PiggyBac transposable element-derived protein 4

Overview
NamePiggyBac transposable element-derived protein 4
Smed IDSMED30014863
Length (bp)2272
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PiggyBac transposable element-derived protein 4 (SMED30014863) t-SNE clustered cells

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30014863) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PiggyBac transposable element-derived protein 4 (SMED30014863) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30014863) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014863

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014863 dd_Smed_v4_13954_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014863 dd_Smed_v4_13954_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014863 dd_Smed_v4_13954_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: PGBD4 (piggyBac transposable element derived 4 [Source:HGNC Symbol;Acc:HGNC:19401])

HSP 1 Score: 121.324 bits (303), Expect = 5.644e-28
Identity = 107/448 (23.88%), Postives = 198/448 (44.20%), Query Frame = 2
Query:  668 PGKHIDCS-----LDAFSLFFNYNIIYIIVKFTNLHGRTVLGK-----------NWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWD--PLFGCTIYRACMSKNRFAALSRHLRF--DDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGI----PYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTS--EVDNTNKNKSE---INLYYNSTKGGVDTLDQKCHAFSVKRKTRR-WPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIK--------------RRSVKHLPKSTIAT 1879
            PG+ +D S     L  F LFF   ++  I + TN     +  K            WK+TD  E+  +  +++  G+ ++   + + FW   PL      R  M+  RF  L R L F  +  +S    + Q     I+ ++D +       Y P  N+ +DE L+ F+G +  +QY+P+K  ++G+K++ +C+S++ Y    +    P +  + +   +  +R IV  L          +  DN+  S  L   L       VGT R N++ IP +      + +       R    L++      + V +LST H+ +  EV+N N  K++   + + YN   G VD+ DQ   ++  +RK  + W    F++L+ +  + + I++K   P+   + +N R  + ++ ++++   P  +              R S +H PKS  AT
Sbjct:   92 PGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKDTDNDELKVFFAVMLLQGIVQKP--ELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKSSR-IVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDL----KKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTMSHINFRLAL-IERMLEKHHKPGQQHLRGRPCSDDVTPLRLSGRHFPKSIPAT 531          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: PGBD2 (piggyBac transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:19399])

HSP 1 Score: 72.4034 bits (176), Expect = 1.824e-12
Identity = 105/460 (22.83%), Postives = 181/460 (39.35%), Query Frame = 2
Query:  701 FSLFFNYNIIYIIVKFTNLHGRTVLGKNWK-ETDQMEILAYIGLLIDAGLKKQGLFDYDE---FWD--PLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQ--EQAGRAVNLARTIVEQLCEPFERTN---RNITFDNYFTSYELANSLLSKGLTCVGTLR--KNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVV-------------LSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQC 2002
            F LFF+   I  IV  TN   R    KN        E+   +G+LI +G        Y     FW+  P     +    + ++RF  +  +L F D     A    DRFA +R +   +N N +K+    E  +  E +  + G    +Q    KP + G KIW    S+  Y ++  P  G    +  R+++L  ++V +  +  +       +I FD  FTS +L + L  KG+   GT+R  + +RC  ++  P   ++++   F ++   +    V + + + VV             L++ H  +    T  ++  +   Y    GGV  +DQ    + VK +  +W  +    ++D     A  + +    D     +  RR I    L       +  RRS +             LE  S   +I   +   + R RC LC S      ++C
Sbjct:  145 FELFFDEGTINFIVNETN---RYAWQKNVNLSLTAQELKCVLGILILSGY-----ISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDA---SDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTSR-GYLVWFEPSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKD--PKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLHRICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRR-------------LETESRFDMIGHWIIHQDKRTRCALCHSQTNTRCEKC 577          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 68.9366 bits (167), Expect = 2.284e-11
