3.936e-86
Identity = 166/426 (38.97%), Postives = 240/426 (56.34%), Query Frame = 2
Query:  164 NSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDS-NFLYGFNTDYLNNLIDFWINQY--QWRIWEAKMNKFRHYFTTIKGLQIHFIH--VKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESN--DTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVENA*NMET 1414
            N+S V+   +  PD T+ +LK RL   +  T  L+   F YGFNT+YL  ++++W + Y  +WR  E  + +F H+ T I+GL+ HF+H  V    K  +K  P+LLLHGWPGS  EFY  I  L ++N  +   Y F ++ PSL GYGWS      G     ++ +M  LM RL   +KF+IQGGD+G++I + ++ + P+ V G H NM        + L K  +    PS   F+     D  +P +  +       GYF +QAT+P TIG  L+D+P GLAAYI+EKF  WT N SY     DGGL T +   D +L N+MIYY+TNSI++S R Y E  +++   L   ++P  VP G A F  ++ +      + KY N+   TY   GGHFAALE P++L +D I F++ VE    ++T
Sbjct:   56 NNSEVIGNRLSYPDKTIADLKERLNRTLRLTPPLEGVAFEYGFNTNYLKEVVEYWRDDYLPRWREREVFLWQFNHFTTDIQGLRTHFLHLMVYDDNKVGKKHYPVLLLHGWPGSVREFYDFIHLLHQTNLDNNNKYIFNVVVPSLPGYGWSQGTSRKGLGPAQVAVMMRNLMLRLGY-NKFFIQGGDWGSIIGSNIATLYPENVLGYHSNMCNN--LSPKSLAKGLVAEFWPSL--FVPSGFEDFFFPKSNEMRYLMEESGYFHIQATKPDTIGAALTDNPVGLAAYILEKFSTWT-NPSYRSLP-DGGL-TKRYKMDALLDNLMIYYLTNSITTSQRLYAEQYAQAQRDLHLDRVPTRVPTGCARFKSDIMQFLDVQLKDKYTNLVHSTYHKKGGHFAALEVPKVLYKDFIDFVETVERKFKIKT 473          
BLAST of Epoxide hydrolase vs. Ensembl Fly
Match: Jheh2 (gene:FBgn0034405 transcript:FBtr0345981)

HSP 1 Score: 267.314 bits (682), Expect = 6.602e-84
Identity = 162/439 (36.90%), Postives = 241/439 (54.90%), Query Frame = 2
Query:  113 PDMPN-----VTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDS-NFLYGFNTDYLNNLIDFWINQY--QWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQK---LIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMI--EIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIK 1384
            PD+ N      TLKE   YR+  + +++   I V    +E+L  +L   + + + L+   F YGFN + L  ++ +W + Y  +W   E  + K  HY T I+GL+IHFIH KP     QK   ++P+LL+HGWPG+  EFY  IP L   +D  DY FE+I PSL GYGWS  +   GF +  ++ +M  LM R+    KF +QGGD+G++I + ++ + P+ V G H NM     P+   + +    + S  PS   F+  E  D         +     MGY  +QA++P TIG  L D+P+GLA+YI+EKF  WT+     +   DGGL T + + D++L NVMIYY+TNSI++S+R Y E +  S   L    +PI   AG   F HE+      +   K+ N+   T+   GGHF A E P+ L +D +SF++
Sbjct:   34 PDLDNNAYWGPTLKEP--YRE--NKAILPFDISVKPEVIEDLIGQLSRPLKAQAPLEGVGFQYGFNANELAKVVKYWRDTYLPKWSEREEYLKKLDHYQTEIQGLKIHFIHAKPSQVKGQKPKKVLPLLLMHGWPGTVREFYDFIPLLTTPSDKSDYVFEVIAPSLPGYGWSQGSSKTGFGVAQVAVVMRNLMLRVGF-DKFLVQGGDWGSIIGSNVASLFPENVLGYHSNMCGNNSPMGQLKMV----LASFFPS--WFVDSEYADFYKGLGHLFSTIMEEMGYAHIQASKPDTIGNALIDNPTGLASYILEKFSTWTNTAFRSLP--DGGL-TKRFTYDQLLDNVMIYYVTNSITTSMRLYSESMVASQFALAVDSVPIKAKAGCTRFAHEITHFSDSVLANKFPNLVHSTHHRDGGHFPAFELPQQLYDDFVSFVQ 458          
BLAST of Epoxide hydrolase vs. Ensembl Fly
Match: Jheh2 (gene:FBgn0034405 transcript:FBtr0089970)

HSP 1 Score: 267.314 bits (682), Expect = 6.602e-84
Identity = 162/439 (36.90%), Postives = 241/439 (54.90%), Query Frame = 2
Query:  113 PDMPN-----VTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDS-NFLYGFNTDYLNNLIDFWINQY--QWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQK---LIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMI--EIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIK 1384
            PD+ N      TLKE   YR+  + +++   I V    +E+L  +L   + + + L+   F YGFN + L  ++ +W + Y  +W   E  + K  HY T I+GL+IHFIH KP     QK   ++P+LL+HGWPG+  EFY  IP L   +D  DY FE+I PSL GYGWS  +   GF +  ++ +M  LM R+    KF +QGGD+G++I + ++ + P+ V G H NM     P+   + +    + S  PS   F+  E  D         +     MGY  +QA++P TIG  L D+P+GLA+YI+EKF  WT+     +   DGGL T + + D++L NVMIYY+TNSI++S+R Y E +  S   L    +PI   AG   F HE+      +   K+ N+   T+   GGHF A E P+ L +D +SF++
Sbjct:   34 PDLDNNAYWGPTLKEP--YRE--NKAILPFDISVKPEVIEDLIGQLSRPLKAQAPLEGVGFQYGFNANELAKVVKYWRDTYLPKWSEREEYLKKLDHYQTEIQGLKIHFIHAKPSQVKGQKPKKVLPLLLMHGWPGTVREFYDFIPLLTTPSDKSDYVFEVIAPSLPGYGWSQGSSKTGFGVAQVAVVMRNLMLRVGF-DKFLVQGGDWGSIIGSNVASLFPENVLGYHSNMCGNNSPMGQLKMV----LASFFPS--WFVDSEYADFYKGLGHLFSTIMEEMGYAHIQASKPDTIGNALIDNPTGLASYILEKFSTWTNTAFRSLP--DGGL-TKRFTYDQLLDNVMIYYVTNSITTSMRLYSESMVASQFALAVDSVPIKAKAGCTRFAHEITHFSDSVLANKFPNLVHSTHHRDGGHFPAFELPQQLYDDFVSFVQ 458          
BLAST of Epoxide hydrolase vs. Ensembl Fly
Match: Jheh3 (gene:FBgn0034406 transcript:FBtr0086622)

HSP 1 Score: 261.536 bits (667), Expect = 1.640e-81
Identity = 160/425 (37.65%), Postives = 231/425 (54.35%), Query Frame = 2
Query:  146 WGYRDMNS----SSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDS-NFLYGFNTDYLNNLIDFWINQY--QWRIWEAKMNKFRHYFTTIKGLQIHFIH--VKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNM--IEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFI 1381
            WG  D         + E  ++VP S +++L+  L   +  T  LD   F YGFNT  L   +D+W + Y  +W   +   N F+ Y T I+GL IH+IH  V    K  + + P+LLLHGWPGS  EF+  IP L + ++  DYAFE++ PSLVGYGWSDAA  PGF+   M+ +M  LM RL    KF+IQGGD+G++I + ++ + P+ V G H NM  +  PL     + K   GS  P   +  S+  +D  +P  E         GYF +QAT+P TIG  L+ SP GLA+YI+EKF   T+         D G        + +L N+M+YY+TNS +++ RFY E +S++  + +L ++   VP G A F  +L  +       K+ N+    Y   G HFAALE P +L  D  +F+
Sbjct:   43 WGPGDAKDFVPDEKIYEFKLQVPQSEIDDLRKELNRTLRLTEPLDGIAFEYGFNTYALEQFVDYWRDNYLTKWDERQELFNSFKQYKTEIQGLNIHYIHEKVSEEAKEKKHVYPLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPGFNAAEMATVMRNLMLRLG-HKKFFIQGGDWGSIIGSNLATLYPENVIGYHSNMCVLHTPLA----ILKGIYGSFFPEK-YLPSRFFVDHHFPVWEKWLELLEESGYFHIQATKPDTIGAALTSSPVGLASYILEKFQTCTNPGLKQ----DFGAIVTVFGLEAVLDNLMVYYLTNSATTAARFYLENVSKTYRDLQLDRVQSPVPMGCARFRFDLASVTDWQLRDKFPNLTHSMYFQQGSHFAALEMPAMLFNDFTAFV 457          
BLAST of Epoxide hydrolase vs. Ensembl Zebrafish
Match: ephx1 (epoxide hydrolase 1, microsomal (xenobiotic) [Source:ZFIN;Acc:ZDB-GENE-040426-913])