Identity = 66/250 (26.40%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  695 DAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAG---LKKQGLFDYDEFWDPLFGC--TIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ-DRFAPIRDIWDLVNKNLRKYYIPGEN-LTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKT-SYPLFGIPYLGQ------EQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKN 1402
            +   LF +  +I +IVK++NL+  +  G +   T   E   ++G++  +G   + ++ +F     W+        +  A M ++RF  +  +L   D    +A  D  D+F+ +R +   +N+   K+ +P E   + DE +VP+ GR   +Q++  KP ++G K W  C +    Y  +  PY G+      E+ G   +L     E L E       +  F+N+FTS  L + L S G    GT+RK+
Sbjct:  144 EILELFLDDEVIELIVKYSNLYACSK-GVHLGLTSS-EFKCFLGIIFLSGYVSVPRRRMF-----WEQRTDVHNVLVSAAMRRDRFETIFSNLHVAD----NANLDPVDKFSKLRPLISKLNERCMKF-VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW--CGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEA-HPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKD 378          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 67.3958 bits (163), Expect = 9.044e-11
Identity = 66/245 (26.94%), Postives = 114/245 (46.53%), Query Frame = 2
Query:  701 FSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGC--TIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ-DRFAPIRDIWDLVNKNLRKYYIPGEN-LTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKT-SYPLFGIPYLGQ------EQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKN 1402
              LF +  +I +IVK++NL+  +  G +   T   E   ++G++  +G     +     FW+        +  A M ++RF  +  +L   D    +A  D  D+F+ +R +   +N+   K+ +P E   + DE +VP+ GR   +Q++  KP ++G K W  C +    Y  +  PY G+      E+ G   +L     E L E       +  F+N+FTS  L + L S G    GT+RK+
Sbjct:  614 LELFLDDEVIELIVKYSNLYACSK-GVHLGLTSS-EFKCFLGIIFLSGYV--SVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVAD----NANLDPVDKFSKLRPLISKLNERCMKF-VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW--CGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHP-GQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKD 846          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 67.3958 bits (163), Expect = 9.044e-11
Identity = 66/245 (26.94%), Postives = 114/245 (46.53%), Query Frame = 2
Query:  701 FSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGC--TIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ-DRFAPIRDIWDLVNKNLRKYYIPGEN-LTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKT-SYPLFGIPYLGQ------EQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKN 1402
              LF +  +I +IVK++NL+  +  G +   T   E   ++G++  +G     +     FW+        +  A M ++RF  +  +L   D    +A  D  D+F+ +R +   +N+   K+ +P E   + DE +VP+ GR   +Q++  KP ++G K W  C +    Y  +  PY G+      E+ G   +L     E L E       +  F+N+FTS  L + L S G    GT+RK+
Sbjct:  614 LELFLDDEVIELIVKYSNLYACSK-GVHLGLTSS-EFKCFLGIIFLSGYV--SVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVAD----NANLDPVDKFSKLRPLISKLNERCMKF-VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW--CGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHP-GQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKD 846          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Fly
Match: CG13151 (gene:FBgn0033750 transcript:FBtr0087939)

HSP 1 Score: 61.2326 bits (147), Expect = 2.614e-9
Identity = 105/492 (21.34%), Postives = 171/492 (34.76%), Query Frame = 2
Query:  668 PGKHIDCSLDAFSLFFNYNIIYIIVKFTN--LHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFD--YDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTRE--VESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYP--DWNKTKMNSRRKIFL-----------------KNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNI---------RRRCYLCPSAK-GRASKQCCGNCGKNVCNEH 2038