HSP 1 Score: 329.331 bits (843), Expect = 7.563e-108
Identity = 169/411 (41.12%), Postives = 253/411 (61.56%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES-NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            S+    ++     +E+L  RL       SL DS F YGFN+ YL  ++ +W   + W     K+NK+ H+ T I+G+ IH++HVKP  +    + +P++++HGWPGSF+EFY +IP L E ++ +D  FE+ICPS+ GYG+S+A+   GFD    + I   LM+RL  T ++Y+QGGD+G+MI   M+++ P+ V G+H+N              +  G   P    F ++ ++  L+P  + L +   R  GY  +QAT+P T G  L+DSP GLAAYI+EKF  WT      +   DGGLE  K S D++LTNVMIY+ +  I SS+RFYKE   +  N+   K+P++VP G+A FP+EL   P+     KYRN++ +T +  GGHFAA+EEP+LL+ED+ +F+K+VEN
Sbjct:   47 SIRPFKVETTPEEIEDLHRRLDQTRSFPSLEDSQFNYGFNSKYLEKVVSYWRKDFNWGKQLDKLNKYPHFKTKIEGIDIHYVHVKPKNLPEGTRAVPLMMVHGWPGSFYEFYGIIPLLTEPSNPDDITFEVICPSIPGYGFSEASHKKGFDTVCAAHIFNKLMKRLGFT-QYYVQGGDWGSMITTNMAQLEPNAVKGLHINFAPPAQGSVLMGLSLIFGRRFPKLFGF-TEHDVKRLFPCMDKLVVDALRETGYMHIQATKPDTAGRGLNDSPVGLAAYILEKFSTWTDPEFRKLE--DGGLER-KYSLDDLLTNVMIYWTSGCIISSMRFYKENFGKGLNQPHAKLPVHVPTGVASFPNELLHTPKLWVTDKYRNLKSYTPIARGGHFAAMEEPQLLAEDVQNFVKIVEN 452          
BLAST of Epoxide hydrolase vs. Ensembl Zebrafish
Match: ephx1 (epoxide hydrolase 1, microsomal (xenobiotic) [Source:ZFIN;Acc:ZDB-GENE-040426-913])

HSP 1 Score: 329.331 bits (843), Expect = 7.563e-108
Identity = 169/411 (41.12%), Postives = 253/411 (61.56%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES-NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            S+    ++     +E+L  RL       SL DS F YGFN+ YL  ++ +W   + W     K+NK+ H+ T I+G+ IH++HVKP  +    + +P++++HGWPGSF+EFY +IP L E ++ +D  FE+ICPS+ GYG+S+A+   GFD    + I   LM+RL  T ++Y+QGGD+G+MI   M+++ P+ V G+H+N              +  G   P    F ++ ++  L+P  + L +   R  GY  +QAT+P T G  L+DSP GLAAYI+EKF  WT      +   DGGLE  K S D++LTNVMIY+ +  I SS+RFYKE   +  N+   K+P++VP G+A FP+EL   P+     KYRN++ +T +  GGHFAA+EEP+LL+ED+ +F+K+VEN
Sbjct:   47 SIRPFKVETTPEEIEDLHRRLDQTRSFPSLEDSQFNYGFNSKYLEKVVSYWRKDFNWGKQLDKLNKYPHFKTKIEGIDIHYVHVKPKNLPEGTRAVPLMMVHGWPGSFYEFYGIIPLLTEPSNPDDITFEVICPSIPGYGFSEASHKKGFDTVCAAHIFNKLMKRLGFT-QYYVQGGDWGSMITTNMAQLEPNAVKGLHINFAPPAQGSVLMGLSLIFGRRFPKLFGF-TEHDVKRLFPCMDKLVVDALRETGYMHIQATKPDTAGRGLNDSPVGLAAYILEKFSTWTDPEFRKLE--DGGLER-KYSLDDLLTNVMIYWTSGCIISSMRFYKENFGKGLNQPHAKLPVHVPTGVASFPNELLHTPKLWVTDKYRNLKSYTPIARGGHFAAMEEPQLLAEDVQNFVKIVEN 452          
BLAST of Epoxide hydrolase vs. Ensembl Zebrafish
Match: ephx5 (epoxide hydrolase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-1050])

HSP 1 Score: 212.616 bits (540), Expect = 2.968e-65
Identity = 120/258 (46.51%), Postives = 163/258 (63.18%), Query Frame = 2
Query:  635 SDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIH--FGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLK--IPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            + I   LMERL   S+FY+QGGD+GA I + M+++ PD V G+H+NM+         L  + IG  LP  + F +KE++  LYP+ E  NI+      GY  +QAT+P T G  L+DSP GLAAYI+EKF  WT+  +  +   DGGLE  K + D++LTNVMIY+ T SI  S+RFYKE L +  +  +     I+VP G+A FP EL   PR  A  ++ ++R FTYMP GGHFAA EEP+LL++DII F + VE 
Sbjct:    4 ARIFLKLMERLGF-SEFYVQGGDWGAFITSNMAQMKPDCVRGLHLNMVIARTDSTAQLLSLVIGRYLPFLVGF-TKEDVRRLYPYMEK-NIYDILRETGYLHIQATKPDTAGCGLNDSPVGLAAYILEKFSTWTNLENRDLE--DGGLER-KFNLDDLLTNVMIYWTTCSIIPSMRFYKENLKKDFKTRVDRVTSIHVPTGLAAFPDELLHCPRAWASSRFSDVRSFTYMPRGGHFAAFEEPQLLAQDIIQFAEKVEG 255          
BLAST of Epoxide hydrolase vs. Ensembl Zebrafish
Match: CABZ01087953.1 (pep chromosome:GRCz11:13:33688474:33690680:1 gene:ENSDARG00000104106.2 transcript:ENSDART00000161465.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01087953.1)

HSP 1 Score: 135.191 bits (339), Expect = 2.163e-36
Identity = 57/148 (38.51%), Postives = 96/148 (64.86%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPG 616
            ++   V+K     +E+L  R+     +  L DS F YGFN+ YL  ++ +W +Q+ W      +N++ H+ T I+G+ +HF+HV+P+ KS Q ++P++++HGWPGSF+EFY +IP L +++   +  FE+ICPS+ GYG+S+A    G
Sbjct:   73 TIQRFVVKTSVEEIEDLHKRIDLTRFTDPLEDSKFNYGFNSTYLRRVVSYWRHQFNWEKQVKVINQYPHFKTKIEGIDVHFVHVRPLQKSGQTVVPLMMVHGWPGSFYEFYGIIPLLTKTD--SNVVFEVICPSIPGYGYSEAPHKKG 218          
BLAST of Epoxide hydrolase vs. Ensembl Zebrafish
Match: ephx2 (epoxide hydrolase 2, cytoplasmic [Source:ZFIN;Acc:ZDB-GENE-041212-70])

HSP 1 Score: 57.7658 bits (138), Expect = 2.070e-8
Identity = 44/165 (26.67%), Postives = 79/165 (47.88%), Query Frame = 2
Query:  365 NKFRHYFTTIK-GLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLN--ITSKFYIQGGDFGAMIAAGMSKINPDKVAGI------------HVNMIE----IPLYDFR 802
             K  H +  IK G++IH++ +           P+LL HG+P S+F +   IP LA      D  F ++ P + GYG S A   P  + ++   IM  L+  L+    ++  + G D+G ++   M++ +P++V  +            + N IE    IP++D++
Sbjct:  231 EKVSHGYVNIKPGVKIHYVEMG-------DGPPVLLCHGFPESWFSWRYQIPALA------DAGFRVLAPDMKGYGGSTA--PPDIEEYSQEQIMLDLVTFLDKMAIAQVTLVGHDWGGVLVWNMAQFHPERVRAVASLNTPLFPVDPNTNPIEKLMAIPIFDYQ 380          
BLAST of Epoxide hydrolase vs. Ensembl Xenopus
Match: tbl1xr1 (transducin (beta)-like 1 X-linked receptor 1 [Source:Xenbase;Acc:XB-GENE-482046])

HSP 1 Score: 317.005 bits (811), Expect = 7.467e-103
Identity = 176/414 (42.51%), Postives = 253/414 (61.11%), Query Frame = 2
Query:  191 IKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESN----DTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIH-FGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWT----HNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            I+  +  L++L  R+ +   S  L  S F YGFN+ +L  ++ +W N + WR     +NKF H+ T I+GL IHFIHVKP  +   +  IPI+++HGWPGSF+EFYK+IPFL +      DT+ Y FE+ICPS+ GY +S+A+   G +  A++ I + LM RL    +FY QGGD+G++I   +++I P++V G+H+NM          +  V +G   P  +  L  E++  ++PF + +  H     GY  LQAT+P T G  L++SP GLAAYI+EKF  WT     +H       DGGLE  K S D++LTN+MIY+++ SI SS+RFYKE + +     K  ++ + VP G+A FP+EL   P   A+ KY NI  F YMP GGHFAA EEPELL++D+  F+  VE 
Sbjct:   53 IETTEEELKDLFDRIDHTRYSEPLEGSRFNYGFNSTHLRKVVAYWRNTFNWRKQLDILNKFPHFKTKIEGLDIHFIHVKPPHLPGGRTAIPIIMVHGWPGSFYEFYKIIPFLTDPGSHGLDTQ-YIFEVICPSIPGYSFSEASHKQGCESVAVARIFYKLMRRLGF-REFYAQGGDWGSLICTNLAQIAPNQVKGLHINMAAAFPTKLPQILSVVLGQRFPG-LFGLHDEDVRRIFPFFKKVVSHVIKESGYMHLQATKPDTAGCGLNNSPVGLAAYILEKFSTWTDPDFRDHE------DGGLER-KFSLDDLLTNIMIYWLSGSIVSSMRFYKEVVGKGFGTAKHDRVQVTVPTGVASFPNELVHCPPFWAKQKYVNIISFNYMPRGGHFAAFEEPELLAKDVQQFVGKVEQ 456          
BLAST of Epoxide hydrolase vs. Ensembl Xenopus
Match: tbl1xr1 (transducin (beta)-like 1 X-linked receptor 1 [Source:Xenbase;Acc:XB-GENE-482046])

HSP 1 Score: 251.906 bits (642), Expect = 1.586e-77
Identity = 141/341 (41.35%), Postives = 208/341 (61.00%), Query Frame = 2
Query:  191 IKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESN----DTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIH-FGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWT----HNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES 1183
            I+  +  L++L  R+ +   S  L  S F YGFN+ +L  ++ +W N + WR     +NKF H+ T I+GL IHFIHVKP  +   +  IPI+++HGWPGSF+EFYK+IPFL +      DT+ Y FE+ICPS+ GY +S+A+   G +  A++ I + LM RL    +FY QGGD+G++I   +++I P++V G+H+NM          +  V +G   P  +  L  E++  ++PF + +  H     GY  LQAT+P T G  L++SP GLAAYI+EKF  WT     +H       DGGLE  K S D++LTN+MIY+++ SI SS+RFYKE + + 
Sbjct:   53 IETTEEELKDLFDRIDHTRYSEPLEGSRFNYGFNSTHLRKVVAYWRNTFNWRKQLDILNKFPHFKTKIEGLDIHFIHVKPPHLPGGRTAIPIIMVHGWPGSFYEFYKIIPFLTDPGSHGLDTQ-YIFEVICPSIPGYSFSEASHKQGCESVAVARIFYKLMRRLGF-REFYAQGGDWGSLICTNLAQIAPNQVKGLHINMAAAFPTKLPQILSVVLGQRFP-GLFGLHDEDVRRIFPFFKKVVSHVIKESGYMHLQATKPDTAGCGLNNSPVGLAAYILEKFSTWTDPDFRDHE------DGGLER-KFSLDDLLTNIMIYWLSGSIVSSMRFYKEVVGKG 383          
BLAST of Epoxide hydrolase vs. Ensembl Xenopus
Match: lyn (LYN proto-oncogene, Src family tyrosine kinase [Source:Xenbase;Acc:XB-GENE-1015126])

HSP 1 Score: 133.65 bits (335), Expect = 2.413e-35
Identity = 62/138 (44.93%), Postives = 90/138 (65.22%), Query Frame = 2
Query:  215 ENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPG 616
            ++L  RL +      L DS F YGFN+ +L +++ +W N ++WR    ++NK+ HY TTI+GL +HF+HVKP  +   QK  P+L++HGWPGSF+EFY++IP L E        +  FEIICPS+ GYG+S+A    G
Sbjct:   70 QDLYRRLDSTRFFPPLEDSQFHYGFNSTHLKHVVSYWRNSFEWRKQVERINKYPHYKTTIEGLDVHFVHVKPAHLAPGQKARPLLMVHGWPGSFYEFYRIIPLLTEPAKHGLNPNLVFEIICPSIPGYGFSEAPHKKG 207          
BLAST of Epoxide hydrolase vs. Ensembl Mouse
Match: Ephx1 (epoxide hydrolase 1, microsomal [Source:MGI Symbol;Acc:MGI:95405])

HSP 1 Score: 315.464 bits (807), Expect = 2.114e-102
Identity = 170/416 (40.87%), Postives = 254/416 (61.06%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNM--IEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVE 1393
            S+    ++  D  +++L  R+     S  L  S F YGFN+ YL  ++ FW N++ WR     +N++ H+ T I+GL IHFIHVK P + S +   P+L++HGWPGSF+EFYK+IP L +      ++++ FE+ICPS+ GYG+S+A+   G +  A + I + LM RL    KFYIQGGD+G++I   ++++ P+ V G+H+NM  I   +Y    L     G  L       ++++L++LYPF E +  +  R  GY  +QAT+P T+G  L+DSP GLAAYI+EKF  WT +    +   DGGLE  K S +++LTN+MIY+ T +I SS RFYKE L +     +   + + VP G + FP E+   P K  ++KY  +  ++YM  GGHFAA EEP+LL++DI  F+ L E
Sbjct:   47 SIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSSYLKKVVSFWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKTHGLSDEHVFEVICPSIPGYGFSEASSKKGLNSVATARIFYKLMSRLGF-QKFYIQGGDWGSLICTNIAQMVPNHVKGLHLNMSFISRNIYSLTPLLGQRFGRFLG-----YTEKDLELLYPFKEKVFYNIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELE--DGGLER-KFSLEDLLTNIMIYWTTGTIVSSQRFYKENLGQGVMVHRHEGMKVFVPTGYSAFPSEILHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAE 453          
BLAST of Epoxide hydrolase vs. Ensembl Mouse
Match: Ephx1 (epoxide hydrolase 1, microsomal [Source:MGI Symbol;Acc:MGI:95405])

HSP 1 Score: 302.753 bits (774), Expect = 1.241e-97
Identity = 166/414 (40.10%), Postives = 248/414 (59.90%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVE 1393
            S+    ++  D  +++L  R+     S  L  S F YGFN+ YL  ++ FW N++ WR     +N++ H+ T I+GL IHFIHVK P + S +   P+L++HGWPGSF+EFYK+IP L +      ++++ FE+ICPS+ GYG+S+A+   G +  A + I + LM RL    KFYIQGGD+G++I   ++++ P  +  +       PL   RF      G  L       ++++L++LYPF E +  +  R  GY  +QAT+P T+G  L+DSP GLAAYI+EKF  WT +    +   DGGLE  K S +++LTN+MIY+ T +I SS RFYKE L +     +   + + VP G + FP E+   P K  ++KY  +  ++YM  GGHFAA EEP+LL++DI  F+ L E
Sbjct:   47 SIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSSYLKKVVSFWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKTHGLSDEHVFEVICPSIPGYGFSEASSKKGLNSVATARIFYKLMSRLGF-QKFYIQGGDWGSLICTNIAQMVPKNIYSL------TPLLGQRF------GRFLG-----YTEKDLELLYPFKEKVFYNIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELE--DGGLER-KFSLEDLLTNIMIYWTTGTIVSSQRFYKENLGQGVMVHRHEGMKVFVPTGYSAFPSEILHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAE 439          
BLAST of Epoxide hydrolase vs. Ensembl Mouse
Match: Ephx1 (epoxide hydrolase 1, microsomal [Source:MGI Symbol;Acc:MGI:95405])

HSP 1 Score: 200.29 bits (508), Expect = 1.378e-60
Identity = 111/255 (43.53%), Postives = 163/255 (63.92%), Query Frame = 2
Query:  407 IHFIHVKP-IVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNM--IEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSS 1150
            IHFIHVKP  + S +   P+L++HGWPGSF+EFYK+IP L +      ++++ FE+ICPS+ GYG+S+A+   G +  A + I + LM RL    KFYIQGGD+G++I   ++++ P+ V G+H+NM  I   +Y    L     G  L       ++++L++LYPF E +  +  R  GY  +QAT+P T+G  L+DSP GLAAYI+EKF  WT +    +   DGGLE  K S +++LTN+MIY+ T +I SS
Sbjct:    2 IHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKTHGLSDEHVFEVICPSIPGYGFSEASSKKGLNSVATARIFYKLMSRLGF-QKFYIQGGDWGSLICTNIAQMVPNHVKGLHLNMSFISRNIYSLTPLLGQRFGRFLG-----YTEKDLELLYPFKEKVFYNIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELE--DGGLER-KFSLEDLLTNIMIYWTTGTIVSS 247          
BLAST of Epoxide hydrolase vs. Ensembl Mouse
Match: Ephx1 (epoxide hydrolase 1, microsomal [Source:MGI Symbol;Acc:MGI:95405])

HSP 1 Score: 67.0106 bits (162), Expect = 4.718e-13
Identity = 31/87 (35.63%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  164 NSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHV 424
               S+    ++  D  +++L  R+     S  L  S F YGFN+ YL  ++ FW N++ WR     +N++ H+ T I+GL IHFIHV
Sbjct:   44 EDESIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSSYLKKVVSFWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFIHV 130          
BLAST of Epoxide hydrolase vs. UniProt/SwissProt
Match: sp|Q8MZR6|HYEP1_CTEFE (Juvenile hormone epoxide hydrolase 1 OS=Ctenocephalides felis OX=7515 GN=EH1 PE=1 SV=3)