            P + +  +++A+ L F+  ++  +++  N  +  R       +  D +E+ A++GL    G+ +    +   DE W    G  I+RA MS  RF ++S  L  +   S   +           +W  +  N R YY     LT+DE    F    K R  +              CD++T Y       +      R        VEQL   F+ T RN+T  + + +      L  + ++ +G L  N         PH  R+   ES +FG    +     +P    AV           V    +       +Y  ++          HA     K +  P  Q  + V         I   L P  D    + + +R++ L                  +LV  L I  I  +S + L     AT    L +S  ++  DK      I          RRC  C   K G  S+  C  C ++ C  H
Sbjct:  140 PARTVSNAVEAWMLLFDDEMLRSLLRHINEQMRKRRTATSVQRPLDVVELRAFLGLSYLCGVFRNARHNGPLDELWTLELGNAIFRASMSLARFESISECLAGNCGWSEGQK-----------LWQRLIINCRSYYGCSSWLTVDET---FCAVAKSRMTL-------------CCDARTLY-------MANAVVSRNQRCPDKDVEQLICDFKTTGRNVTLGSRYLNLTQCEQLAQRQISSLGKLEANS--------PHWPRQWPTESPLFGGSSKL-----IPLDGDAVFCCGLSSQVDAVQAYEQTSEACQQFYEHSQRFSTA-----HATPAPLKKQINPFLQLLHFVLNAAAVNAWILLRLSPKGDAAMDQRDFQRQLGLFLTQQRLQRRLQRRSTSTSLVMRLQICEILGQSSQRLLSE--ATGEAKLTHSVGVLTPDKMSLPLGINLASRYGEKHRRCKPCARNKRGTKSRTRCQQCLQHRCGNH 577          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: CABZ01072083.2 (dual specificity phosphatase 26 [Source:NCBI gene;Acc:570815])

HSP 1 Score: 293.508 bits (750), Expect = 2.148e-89
Identity = 179/519 (34.49%), Postives = 270/519 (52.02%), Query Frame = 2
Query:  560 SYIGKDG-TEWNSVPYIKGRTAAHNIIRGGINKVVLPPGKHIDCS-----LDAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRA-VNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRS-VKHLPKSTIATINETLENSSNIVVIDKSVPETN--IRRRCYLC----PSAKGRASKQ--CCGNCGKNVCNEHSQKIVVCKTC 2068
            +Y+ K G   W+  P   G    H      + + + P      CS        F LFF   I  ++++ +NL G+ V G  WK+ D  ++ A+IG+LI  G+ +      D  WD + G  I+RA M+   F + SR + F        ++  D+ API ++WD   + L   Y PG+NLT+D+ LVPFRGR  F+ YM  KP KYG++IW +CDSK+SY      + G+   G+A  + A  +V  +    E    NIT D  FTSY L   LL + +T +GT R +   +P   L  + R + S+ F F  T TLVSY P+KN+ V+V+ST+H     ++  ++K ++ L YNST+GGVD  D+    ++ +RKT  WP+  F+N++DV    A ++W +L P W   K N RR+IFL++L + LV P+++RR  +  LP S    IN  +E  S    I + +P      R+RC  C       K R +K    C  C   +C  H+    +C  C
Sbjct:   80 AYMSKTGHVLWSPTPPPSG----HKRFPSHLFENMTPGPTSFACSNAQDIKSTFELFFPDEIKEMLMQISNLEGKRVYGAAWKDLDWTDLQAFIGILILIGVYRSKHESVDSLWDGVLGRPIFRATMALYTFKSWSRVICFRKRDPEPGQKSGDKLAPILNVWDKWVERLPLMYNPGQNLTVDKCLVPFRGRCPFKIYMQCKPAKYGIQIWAVCDSKSSYAWNMQIHTGKPADGKAEEDQAMRVVLDMTSALE--GHNITCDQSFTSYALGEELLRRNITMIGTTRLSNPELPPALLSVKGRAINSSKFAFTDTHTLVSYHPRKNKNVLVMSTLHRDDAENSDEQSKPQMILDYNSTRGGVDNFDKLTSTYTCQRKTLHWPMVIFFNMLDVSAYNAFVLWMDLNPSWEAQKTN-RRRIFLQDLGRALVTPHLQRRERLPRLPNS----INMIVEAQSAPEDIQRCIPPVTDPKRKRCEPCNRSTNGGKRRDTKTRLTCDKCNMYICKAHAVITTLCYRC 587          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 130.568 bits (327), Expect = 6.530e-31
Identity = 121/470 (25.74%), Postives = 201/470 (42.77%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHG---RTVLGKNWKETDQMEILAYIGLLIDAGLKKQ-GLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ------DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEIN--------------LYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVC 2029
            L  F LFF  +++  I++ +N +    R    K+WK     ++ +Y+ L+I  GL K   L DY    D ++   +    MS  +F  ++  L   D +   A   +      DR   I+ ++D +    R +Y PG+N++IDE++V  + R   +QYM +KP K+G K++ + DS+  Y      Y G+  +        +++  + E +  T   +  DN++TS +L   LLSK +   GT+R N+   P+       ++       + R   L+    K  R V++ ST H     D   +   + +              L YN   GGVD  D     + V  KTR+W    FY+ VD+  V A I+ + L     K +    +K F + LV EL        +      S I T +    N   I     S   T+ RR+C +C     + +   C  C   +C