HSP 1 Score: 330.487 bits (846), Expect = 2.560e-107
Identity = 186/428 (43.46%), Postives = 262/428 (61.21%), Query Frame = 2
Query:  122 PNVTLKEIWGYRDMNSS--SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNM--IEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESN--EKLLKIPINVPAGIALFPHEL-FRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIK 1384
            PN+ L   WG     +   S+    I + +  +ENLK++L +   +  L   NF YGFNTD L  ++DFW  QY WR  EA +NK+ H+ T I+GL IH++H+KP V  N +++P++++HGWPGSF EFYK+IP L       ++ FE+I PS+ GYG+S AA  PG     ++ IM  LMER+    K+Y+QGGD+G+MI + MS + P+ V G H NM  +  P  +     K  IGS  P S  F        +YP +E+       MGY  LQAT+P T+G+ L DSP+GLAAYI+EKF  WT N S+     DG L  +K +  E+L NVMIYY+T+SI++S+R Y E  ++++    L ++  +VPA  A FP+EL +    +LAE KY+ + Q   MPSGGHFAA EEP LL+EDI + +K
Sbjct:   30 PNIPLDTWWGPGKPQNVDISIRPFKININNKVIENLKLKLNDVQYTLPLEGINFEYGFNTDSLKKIVDFWRTQYNWREREALLNKYPHFKTNIQGLDIHYVHIKPQVSKNIEVLPLVMIHGWPGSFVEFYKIIPMLTTPRAGYNFVFELILPSIPGYGFSQAAAKPGLGSTQVAVIMRNLMERIGF-KKYYVQGGDWGSMIISAMSTLFPENVLGQHSNMCFVNTPSSNI----KAIIGSFFPES--FAGTGNAHKMYPMSEHFFTLLEEMGYLHLQATKPDTVGVALRDSPAGLAAYILEKFSTWT-NRSWRSVK-DGNL-LLKYNIPELLDNVMIYYVTDSITTSMRLYAESFTKAHLALNLDRVRNHVPAACAKFPNELAYVTDCQLAE-KYKTLLQSNDMPSGGHFAAFEEPGLLAEDIFTAVK 446          
BLAST of Epoxide hydrolase vs. UniProt/SwissProt
Match: sp|Q8MZR5|HYEP2_CTEFE (Juvenile hormone epoxide hydrolase 2 OS=Ctenocephalides felis OX=7515 GN=EH2 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.352e-105
Identity = 185/445 (41.57%), Postives = 268/445 (60.22%), Query Frame = 2
Query:  122 PNVTLKEIWGYRDMNS--SSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKL--LKIPINVPAGIALFPHEL-FRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLV------ENA*NMETRNL 1423
            PN+ L   WG        +S+    I + D  L  LK++L +   +  L   +F YGFNT+ L  L+DFW  QY WR  EA +NK+ H+ T I+GL IH++H+KP V  N  ++P++++HGWPGSF EFYK+IP L       ++ FE+I PS+ GYG+S AA  PG     ++ IM  LM+R+    K+Y+QGGD+G+ I + MS + P+ V G H N+    L       K ++GS+ P    F  K+ +  +YP +E+        GYF +QAT+P T+G+ L DSP+GLAAYI+EKF   T N ++  ++ DG L++ K +  E+L NVMIYY+T SI++S+R Y E  S  +  L   ++P  VP   A FPHE+ ++   +LAE KY+ + Q T MP GGHFAALEEP LL+EDI S +K        +++ N E R+L
Sbjct:   30 PNIPLDTWWGTGKSQKIDTSMRPFKIAINDEVLNTLKVKLSDVSFTPPLEGIDFQYGFNTNTLKKLVDFWRTQYNWREREALLNKYPHFKTNIQGLDIHYVHIKPQVSKNIHVLPMIMVHGWPGSFVEFYKIIPMLTTPRTDYNFVFELILPSIPGYGFSQAAAKPGLGATQIAVIMHNLMDRIGF-KKYYVQGGDWGSRIVSAMSTLFPENVLGHHSNLCF--LNTLSSNIKSFVGSLFPE--WFAGKQNVHKIYPLSEHFFTLLEESGYFHIQATKPDTVGVALRDSPAGLAAYILEKFSTGT-NKAWR-SAKDGNLQS-KFTFTELLDNVMIYYVTGSITTSMRIYAESYSWDHLSLNMDRVPTIVPTACAKFPHEIAYKTDFQLAE-KYKTLLQSTIMPRGGHFAALEEPLLLAEDIFSAVKKFIDHHSKKDSKNQENRDL 465          
BLAST of Epoxide hydrolase vs. UniProt/SwissProt
Match: sp|P04068|HYEP_RABIT (Epoxide hydrolase 1 OS=Oryctolagus cuniculus OX=9986 GN=EPHX1 PE=1 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 1.862e-103
Identity = 171/421 (40.62%), Postives = 255/421 (60.57%), Query Frame = 2
Query:  161 MNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKP-IVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPL--YDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            +   S+    ++  D  + +L  R+    ++  L +S F YGFN++YL  ++ +W +++ W+     +N + H+ T I+GL IHFIHVKP  V   +   P+L++HGWPGSFFEFYK+IP L +      ++++ FE+ICPS+ GYG+S A+   GF+  + + I + LM RL    +FYIQGGD+GA++   M+++ P  V G+H+NM  I    Y    L    IG +L       ++ ++++LYPF E +     R  GY  ++AT+P T+G  L+DSP GLAAYI+EKF  WT++    +   DGGLE  K S  ++LTN+MIY+ T SI SS R+YKE L +     K  ++ ++VP G A FP E+  +P K    KY  +  ++YMP GGHFAA EEPELL+ DI  F+ LVE 
Sbjct:   43 LEDESIRPFKVETSDEEINDLHQRIDRIRLTPPLENSRFHYGFNSNYLKKILSYWRHEFDWKKQVEILNSYPHFKTKIEGLDIHFIHVKPPQVPPGRTPKPLLMVHGWPGSFFEFYKIIPLLTDPKSHGLSDEHIFEVICPSIPGYGFSQASSKKGFNSVSTARIFYKLMLRLGF-QEFYIQGGDWGALVCTNMAQLVPSHVKGLHLNMALILRNHYTLTLLLGRRIGGLLG-----YTERDMELLYPFKEKVFYSLMRESGYMHIRATKPDTVGCALNDSPVGLAAYILEKFSTWTNSEFRDLE--DGGLER-KFSLQDLLTNIMIYWTTGSIVSSQRYYKENLGQGFMAHKHERLKVHVPTGFAAFPCEIMHVPEKWVRTKYPQLISYSYMPRGGHFAAFEEPELLARDICKFVGLVER 454          
BLAST of Epoxide hydrolase vs. UniProt/SwissProt
Match: sp|P79381|HYEP_PIG (Epoxide hydrolase 1 OS=Sus scrofa OX=9823 GN=EPHX1 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 2.012e-103
Identity = 168/417 (40.29%), Postives = 254/417 (60.91%), Query Frame = 2
Query:  170 SSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEI--PLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
             S+    ++  D  + +L  R++   ++  L DS F YGFN++YL  +I +W N + WR     +NK+ H+ T I+GL IHFIHVK P + S +   P+L++HGWPG F+EFYK+IP L +  +   ++++ FE+ICPS+ GYG+S+A+   GF+  A + I + LM RL    +FY+QGGD+G++I   M+++ P  V G+H+N+  +   +Y   F     +G +        ++ +L++LYPF +         GY  +Q+T+P T+G  L+DSP GLAAYI+EKF  WT+     +   DGGLE  K S DE+LT +M+Y+ T +I+SS RFYKE L +     K   I ++VP G A FP E+   P K  + KY  +  ++YM  GGHFAA EEPELL++DI  F+ L+E 
Sbjct:   46 ESIRPFKVETSDEEINDLHQRIEKFRLTPPLEDSRFHYGFNSNYLKKIISYWRNTFDWRKQVEVLNKYPHFKTKIEGLDIHFIHVKPPQLPSGRTAKPLLMVHGWPGCFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVAAARIFYKLMLRLGF-QEFYLQGGDWGSLICTNMAQLVPSHVKGLHLNVALVLRNVYTLTFFLGRRLGRLFG-----YTERDLELLYPFKKTFYTLMRESGYMHIQSTKPDTVGCALNDSPVGLAAYILEKFSTWTNEEFRDLE--DGGLER-KFSLDELLTVIMLYWTTGTITSSQRFYKENLGQGVMANKHEAIKVHVPTGFAAFPSEVLHCPEKWVKNKYPKLISYSYMARGGHFAAFEEPELLAQDIRKFMGLLEQ 453          
BLAST of Epoxide hydrolase vs. UniProt/SwissProt
Match: sp|P07099|HYEP_HUMAN (Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPHX1 PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.167e-101
Identity = 170/415 (40.96%), Postives = 258/415 (62.17%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVK-PIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESND---TEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR-MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            S+    ++  D  + +L  R+     +  L DS F YGFN++YL  +I +W N++ W+     +N++ H+ T I+GL IHFIHVK P + +     P+L++HGWPGSF+EFYK+IP L +  +   ++++ FE+ICPS+ GYG+S+A+   GF+  A + I + LM RL    +FYIQGGD+G++I   M+++ P  V G+H+NM  + L +F  LT + +G      +  L++ ++++LYP  E +     R  GY  +Q T+P T+G  L+DSP GLAAYI+EKF  WT+    ++   DGGLE  K S D++LTNVM+Y+ T +I SS RFYKE L +    +K  ++ + VP G + FP EL   P K    KY  +  ++YM  GGHFAA EEPELL++DI  F+ ++E 
Sbjct:   47 SIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGF-QEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALV-LSNFSTLT-LLLGQRFGRFLG-LTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLE--DGGLER-KFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLER 454          
BLAST of Epoxide hydrolase vs. TrEMBL
Match: G3NLB7 (Epoxide hydrolase OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 8.674e-119
Identity = 187/405 (46.17%), Postives = 268/405 (66.17%), Query Frame = 2
Query:  191 IKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTE-NLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKE-FLSESNEKL-LKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            ++  D  +E+L  R+     + SL D  F YGFN+ YL  ++ +W +++ W+   A +NK+ H+ T I+GL +H++HV+P  + NQ ++P++L+HGWPGSF+EFYK++P L E+ D    AFE+ICPS+ GYG+SDA    GFD  A + +   LMERL   S+FY+QGGD+G++I   MS++ P  V G+H+NMI++ +  F  +  + IGS LP  + F S+E++  L+PF E N+       GYF +QAT+P T G   +DSP GLAAYI+EKF  WT N +  +   DGGLE  K S D++LTNVMIY+ T SI SS+RFYKE F S  + ++  K+ I VP G+A FP EL   P+  A  +Y+NI  +T+MP GGHFAA EEP+LL+ DI+ F+K VE 
Sbjct:   71 VQTTDEEIEDLHERIDRTRYTESLEDGCFHYGFNSTYLKKVVSYWRHKFDWKKQVAALNKYPHFKTKIEGLDVHYVHVRPPRRENQTVVPLMLVHGWPGSFYEFYKILPLLTENRD--GLAFEVICPSIPGYGFSDAPRKQGFDSLAAARVFLTLMERLGF-SQFYLQGGDWGSLITTNMSQMKPMCVKGLHLNMIKVRM-GFSVMFSLMIGSYLPFLVGF-SREDVRRLFPFFEKNVYGILRETGYFHIQATKPDTAGCGGNDSPVGLAAYILEKFSTWTDNSNRALA--DGGLER-KFSLDDVLTNVMIYWTTGSIVSSMRFYKENFKSNPDNRVDAKVGITVPTGLAAFPAELMHCPKSWARHRYQNIYSYTFMPRGGHFAAFEEPQLLANDIVQFVKKVEK 467          
BLAST of Epoxide hydrolase vs. TrEMBL
Match: A0A1A7YPW9 (Epoxide hydrolase OS=Iconisemion striatum OX=60296 GN=EPHX1L PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.504e-118
Identity = 192/423 (45.39%), Postives = 271/423 (64.07%), Query Frame = 2
Query:  146 WGYRDMNSS---SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTE-NLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            WG  +   S   +V    +K  D  +++L  R+ +   S  L DS F YGFN+ YL  ++ +W N++ W+   A +NK+ H+ T I+GL +HFIHV+P  + +QK++P++L+HGWPGSF+EFYK++P L +S D    AFE+I PS+ GYG+S+A    GF+  A + I   LMERL   S+FY+QGGD+G++I   M+++ PD V G+H+NM  +    F+ L  + IG  LP  + F S+E++  L+PF E N+       GY  +QAT+P T G  L+DSP GLAAYI+EKF  WT   +  +   DGGLE  K S D++LTNVMIY+ T SI SS+RFYKE    + E  +  K  I VP G+A FP EL   PR  A+I+YRNI+ +T+M +GGHFAA EEP LL++DI  F+K VE 
Sbjct:   55 WGAGEKTLSEDHTVYPFTVKTSDEEIKDLHRRIDSFRFSDPLEDSGFNYGFNSTYLKKVVSYWRNEFDWKKQVAMLNKYSHFKTKIEGLDVHFIHVRPAARGDQKVLPLMLVHGWPGSFYEFYKILPLLTQSQD--GIAFEVIIPSIPGYGFSEAPHKQGFNSLAAARIFLTLMERLGF-SQFYLQGGDWGSLITTNMAQMKPDCVKGLHLNMC-LSTRGFKVLLSMIIGPYLPFLVGF-SREDVRRLFPFFEKNVWAMLRESGYLHIQATKPDTAGCGLNDSPVGLAAYILEKFSTWTKMKNRDLV--DGGLER-KFSLDDLLTNVMIYWTTGSIVSSMRFYKENFKTNPESRIDAKTGIFVPTGLAAFPQELLHFPRSWAQIRYRNIQSYTFMQAGGHFAAFEEPRLLADDIFQFVKKVEK 469          
BLAST of Epoxide hydrolase vs. TrEMBL
Match: A0A3Q3DD93 (Epoxide hydrolase OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 6.374e-118
Identity = 191/421 (45.37%), Postives = 273/421 (64.85%), Query Frame = 2
Query:  146 WGYRDMNSS---SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTE-NLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            WG  +   S   ++    ++  D  +++L+ RL     +  L DS F YGFN+ YL  +  +W +++ W+   A +NK+ H+ T I+G+ +HFIHV+P  + NQK++P++L+HGWPGSFFEFYK++P L ES+   D AFE+ICPS+ GYG+S+A    GF+  A + I   LMERL   S+FY+QGGD+GA+I   M+++ P  V G+H+NMI +    F+ L  + IG  LP  +  LS+E+   L+PF E N+       GY  +QAT+P +IG  ++DSP GLAAYI+EKF  WT   + H+   DGGLE  K S D++LTNVMIY+ T SI SS+RFYKE LS + +K +   I VP G+A FP EL   P+  A+I++ NI  +T MP GGHFAA EEP+LL+ D+I F++ VE 
Sbjct:   38 WGAGEKPQSEDDNIYSFEVQTSDDEIKDLQERLDKTRYTDPLEDSAFEYGFNSIYLKQVASYWRHEFDWKKQVAVLNKYPHFKTKIEGIDVHFIHVRPSQQKNQKVVPLMLVHGWPGSFFEFYKILPLLTESHT--DLAFEVICPSIPGYGFSEAPHKQGFNSLAAARIFLKLMERLGF-SEFYLQGGDWGALITTNMAQMKPQCVKGLHLNMI-LSRRGFKVLLSLLIGPYLPFLVG-LSREDARRLFPFFEKNVWTILRETGYMHIQATKPDSIGCGVNDSPVGLAAYILEKFSTWTDLENIHLE--DGGLER-KFSLDDLLTNVMIYWTTGSIVSSMRFYKENLSSNLDKRIDSRIFVPTGLAAFPGELMHCPKMWAQIRFHNIVSYTMMPRGGHFAAFEEPQLLASDLIQFVRKVER 450          
BLAST of Epoxide hydrolase vs. TrEMBL
Match: A0A1A8HHN7 (Epoxide hydrolase OS=Nothobranchius korthausae OX=1143690 GN=EPHX1L PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 7.068e-118
Identity = 187/405 (46.17%), Postives = 266/405 (65.68%), Query Frame = 2
Query:  191 IKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYP-FTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            +K  D  +++L  R+ +   S  L D  F YGFN+ YL  ++ +W N++ W+   A +NK+ H+ T I+GL +HFIHV+P V+ ++K++P++L+HGWPGSF+EFYK++P L +S D    AFE+I PS+ GYG+S+A    GFD  A++ I   LMERL   S+FY+QGGD+G++I   M+++ PD V G+H+NM  +    F+ L  + IG  LP  + F S+E++  L+P F +N+       GY  +QAT+P T G  L+DSP GLAAYI+EKF  WT   +  +   DGGLE  K S D++LTNVMIY+ T SI SS+RFYKE    + E  +  K  I VP G+A FP EL   P+  A+I+YRNI  +T+MP+GGHFAA EEP LL++DI  F+K VE 
Sbjct:   73 VKTSDEEIKDLHRRIDSFRFSDPLEDCGFNYGFNSTYLKKVVSYWRNEFDWKKQVAMLNKYSHFKTKIEGLDVHFIHVRPAVRGDRKVLPLMLVHGWPGSFYEFYKILPLLTQSQD--GVAFEVIIPSIPGYGFSEAPHKQGFDSLAVARIFLTLMERLGF-SQFYVQGGDWGSLITTNMAQMKPDCVKGLHLNMC-MSTRGFKVLLSMIIGPYLPFLVGF-SREDVRRLFPYFEKNVWEILRESGYLHIQATKPDTAGCGLNDSPVGLAAYILEKFSTWTKKTNRDLV--DGGLER-KFSLDDLLTNVMIYWTTGSIVSSMRFYKENFKTNPENRIDAKTGIFVPTGLAAFPQELMHCPKSWAQIRYRNIYSYTFMPAGGHFAAFEEPRLLADDIFQFVKKVEK 469          
BLAST of Epoxide hydrolase vs. TrEMBL
Match: A0A484CAS4 (EHN domain-containing protein OS=Perca flavescens OX=8167 GN=EPR50_G00176760 PE=4 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 7.651e-118
Identity = 190/405 (46.91%), Postives = 268/405 (66.17%), Query Frame = 2
Query:  191 IKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTE-NLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKE-FLSESNEKL-LKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            ++  D  +E+L  R+     +  L DS F YGFN+ YL  ++ +W +++ W+   A +NKF+H+ T I+GL +HFIHV+P  + NQKL+P++L+HGWPGSF+EFYK++P L E+ D    AFE+ICPS+ GYG+S++    GFD  A + I   LMERL   SKFY+QGGD+G++I   M+++ P  V G+H+NM  I    F+ +  + IG  LP  + F S+E++  L+PF E N+       GY  +QAT+P T G  ++DSP GLAAYI+EKF +WT   +  +   DGGLE  K S D++LTNVMIY+ T SI SS+RFYKE F S  + ++  K  I VP G+A FP EL   P+  A+I+YRNI  +T+MP GGHFAA EEP+LL+ DI+ F+K VE 
Sbjct:  111 VQTSDKEIEDLHERIDRTRFTDPLEDSCFQYGFNSTYLKKVVSYWRHEFDWKKQVAVLNKFQHFKTKIEGLDVHFIHVRPPHRENQKLLPLMLVHGWPGSFYEFYKILPLLTENQD--GVAFEVICPSIPGYGFSESPHKQGFDSLAAARIFLKLMERLGF-SKFYLQGGDWGSLITTNMAQMKPQYVKGLHLNMF-ISTKGFKVMFSLMIGPYLPFLVGF-SREDVRRLFPFFEKNVWDILRETGYMHIQATKPDTAGCGVNDSPVGLAAYILEKFSSWTDLRNRGLV--DGGLER-KFSLDDLLTNVMIYWTTGSIVSSMRFYKENFKSNPDNRVDAKTGIFVPTGLAAFPGELMHCPKTWAQIRYRNIYSYTFMPRGGHFAAFEEPQLLANDIVQFVKKVEE 507          
BLAST of Epoxide hydrolase vs. Ensembl Cavefish
Match: ephx5 (epoxide hydrolase 1-like [Source:NCBI gene;Acc:103024088])