Sbjct:  222 LQLFQLFFTPSVLQTIMQHSNAYATKQRQGTDKSWKNISVEDLKSYLALVIFMGLLKVCALTDYWRRSD-VYSVPLPTRIMSCRKFLNIANALHLSDPVDDEANEGRKGTAAYDRLGKIKPLYDNIRDACRAFYHPGQNISIDERMVASKARSGLKQYMKNKPTKWGYKLFVLADSQCGYTSEFFVYEGKRMSSPNGLSYESVMALIDEKYLGTGYKLYVDNFYTSPKLFRDLLSKRIYACGTIRPNRIGFPKMATNKLPQDAPRGSMRWIREDDLLFVEWKDTREVLMCSTFHKAYGGDIVERKSKDNDGQWSTVHVPIPGAVLDYNRFMGGVDLSDALICYYKVLHKTRKWYRTFFYHFVDIAVVNAFILHQKLA--RAKKERPLTQKAFRETLVMEL--------AGLESGASPIPTPSTICHNPKYI-----SGDSTSGRRKCRVC----HQKTPVMCATCEVPLC 671          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: si:ch211-130m23.5 (si:ch211-130m23.5 [Source:ZFIN;Acc:ZDB-GENE-131121-298])

HSP 1 Score: 129.798 bits (325), Expect = 9.092e-31
Identity = 110/410 (26.83%), Postives = 181/410 (44.15%), Query Frame = 2
Query:  689 SLDAFSLFFNYNIIYIIVKFTN---LHGRTVLGK---NWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFW--DPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRD--QDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRA-VNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTS---------EVDNTNKNKSEI---------NLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSR---RKIFLKNLVQELV 1822
            +LD F L F  ++   +V+ TN   L+ +   G+   +W  TD  E+ AY+GL I  G+ +  L DY  +W  D   G   ++  M+  RF  L++HL   D  S  ++ +   D    IR + D+V   +   Y+P   LTIDE  V  +GR    QYMPSKP + G+K+W +CDS++ Y      Y+G+     A   L   +V  L    E  + +I  D++FTS  L   LL +G    G    +++  P    P    ++    F   +   LV+ V +  + V  LS+              +VD ++ +   +          L Y     GVD  DQ    + V R  ++W     +  V++C V A ++++           N +   ++ F   L Q+L+
Sbjct:  193 TLDYFRLLFPDSLFKHMVEQTNNYALYRQRRSGRSDAHWHPTDIREMRAYVGLNILMGINQ--LPDYGMYWASDIFIGNAGFKKTMTARRFEKLNQHLHLCDRESEPSKGELGYDGLYKIRPLLDMVGNTMWDAYLPNRCLTIDECSVASKGRFSPTQYMPSKPFRKGLKVWMMCDSRSGYCHRTRIYVGKPSDDLATAALGHKVVSSLVRGLEGRHHHIFIDSFFTSVPLLQHLLHQGFYACGPTNPSRQGYPDALKPRNVGKLAPGEFYQCQHGNLVATVTRDAKIVSCLSSNSAPGIVGISPGKRDVDASDGDCGLVGLGLPRPLPLLLYQENMRGVDLCDQLRECYQVGRPCKKWWRYFLWFYVNLCIVNAYVVFRESRGGSPPAGFNGKQFTQRHFRIRLAQQLI 600          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 124.79 bits (312), Expect = 2.336e-29
Identity = 111/440 (25.23%), Postives = 195/440 (44.32%), Query Frame = 2
Query:  701 FSLFFNYNIIYIIVKFTNLHGRTVLGKN----WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFW--DPLFGCTIYRACMSKNRFAALSRHLRF---DDLLSRSARR---DQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEP-FERTNRNITFDNYFTSYELANSLLSKGLTCVGTL---RKNKRCIPQNFLPHRT-----REVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEIN---------------LYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELV-IP---NIKRRSVKHLPKSTIATINETLEN 1900
            F  FF+   + +I   TN++    L K     W++      L YIGLLI   L K  L    ++W  D         + M+++RF A+SR +     DD +    ++   D D    ++ ++  +    +  + P + + IDE++V  + ++  +QYM +KP K+G+K++ + DS   Y      Y G+ +   +  L   +V  L +P F     ++  DN++TS +L   L + G    GT    RKN R   QN L  R+     R +  N   F + M          R V V ST+H   + D   +N  +                 + YN   GGVD  DQ    +SV +++ RW     Y+ +D+    + I+ K +        M+  +  F++ L +EL  +P   ++  R  + LP+S +A+++E  ++
Sbjct:  131 FRQFFSVTTVRVICCNTNINAEKELSKGKKLAWEKLTSDTFLKYIGLLIYMALLK--LPRVRDYWRRDSHLSVHFPVSVMTRDRFMAISRTVHLSNPDDDIENDRKKGTPDYDPLYRLKPLYITIKDTCKSMWQPRKQIAIDERMVATKAKIALKQYMKAKPIKWGVKLFVLADSSNGYTSDFTIYTGKSRFTSSQGLPYDVVSNLIDPSFLGRGYHLYVDNFYTSPKLFRDLYASGFVACGTFKDSRKNVRETKQNALTSRSPRGSIRWIRQNKLLFVKWM--------DTREVSVCSTIHKAFDGDTVTRNVHDKETGSWQIKNIASPRCVVDYNKYMGGVDLSDQLLQYYSVHKRSNRWYRTLLYHFIDIAATNSYILHKEMCLAAQTVAMSHGQ--FMEELSRELCGVPKGSDVAPRGAQCLPES-LASVDEETDS 557          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 111.694 bits (278), Expect = 4.642e-25
Identity = 119/475 (25.05%), Postives = 205/475 (43.16%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHG---RTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFW--DPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAP-------IRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFER---TNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKN-KSEINLY-------------YNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVC 2029
            L  F LFF+  ++  IV  +N+ G        + WK+    ++ ++I ++I  G+ K   F+  ++W    ++        MS+ +F  +S  L   D     A  D+ R  P       I+ ++  +    +  + P +N++IDE++V  + R    QY+ S+P K+G K++ + DS  +Y      Y G+ +  +   ++   V  L +  ER   T   +  DN++TS  L   LLSK +   GT+R N+       + H   E       + R   L+    K  R V++ ST H     D   +N K + +++             YN   GGVD  D     ++V  KT++W  + FY+ VD+  V A I+ + +    N+  M   +K+F + LV EL    I+       P +  A I  T  +    +  D     T  RR+C LC       +   C  C  ++C
Sbjct:  155 LQYFELFFSQPVMQKIVDHSNIFGAMRHEARKRKWKDITVADLKSFIAMVIYMGIVK--CFNLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDP-KVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQNISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEGKVKTEQRKGISYDSVMALID--ERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNR-------INHTETEAPRGNIRWFREDGLLFVEWKDKRDVLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKHMGGVDVSDALIGYYTVLHKTKKWYRSFFYHFVDIAVVNAFILHQQMAKSKNQKAMT--QKVFRETLVAELA--GIR----AGYPPAREAAIASTDNHLPKYIKGD----STFGRRKCKLC----THKTPITCVTCQVHLC 600          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: npffr2 (neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-GENE-994428])

HSP 1 Score: 219.164 bits (557), Expect = 1.518e-63
Identity = 141/398 (35.43%), Postives = 203/398 (51.01%), Query Frame = 2
Query:  881 WDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQA-GRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVCNE-HSQKIVVCKTC 2068
            W   F   + +  M ++RF ++ +HLRFDD  +R+ R   D+FA I DI    NKN  + + PGE++TIDEQL P + R  F QY+ +KPDK+G+K W   D +T Y     PYLG++ +  +   LA  +V  L EPF    RN+T DN+FTS  L++ LL    T +GT+ K +R +PQ       REV S       +++L  Y PKKN  V VL++MH    + +  K K      YN  K GVD LDQ    +SV+  TRRWP+A +YN++D+  V A I++K        T    +R++FL  L +EL     + R ++H          E L         + +VP T    +C +  S     S+  C  C K  C +       VCK C
Sbjct:   23 WSENFLVPVIKETMPRDRFISIMQHLRFDDKDTRAERVKTDKFAAISDIRTRFNKNCAESFTPGEHMTIDEQLFPTKVRCPFTQYVATKPDKFGIKFWMARDLETKYVCNASPYLGKDPSRQKGERLAENVVMNLMEPFLDEGRNVTTDNFFTS--LSHRLLQHKTTLLGTVNKVRRELPQLAKDTAQREVFSTSVLRSGSVSLTIYAPKKNLTVCVLNSMHQDVTIGDNRKRKPNTITDYNHMKCGVDVLDQMARMYSVRAATRRWPVAVYYNMLDLAAVNAYILYKAC------TGWTGKRRLFLSLLAKEL-----RCRFMQH---------KEILARRQ---AAEAAVPGTVQTTQCQVQESCNRNHSRFICTTCQKFTCAKCRDDGHWVCKRC 395          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000026678.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:88624292:88625603:1 gene:ENSXETG00000013495.1 transcript:ENSXETT00000026678.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 6.322e-39
Identity = 103/367 (28.07%), Postives = 180/367 (49.05%), Query Frame = 2
Query:  668 PGKHIDCS----LDAFSLFFNYNIIYIIVKFTNLHGRTVLGKN----------WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDP--LFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ--DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQ----AGRAVNLART--IVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEV------DNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRW 1678
            PG  +D +    +D F+L+    I+  +V++TNL+    L  N          W  T+  EI  ++ L +  GL ++       +WD   +    ++ A M +NR+  L R L F+D  +  A  +   DR   +R + D +++   + Y P +N+ +DE L+ F+GR+KFRQY+PSK  +YGMK + +C+S T Y  + + Y G++      G   +L  +  IV +L  P      ++  DN++TS  L  +L S      GT+ +N++ +P+  L  + +  E +     R+  L++      + V +L+T+H  + +         +K K   +  Y+   GGVD  DQ  H ++  RKTR W
Sbjct:   36 PGLSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERN--SLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHAL---RSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAW 397          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: wdtc1 (WD and tetratricopeptide repeats 1 [Source:Xenbase;Acc:XB-GENE-977179])