HSP 1 Score: 347.436 bits (890), Expect = 8.003e-115
Identity = 175/411 (42.58%), Postives = 265/411 (64.48%), Query Frame = 2
Query:  173 SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTE-NLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            ++   V++  +  +++L  R+     + SL D+ F YGFN+ +L  +  +W +++ W      +NK+ H+ T I+GL +HFIHVKP+ ++ QK++P++L+HGWPGSFFEFYK+IP L +++   D+ FE+ICPS+ GYG+S+A+   GF   A + I   LM+RL  T  +YIQGGD+GA I   M+ I P+ V G+H+NM+       + +  + +G   P  + F ++E++  +YPF + N+       GY  +QAT+P T G  L+DSP GLAAYI+EKF +WT   + ++   DGGLE  K S D++LTN+MIY+ T SI  S+RFYKE +    +K++     ++VP G A FPHEL   P   A  ++R++R FTYMP GGHFAA EEPELL++D+  F+K VE+
Sbjct:   64 TIRPFVVETSEDVIQDLYERIDRMRYTDSLEDARFHYGFNSTHLKKVASYWRHEFDWGKQVKVLNKYPHFKTNIEGLDVHFIHVKPVQRAGQKVLPLMLVHGWPGSFFEFYKIIPMLTKTDG--DFVFEVICPSIPGYGYSEASQVQGFTAIAAARIFHKLMDRLEFTD-YYIQGGDWGAFITTIMALIKPECVRGLHLNMVNARAGGVKAVISLLLGRYFPFLVGF-TREDVCRMYPFMQKNVYELLRESGYMHIQATKPDTAGCGLNDSPVGLAAYILEKFSSWTDFKNRNLE--DGGLER-KYSLDDLLTNIMIYWTTGSIIPSMRFYKENMGYDFQKIMTNTTKVSVPTGFAAFPHELMHCPWVWASSRFRDLRSFTYMPRGGHFAAFEEPELLAQDVQQFVKKVES 467          
BLAST of Epoxide hydrolase vs. Ensembl Cavefish
Match: ephx1 (epoxide hydrolase 1 [Source:NCBI gene;Acc:103040834])

HSP 1 Score: 325.865 bits (834), Expect = 1.392e-106
Identity = 174/424 (41.04%), Postives = 253/424 (59.67%), Query Frame = 2
Query:  146 WGYRDMNSS----SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIH-FGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKE-FLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            WG   +  S    S+    ++     LE+L  R+      +SL DS F YGFN+ YL  ++ +W + + WR    K+NK+ H+ T I+G+ IH+IHVKP  +    K +P++++HGWPGSF+EFY ++P L E    +D AFE+ICPS+ GYG+S+A    GFD    + +   LM+RL   S+FYIQGGD+G +I   M+++ P  V G+HVN           +  + +G   P    F S+ ++  L+P  + L +      GY  +QAT+P T G  L+DSP GLAAYI+EKF  WT      +   DGGLE  K + D++LTNVMIY+ + SI SS+RFYKE F    ++   KIP+ VP G+A+FP+EL   P+   + KY  +  +T    GGHFAA+EEPEL+++DI  F+K+VE 
Sbjct:   34 WGVGSLLESPEDDSIRPFRVETTQQELEDLYRRIDQTRSFSSLEDSKFHYGFNSSYLQKVVSYWRSNFDWRKQVDKLNKYPHFKTKIEGIDIHYIHVKPKNLPEGSKAVPLMMVHGWPGSFYEFYGILPLLTEPASPDDIAFEVICPSIPGYGFSEAPHKKGFDSVCAARVFHKLMKRLGF-SQFYIQGGDWGWLITTNMAQLEPKIVKGLHVNFAPPAKPSLMVVLSMLLGRHFPKLFDF-SEHDIKRLFPCVQKLVVDAVKETGYMHIQATKPDTAGRGLNDSPVGLAAYILEKFSTWTDPEFVKLD--DGGLER-KFTLDDLLTNVMIYWTSGSIISSMRFYKENFGKGLDQPHSKIPVVVPTGVAIFPNELMHAPKLWVKQKYHKLVTYTLAARGGHFAAMEEPELMAQDIQKFVKIVER 452          
BLAST of Epoxide hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000004724.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000051.1:2432382:2441556:1 gene:ENSAMXG00000004619.2 transcript:ENSAMXT00000004724.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 300.056 bits (767), Expect = 2.130e-96
Identity = 172/434 (39.63%), Postives = 258/434 (59.45%), Query Frame = 2
Query:  125 NVTLKEIWGYRDMNSSS----VVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVK-SNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTE-NLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSY-HMTSFDGGLETM--KISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVE 1393
            ++ L + W  R+   +S    +    I+  D+ +++L  RL    +S  L +S F YGF++ YL  +I +W + + W+     +N++ H+ T I+GL +HF+H KP    S Q   P++LLHGWPGSF EFY ++P L  + D  D AFE+ICPS+ GYG+SDA    GFD  A + I   LMERL   SKFY+QGGD+G++IA  M+++ PD + G+H+NM  +   +   L  + +GS  PS + F S++++ +LYP+ + N+       GY  +QAT+P T G ++      L   +I+       + S+  +T   GG   +  K S D++LTNVMIY+ T SI SS+RFYKE    S  K +  +  ++VP G+A FP +L   P   A  KYRN+  ++YMP GGHFAALEEP+LL++DI  F+  VE
Sbjct:   43 SIPLGDGWWSRETRPASEDSRIHPFRIETSDTEIQDLHARLDRARLSPPLENSGFHYGFSSSYLQKVISYWRHNFDWQKQVNVLNRYPHFKTNIEGLNVHFVHCKPTGSLSGQSGKPLMLLHGWPGSFSEFYWMLPLLLANQD--DLAFEVICPSIPGYGYSDAPECEGFDTLAAARIFLKLMERLGF-SKFYLQGGDWGSIIATNMAQMKPD-LKGLHLNMFPVTNVNPVILVSLLLGSRFPSLVGF-SQKDVKLLYPYMQKNIFSMLKETGYLHIQATKPDTAGNLV------LLVQLIK-------SQSFIAVTDSSGGNRRVEVKFSLDDLLTNVMIYWTTGSIVSSMRFYKENFKGSLLKRVDARASVHVPTGLAAFPEDLVHCPPLWARQKYRNVVSYSYMPCGGHFAALEEPQLLADDIRQFVTKVE 458          
BLAST of Epoxide hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000051969.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000051.1:2436806:2442441:1 gene:ENSAMXG00000004619.2 transcript:ENSAMXT00000051969.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 8.262e-49
Identity = 101/261 (38.70%), Postives = 152/261 (58.24%), Query Frame = 2
Query:  626 FAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTE-NLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLA-AYIIEKFGAWTHNH-SYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLL--KIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVE 1393
             A + I   LMERL   SKFY+QGGD+G++IA  M+++ PD + G+H+NM  +   +   L  + +GS  PS + F S++++ +LYP+ + N+       GY  +QAT+P T G ++      +  ++I++           +H   F         S D++LTNVMIY+ T SI SS+RFYKE    S  K +  +  ++VP G+A FP +L   P   A  KYRN+  ++YMP GGHFAALEEP+LL++DI  F+  VE
Sbjct:    1 LAAARIFLKLMERLGF-SKFYLQGGDWGSIIATNMAQMKPDSLKGLHLNMFPVTNVNPVILVSLLLGSRFPSLVGF-SQKDVKLLYPYMQKNIFSMLKETGYLHIQATKPDTAGNLVLLLLHVVCFSFIVQPLNVLLMLFILFHFRKF---------SLDDLLTNVMIYWTTGSIVSSMRFYKENFKGSLLKRVDARASVHVPTGLAAFPEDLVHCPPLWARQKYRNVVSYSYMPCGGHFAALEEPQLLADDIRQFVTKVE 250          
BLAST of Epoxide hydrolase vs. Ensembl Cavefish
Match: ephx2 (epoxide hydrolase 2 [Source:NCBI gene;Acc:103037948])

HSP 1 Score: 55.8398 bits (133), Expect = 7.126e-8
Identity = 38/147 (25.85%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  365 NKFRHYFTTIK-GLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDI---MFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLY 793
             K  H + T+K G++IH++ +           P+LL HG+P S++ +   IP LA      D  F +I P + GYG  D++     + ++  +I   +   M++L + ++  + G D+G  +A  M++ +P+++    V  +  PL+
Sbjct:  202 EKVSHGYVTVKPGVKIHYVEMG-------DGPPVLLCHGFPESWYSWRYQIPALA------DAGFRVIAPDMKGYG--DSSAPADIEEYSQENIVKDLVTFMDKLGL-AQVTLFGHDWGGSVAWNMAQCHPERLRA--VASLNTPLF 330          
BLAST of Epoxide hydrolase vs. Ensembl Sea Lamprey
Match: ephx5 (epoxide hydrolase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-1050])