HSP 1 Score: 150.984 bits (380), Expect = 1.873e-38
Identity = 103/367 (28.07%), Postives = 180/367 (49.05%), Query Frame = 2
Query:  668 PGKHIDCS----LDAFSLFFNYNIIYIIVKFTNLHGRTVLGKN----------WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDP--LFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ--DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQ----AGRAVNLART--IVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEV------DNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRW 1678
            PG  +D +    +D F+L+    I+  +V++TNL+    L  N          W  T+  EI  ++ L +  GL ++       +WD   +    ++ A M +NR+  L R L F+D  +  A  +   DR   +R + D +++   + Y P +N+ +DE L+ F+GR+KFRQY+PSK  +YGMK + +C+S T Y  + + Y G++      G   +L  +  IV +L  P      ++  DN++TS  L  +L S      GT+ +N++ +P+  L  + +  E +     R+  L++      + V +L+T+H  + +         +K K   +  Y+   GGVD  DQ  H ++  RKTR W
Sbjct:  109 PGLSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLA--SYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHAL---RSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAW 470          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000039775.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:120141819:120143298:1 gene:ENSXETG00000001091.1 transcript:ENSXETT00000039775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 2.005e-38
Identity = 103/367 (28.07%), Postives = 180/367 (49.05%), Query Frame = 2
Query:  668 PGKHIDCS----LDAFSLFFNYNIIYIIVKFTNLHGRTVLGKN----------WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDP--LFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ--DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQ----AGRAVNLART--IVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEV------DNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRW 1678
            PG  +D +    +D F+L+    I+  +V++TNL+    L  N          W  T+  EI  ++ L +  GL ++       +WD   +    ++ A M +NR+  L R L F+D  +  A  +   DR   +R + D +++   + Y P +N+ +DE L+ F+GR+KFRQY+PSK  +YGMK + +C+S T Y  + + Y G++      G   +L  +  IV +L  P      ++  DN++TS  L  +L S      GT+ +N++ +P+  L  + +  E +     R+  L++      + V +L+T+H  + +         +K K   +  Y+   GGVD  DQ  H ++  RKTR W
Sbjct:  109 PGLSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLA--SYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHAL---RSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAW 470          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000042747.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:94706384:94707791:-1 gene:ENSXETG00000002351.1 transcript:ENSXETT00000042747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 2.180e-38
Identity = 103/367 (28.07%), Postives = 180/367 (49.05%), Query Frame = 2
Query:  668 PGKHIDCS----LDAFSLFFNYNIIYIIVKFTNLHGRTVLGKN----------WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDP--LFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ--DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQ----AGRAVNLART--IVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEV------DNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRW 1678
            PG  +D +    +D F+L+    I+  +V++TNL+    L  N          W  T+  EI  ++ L +  GL ++       +WD   +    ++ A M +NR+  L R L F+D  +  A  +   DR   +R + D +++   + Y P +N+ +DE L+ F+GR+KFRQY+PSK  +YGMK + +C+S T Y  + + Y G++      G   +L  +  IV +L  P      ++  DN++TS  L  +L S      GT+ +N++ +P+  L  + +  E +     R+  L++      + V +L+T+H  + +         +K K   +  Y+   GGVD  DQ  H ++  RKTR W
Sbjct:   94 PGISVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLA--SYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHAL---RSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAW 455          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 2.711e-27
Identity = 107/448 (23.88%), Postives = 198/448 (44.20%), Query Frame = 2
Query:  668 PGKHIDCS-----LDAFSLFFNYNIIYIIVKFTNLHGRTVLGK-----------NWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWD--PLFGCTIYRACMSKNRFAALSRHLRF--DDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGI----PYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTS--EVDNTNKNKSE---INLYYNSTKGGVDTLDQKCHAFSVKRKTRR-WPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIK--------------RRSVKHLPKSTIAT 1879
            PG+ +D S     L  F LFF   ++  I + TN     +  K            WK+TD  E+  +  +++  G+ ++   + + FW   PL      R  M+  RF  L R L F  +  +S    + Q     I+ ++D +       Y P  N+ +DE L+ F+G +  +QY+P+K  ++G+K++ +C+S++ Y    +    P +  + +   +  +R IV  L          +  DN+  S  L   L       VGT R N++ IP +      + +       R    L++      + V +LST H+ +  EV+N N  K++   + + YN   G VD+ DQ   ++  +RK  + W    F++L+ +  + + I++K   P+   + +N R  + ++ ++++   P  +              R S +H PKS  AT
Sbjct:   92 PGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKDTDNDELKVFFAVMLLQGIVQKP--ELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKSSR-IVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDL----KKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTMSHINFRLAL-IERMLEKHHKPGQQHLRGRPCSDDVTPLRLSGRHFPKSIPAT 531          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q6P3X8|PGBD2_HUMAN (PiggyBac transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=PGBD2 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.760e-12
Identity = 105/460 (22.83%), Postives = 181/460 (39.35%), Query Frame = 2
Query:  701 FSLFFNYNIIYIIVKFTNLHGRTVLGKNWK-ETDQMEILAYIGLLIDAGLKKQGLFDYDE---FWD--PLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQ--EQAGRAVNLARTIVEQLCEPFERTN---RNITFDNYFTSYELANSLLSKGLTCVGTLR--KNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVV-------------LSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQC 2002
            F LFF+   I  IV  TN   R    KN        E+   +G+LI +G        Y     FW+  P     +    + ++RF  +  +L F D     A    DRFA +R +   +N N +K+    E  +  E +  + G    +Q    KP + G KIW    S+  Y ++  P  G    +  R+++L  ++V +  +  +       +I FD  FTS +L + L  KG+   GT+R  + +RC  ++  P   ++++   F ++   +    V + + + VV             L++ H  +    T  ++  +   Y    GGV  +DQ    + VK +  +W  +    ++D     A  + +    D     +  RR I    L       +  RRS +             LE  S   +I   +   + R RC LC S      ++C
Sbjct:  145 FELFFDEGTINFIVNETN---RYAWQKNVNLSLTAQELKCVLGILILSGY-----ISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDA---SDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTSR-GYLVWFEPSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKD--PKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLHRICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRR-------------LETESRFDMIGHWIIHQDKRTRCALCHSQTNTRCEKC 577          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q8N328|PGBD3_HUMAN (PiggyBac transposable element-derived protein 3 OS=Homo sapiens OX=9606 GN=PGBD3 PE=1 SV=3)

HSP 1 Score: 68.9366 bits (167), Expect = 1.097e-10
Identity = 66/250 (26.40%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  695 DAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAG---LKKQGLFDYDEFWDPLFGC--TIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ-DRFAPIRDIWDLVNKNLRKYYIPGEN-LTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKT-SYPLFGIPYLGQ------EQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKN 1402
            +   LF +  +I +IVK++NL+  +  G +   T   E   ++G++  +G   + ++ +F     W+        +  A M ++RF  +  +L   D    +A  D  D+F+ +R +   +N+   K+ +P E   + DE +VP+ GR   +Q++  KP ++G K W  C +    Y  +  PY G+      E+ G   +L     E L E       +  F+N+FTS  L + L S G    GT+RK+