HSP 1 Score: 316.235 bits (809), Expect = 2.253e-103
Identity = 171/428 (39.95%), Postives = 253/428 (59.11%), Query Frame = 2
Query:  146 WGYRDMNSSSVVEIV--IKVPDS--TLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIK---GLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDT-EDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES--NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            WG  + + +   + V   KVP S  T+++++ RL +  ++  L  S F YGFN+ YL  ++ +W  ++ W    A +NK+  Y T I+   G+ +HF+HV+P+ V  + K   +L+ HGWPGSF+EFYK++P L E         FE+ICPS+ GY +S+A    GF+    + +   LMERL    K+Y+QGGD+G++I   M+ + P  V G+H+N   +     R L    +G  +P  +  L+  ++  ++P T+ L       GY  +Q T+P T+G+ LSDSP+GLAAYI+EKF  WT     +M   DGGLET+    DE+L  VMIY+++  I+SS+RFYKE  S +    K   +P+ VP G+A FP EL   PR     KYR+I  + YMP GGHFAA E+P LL+ED+ SF+K VE 
Sbjct:   40 WGKGEPSQTPADQTVRPFKVPYSPETMQDVRRRLASVRLAEPLEGSRFHYGFNSTYLQRVLKYWAEEFDWECTVAVLNKYPQYITNIEAYPGIDVHFVHVRPLGVPESTKPKVLLMTHGWPGSFYEFYKILPLLVEPQGPGATEVFEVICPSIPGYSFSEAPHKQGFNSLCAARLFCKLMERLG-HDKYYVQGGDWGSLIGTNMANMRPWCVKGLHLNFATVTGGLVRLLPSAVLGPWMPG-LFGLTPTDIKRVFPCTQLLKNVLLESGYMHIQGTKPDTVGVALSDSPAGLAAYILEKFSTWTKRE--NMDQEDGGLETL-FELDELLCMVMIYWVSGCITSSMRFYKENFSRNIFKSKDAHMPVWVPTGVAAFPSELVHTPRAWLASKYRSIVSYEYMPRGGHFAAFEQPLLLAEDVRSFVKKVEE 462          
BLAST of Epoxide hydrolase vs. Ensembl Nematostella
Match: EDO30223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E2])

HSP 1 Score: 318.546 bits (815), Expect = 1.134e-104
Identity = 167/401 (41.65%), Postives = 251/401 (62.59%), Query Frame = 2
Query:  227 IRLKNRIVSTSLLDS----NFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSI------HF-LSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            + L  R+  T   D+     + YG N +Y+ +L+ +W+ +Y W+  E+ +N   +Y+T I+GL++HF H+KP ++  Q++IPI+L+HGWPGS+FEFYK I  L +++    +A+EIICPS+ GYG+S+A   PGF+++A + +   LMERL   S +YIQGGD+G+MI   M++I P  V G+H+NM               IG + P  I      +F L  +E   ++P  +         GY  LQATRP T+G  L+DSP+GLA+YIIEKF  W+  H+         LE+ + +KDE+LTNVMIY++TNSI+SS+RFYKE    +++ +  I   VP G+A FP E+  +P+      + +I Q T MP GGHFAAL+EPELL++D++ F++ VE 
Sbjct:   30 VELWQRLTKTRFFDTLEGIEWQYGTNQEYMRSLVKYWMEEYDWQKQESLLNSEPNYYTEIEGLRVHFQHIKPDIQKGQEIIPIVLIHGWPGSYFEFYKAIKILKDASKKGPFAYEIICPSIPGYGFSEAPHKPGFNVYAAARVFHKLMERLGHKS-YYIQGGDWGSMIGRCMAQIAPSCVRGLHINM---------------IGMIAPRGIWSYILGYFTLPAKEHQKIFPLMDFYIYILRESGYMHLQATRPDTVGAGLNDSPAGLASYIIEKFSVWSGCHTNQSAQC---LES-RFTKDELLTNVMIYWLTNSITSSMRFYKENCLTAHD-VNAIQEVVPVGLADFPDEIIHLPQPWLSATFIDIIQHTEMPRGGHFAALQEPELLAQDVMEFVRKVET 409          
BLAST of Epoxide hydrolase vs. Ensembl Medaka
Match: ephx5 (epoxide hydrolase 1 [Source:NCBI gene;Acc:101166982])

HSP 1 Score: 347.051 bits (889), Expect = 1.231e-114
Identity = 183/423 (43.26%), Postives = 272/423 (64.30%), Query Frame = 2
Query:  146 WGYRDMNSS---SVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYP-FTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKE-FLSESNEKLLKIP-INVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            WG     +S   +V    I+  D  +++L  R+     +  L  S F YGFN+ YL  ++ +W N++ W+   A +N + H+ T I+GL +HF+ V+P   S Q+++P++L+HGWPGSF+EFY ++P L ++ D    AFE+I PS+ GYG+S+A+   G D  A++ I   LMERL   S+FY+QGGD+G++I   M+++ P+ V G+H+NM  +    F+ +  + IG  LP  +  L++E++  L+P F +N+       GY  +QAT+P T G  ++DSP GLAAYI+EKF  WT   +  +   DGGLE  K S D++LTNVMIY+ T SI SS+RFYKE F S+ N ++  +  I VP G+A FP+EL   P+  A+I+YRNI+ +T MPSGGHFAA EEP+LL++DII F+K VE 
Sbjct:   53 WGTGQKPASEDEAVHPFTIQASDREIQDLHDRIDRTRFAEPLEHSGFQYGFNSTYLRRVVSYWRNEFDWKKQVAVLNTYPHFKTKIEGLDVHFLRVRPSHASGQRVLPLMLVHGWPGSFYEFYGILPLLTKNQD--GVAFEVIIPSIPGYGFSEASHKQGLDSLAVARIFLKLMERLGF-SQFYVQGGDWGSLITTNMAQMKPECVKGLHLNMC-MSTRGFKIMLSLMIGPYLPFLVG-LTREDVRRLFPFFKKNVWEILKESGYMHIQATKPDTAGCGVNDSPVGLAAYILEKFSTWTDYKNRDLA--DGGLER-KYSLDDLLTNVMIYWTTGSIVSSMRFYKENFKSDPNSRIDGLTGIFVPTGVAAFPNELMHCPKSWAQIRYRNIQSYTLMPSGGHFAAFEEPQLLAKDIIQFVKKVEK 467          
BLAST of Epoxide hydrolase vs. Ensembl Medaka
Match: ephx1 (epoxide hydrolase 1 [Source:NCBI gene;Acc:101172051])

HSP 1 Score: 323.168 bits (827), Expect = 4.397e-105
Identity = 162/405 (40.00%), Postives = 250/405 (61.73%), Query Frame = 2
Query:  191 IKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPI-VKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIH-FGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSES-NEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVEN 1396
            ++  +  LE+L  R+       S+ DS F YGFN+ +L +++ +W   + WR     +N++ H+ T I+G+ +H++HVKP  V      +PI+L+HGWPGSF+EFY+LIP L E  + E+  FE++CPS+ GYG+S+A    GF+    +++   LM+RL   + F+  GGD+G  I   M++++P  V G+H++              + +G + P+   F ++ +  +LYP TE L +      GY  +QAT+P T G  L+DSP GLAAYI+EKF  WT+ +   +   DGGL T K S D++LTNVMIY+ +  I+SS+RFYKE   +  ++   +IP+NVP G A FP+++   P+   + KYRN+ ++T MP GGHFAA+EEP+L++EDI  F K VE 
Sbjct:   89 VRTSEEELEDLYSRMDRTRPVPSVEDSRFHYGFNSQHLQDVVSYWRKDFDWRRQVHGLNRYPHFRTRIEGIDVHYVHVKPRRVAEGAPALPIILVHGWPGSFYEFYRLIPLLTEPENPEEPVFEVVCPSIPGYGFSEAPHKRGFNSVCAANVFQKLMKRLGFQT-FFAHGGDWGWQITTNMAQLDPGSVRGLHLSFAPPSKPGLLVALSLMLGRLFPTLFGF-TEADRRLLYPCTEKLLLESMKESGYLHIQATKPDTAGRALNDSPVGLAAYILEKFSTWTNQNFRDLE--DGGL-TRKFSLDDLLTNVMIYWTSGCITSSMRFYKENFGKGLDQPHSRIPVNVPTGFACFPNDVMHSPKLWVKQKYRNLIRYTPMPRGGHFAAMEEPQLMAEDIQEFTKTVEK 488          
BLAST of Epoxide hydrolase vs. Planmine SMEST
Match: SMESG000002805.1 (SMESG000002805.1)

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 459/460 (99.78%), Postives = 460/460 (100.00%), Query Frame = 2
Query:   20 MQFWKGFVFISXXXXXXXXXXNTNDVGDLFLPDMPNVTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVENA 1399
            MQFWKGFVFISLLGLLLAFLLNTNDVGDLFLPDMPNVTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLID+WINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVENA
Sbjct:    1 MQFWKGFVFISLLGLLLAFLLNTNDVGDLFLPDMPNVTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDYWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVENA 460          
BLAST of Epoxide hydrolase vs. Planmine SMEST
Match: SMESG000002805.1 (SMESG000002805.1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 426/427 (99.77%), Postives = 427/427 (100.00%), Query Frame = 2
Query:  119 MPNVTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDFWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVENA 1399
            MPNVTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLID+WINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVENA
Sbjct:    1 MPNVTLKEIWGYRDMNSSSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLIDYWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILLLHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGFDIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHVNMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGRMGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGGLETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVPAGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDIISFIKLVENA 427          
The following BLAST results are available for this feature:
BLAST of Epoxide hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPHX12.430e-10240.96epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3... [more]
EPHX12.430e-10240.96epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3... [more]
EPHX12.430e-10240.96epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3... [more]
EPHX15.940e-2438.98epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3... [more]
EPHX13.798e-1435.96epoxide hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
W01A11.13.050e-9040.71Epoxide hydrolase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
C45B11.62.271e-4126.64Epoxide hydrolase [Source:UniProtKB/TrEMBL;Acc:A4... [more]
W01A11.16.154e-3939.33Epoxide hydrolase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Jheh13.936e-8638.97gene:FBgn0010053 transcript:FBtr0086625[more]
Jheh26.602e-8436.90gene:FBgn0034405 transcript:FBtr0345981[more]
Jheh26.602e-8436.90gene:FBgn0034405 transcript:FBtr0089970[more]
Jheh31.640e-8137.65gene:FBgn0034406 transcript:FBtr0086622[more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ephx17.563e-10841.12epoxide hydrolase 1, microsomal (xenobiotic) [Sour... [more]
ephx17.563e-10841.12epoxide hydrolase 1, microsomal (xenobiotic) [Sour... [more]
ephx52.968e-6546.51epoxide hydrolase 5 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
CABZ01087953.12.163e-3638.51pep chromosome:GRCz11:13:33688474:33690680:1 gene:... [more]
ephx22.070e-826.67epoxide hydrolase 2, cytoplasmic [Source:ZFIN;Acc:... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tbl1xr17.467e-10342.51transducin (beta)-like 1 X-linked receptor 1 [Sour... [more]
tbl1xr11.586e-7741.35transducin (beta)-like 1 X-linked receptor 1 [Sour... [more]
lyn2.413e-3544.93LYN proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ephx12.114e-10240.87epoxide hydrolase 1, microsomal [Source:MGI Symbol... [more]
Ephx11.241e-9740.10epoxide hydrolase 1, microsomal [Source:MGI Symbol... [more]
Ephx11.378e-6043.53epoxide hydrolase 1, microsomal [Source:MGI Symbol... [more]
Ephx14.718e-1335.63epoxide hydrolase 1, microsomal [Source:MGI Symbol... [more]
back to top
BLAST of Epoxide hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MZR6|HYEP1_CTEFE2.560e-10743.46Juvenile hormone epoxide hydrolase 1 OS=Ctenocepha... [more]
sp|Q8MZR5|HYEP2_CTEFE1.352e-10541.57Juvenile hormone epoxide hydrolase 2 OS=Ctenocepha... [more]
sp|P04068|HYEP_RABIT1.862e-10340.62Epoxide hydrolase 1 OS=Oryctolagus cuniculus OX=99... [more]
sp|P79381|HYEP_PIG2.012e-10340.29Epoxide hydrolase 1 OS=Sus scrofa OX=9823 GN=EPHX1... [more]
sp|P07099|HYEP_HUMAN1.167e-10140.96Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPH... [more]
back to top
BLAST of Epoxide hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3NLB78.674e-11946.17Epoxide hydrolase OS=Gasterosteus aculeatus OX=692... [more]
A0A1A7YPW91.504e-11845.39Epoxide hydrolase OS=Iconisemion striatum OX=60296... [more]
A0A3Q3DD936.374e-11845.37Epoxide hydrolase OS=Hippocampus comes OX=109280 P... [more]
A0A1A8HHN77.068e-11846.17Epoxide hydrolase OS=Nothobranchius korthausae OX=... [more]
A0A484CAS47.651e-11846.91EHN domain-containing protein OS=Perca flavescens ... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ephx58.003e-11542.58epoxide hydrolase 1-like [Source:NCBI gene;Acc:103... [more]
ephx11.392e-10641.04epoxide hydrolase 1 [Source:NCBI gene;Acc:10304083... [more]
ENSAMXT00000004724.22.130e-9639.63pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051969.18.262e-4938.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ephx27.126e-825.85epoxide hydrolase 2 [Source:NCBI gene;Acc:10303794... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ephx52.253e-10339.95epoxide hydrolase 5 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epoxide hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO302231.134e-10441.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epoxide hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ephx51.231e-11443.26epoxide hydrolase 1 [Source:NCBI gene;Acc:10116698... [more]
ephx14.397e-10540.00epoxide hydrolase 1 [Source:NCBI gene;Acc:10117205... [more]
back to top
BLAST of Epoxide hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000002805.10.000e+099.78SMESG000002805.1[more]
SMESG000002805.10.000e+099.77SMESG000002805.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014891 ID=SMED30014891|Name=Epoxide hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1486bp
ATTATTTGAGTAAATCAACATGCAATTTTGGAAAGGCTTTGTTTTCATAT
CTTTATTAGGATTACTTTTAGCATTTTTATTAAATACCAATGATGTTGGT
GATTTATTTCTACCCGATATGCCAAATGTAACCTTGAAAGAAATTTGGGG
TTATAGAGATATGAATTCTTCAAGTGTTGTTGAAATTGTTATTAAAGTTC
CTGACTCAACTTTGGAGAACCTGAAAATTCGTTTGAAAAACCGTATTGTT
TCAACGTCTTTGTTAGATTCAAATTTCCTATATGGATTTAACACAGATTA
TTTGAATAATTTAATCGATTTTTGGATAAATCAATATCAATGGCGAATTT
GGGAGGCAAAAATGAATAAATTTCGGCATTATTTTACAACAATAAAAGGC
TTGCAAATTCATTTTATTCATGTCAAACCAATTGTAAAATCAAATCAGAA
ACTTATTCCTATTCTCTTACTTCATGGGTGGCCAGGATCATTTTTTGAAT
TCTACAAATTAATACCGTTCTTAGCTGAGTCTAATGACACGGAAGATTAT
GCATTTGAAATAATCTGTCCATCTTTGGTTGGATATGGATGGTCAGATGC
AGCATTAACACCGGGTTTTGATATATTTGCAATGTCAGATATAATGTTTC
TATTGATGGAACGTTTGAACATTACAAGCAAATTCTACATTCAAGGTGGC
GATTTCGGAGCTATGATAGCAGCAGGAATGTCAAAAATAAATCCAGACAA
AGTTGCTGGAATTCATGTCAATATGATTGAGATTCCGTTATATGATTTTC
GATTTTTGACTAAAGTTTGGATTGGATCGATGTTGCCTTCCTCAATTCAT
TTCCTGTCAAAAGAAGAATTAGATGTGCTGTATCCGTTTACGGAAAATCT
TAACATTCACTTTGGCCGAATGGGTTATTTTTGGCTCCAAGCTACTCGAC
CGAGCACAATAGGAATTGTATTGTCCGACAGTCCAAGTGGATTAGCAGCG
TATATAATTGAAAAATTTGGAGCATGGACTCATAATCATTCTTATCATAT
GACTAGTTTTGATGGTGGCTTAGAAACGATGAAGATCTCCAAAGATGAAA
TGCTTACTAATGTCATGATTTACTACATCACAAATAGCATATCTTCATCT
GTCAGATTTTATAAAGAATTTCTGTCCGAATCAAATGAAAAGCTCCTGAA
GATTCCTATCAATGTGCCAGCTGGGATTGCGCTGTTTCCACATGAGCTTT
TTAGAATTCCAAGGAAATTGGCAGAAATAAAATATAGGAACATTCGCCAG
TTTACCTATATGCCAAGTGGGGGTCATTTTGCGGCTTTGGAGGAGCCTGA
ATTATTATCGGAGGATATTATTTCTTTCATTAAGCTTGTTGAAAATGCGT
GAAATATGGAAACACGTAATTTGTGAGGTGTCAATAGGATTTTTCTGAGT
AAATAATAAATTTATTTGACTTGGGTAACCCAAAAA
back to top

protein sequence of SMED30014891-orf-1

>SMED30014891-orf-1 ID=SMED30014891-orf-1|Name=SMED30014891-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MQFWKGFVFISLLGLLLAFLLNTNDVGDLFLPDMPNVTLKEIWGYRDMNS
SSVVEIVIKVPDSTLENLKIRLKNRIVSTSLLDSNFLYGFNTDYLNNLID
FWINQYQWRIWEAKMNKFRHYFTTIKGLQIHFIHVKPIVKSNQKLIPILL
LHGWPGSFFEFYKLIPFLAESNDTEDYAFEIICPSLVGYGWSDAALTPGF
DIFAMSDIMFLLMERLNITSKFYIQGGDFGAMIAAGMSKINPDKVAGIHV
NMIEIPLYDFRFLTKVWIGSMLPSSIHFLSKEELDVLYPFTENLNIHFGR
MGYFWLQATRPSTIGIVLSDSPSGLAAYIIEKFGAWTHNHSYHMTSFDGG
LETMKISKDEMLTNVMIYYITNSISSSVRFYKEFLSESNEKLLKIPINVP
AGIALFPHELFRIPRKLAEIKYRNIRQFTYMPSGGHFAALEEPELLSEDI
ISFIKLVENA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000639Epox_hydrolase-like
IPR016292Epoxide_hydrolase
IPR010497Epoxide_hydro_N
IPR029058AB_hydrolase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0033961cis-stilbene-oxide hydrolase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0019439aromatic compound catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000639Epoxide hydrolase-likePRINTSPR00412EPOXHYDRLASEcoord: 399..415
score: 24.33
coord: 178..193
score: 42.33
coord: 224..237
score: 38.31
coord: 431..453
score: 37.55
coord: 238..251
score: 26.95
coord: 152..170
score: 46.17
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 57..460
e-value: 2.9E-118
score: 397.0
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 52..455
IPR010497Epoxide hydrolase, N-terminalPFAMPF06441EHNcoord: 55..161
e-value: 1.0E-28
score: 99.8
IPR016292Epoxide hydrolasePIRSFPIRSF001112Epoxide_hydrocoord: 15..459
e-value: 1.5E-119
score: 397.0
NoneNo IPR availablePANTHERPTHR21661:SF35EPOXIDE HYDROLASEcoord: 41..458
NoneNo IPR availablePANTHERPTHR21661EPOXIDE HYDROLASE 1-RELATEDcoord: 41..458
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.888
NoneNo IPR availableTMHMMTMhelixcoord: 7..24