Sbjct:  144 EILELFLDDEVIELIVKYSNLYACSK-GVHLGLTSS-EFKCFLGIIFLSGYVSVPRRRMF-----WEQRTDVHNVLVSAAMRRDRFETIFSNLHVAD----NANLDPVDKFSKLRPLISKLNERCMKF-VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW--CGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEA-HPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKD 378          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|P0DP91|ERPG3_HUMAN (Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.343e-10
Identity = 66/245 (26.94%), Postives = 114/245 (46.53%), Query Frame = 2
Query:  701 FSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGC--TIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ-DRFAPIRDIWDLVNKNLRKYYIPGEN-LTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKT-SYPLFGIPYLGQ------EQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKN 1402
              LF +  +I +IVK++NL+  +  G +   T   E   ++G++  +G     +     FW+        +  A M ++RF  +  +L   D    +A  D  D+F+ +R +   +N+   K+ +P E   + DE +VP+ GR   +Q++  KP ++G K W  C +    Y  +  PY G+      E+ G   +L     E L E       +  F+N+FTS  L + L S G    GT+RK+
Sbjct:  614 LELFLDDEVIELIVKYSNLYACSK-GVHLGLTSS-EFKCFLGIIFLSGYV--SVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVAD----NANLDPVDKFSKLRPLISKLNERCMKF-VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW--CGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHP-GQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKD 846          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q96JS3|PGBD1_HUMAN (PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.431e-8
Identity = 86/373 (23.06%), Postives = 159/373 (42.63%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWK-ETDQMEILAYIGLLIDAGLKKQGLFDYDEFWD-PLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ-DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTS-YPLFGIPYLGQEQAGRAV--------------NLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNK--RCIPQNFLPHRTREVESNVFGFR----RTMTLVSY----VPKKNRAVVVLSTMHHTSEVDNTNKNKSEINL-----YYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDV 1711
            ++ F LFF+     +IV  TN +      KN   E    E+    G+L+ +G  +    +   +W+       + R  + ++RF  +  +L F D    +   DQ D+F  +R +   +NKN   Y    E    D+ +          Q++  KP + G KIW  C + T  Y ++  PY  QE++   V              N A  ++E+   P+     ++ FD++FTS +L ++L  KG+   GT+R+N+  +C   N      ++++   F FR      + L  +    +       V +  ++  S  D  N+   +I+       Y+  K GV  +DQ    + V+ ++++W       ++DV
Sbjct:  420 VELFELFFDDETFNLIVNETNNYASQ---KNVSLEVTVQEMRCVFGVLLLSGFMRHPRREM--YWEVSDTDQNLVRDAIRRDRFELIFSNLHFAD----NGHLDQKDKFTKLRPLIKQMNKNFLLYAPLEEYYCFDKSMCEC---FDSDQFLNGKPIRIGYKIW--CGTTTQGYLVWFEPY--QEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPY-----HLCFDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPLMNV--EHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDV 769          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4C1UEE4 (PiggyBac transposable element-derived protein 4 OS=Eumeta variegata OX=151549 GN=PGBD4 PE=4 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 294/525 (56.00%), Postives = 381/525 (72.57%), Query Frame = 2
Query:  344 MAKRIKLTDGEILRALXXXXXXXXXXXXXXXXXXXXXL---SGSETDVLETASETSDEMFIXXXXXXXXXXXQYIS---YIGKDGTEWNSVPYIKGRTAAHNIIRGGINKVVLPPGKHIDCSLDAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLEN 1900
            MAKR +L   EI RAL ES ++ + + +   +     +   S SE++V E ASE  DE        +     +Y+S   Y G+DGT W S    + RT  HNIIRGGI+KV+LPPG+ I   +D+FSLFF+ +++ IIVK+TN  G  +L   WK TD++E+ A++GLL+   + KQ   D+ E+WDP+FG  I+RA M KNRFA+L R LRFDD  +RS R+ +D+ APIR++W+ VN+NL+K+Y+PGENLTIDEQLVPFRGRV F+QY+PSKPDK+GMKIWW+CDSKTSYPLFGIPYLG+E   RA +LA  ++ QLCEP  R+NRN+TFDNYFTS ++A SL   GLT VGTLRKNK CIP NF P +TR++ESNVFGF + MTLVSYVPKKN A+++LSTMHH  + D    NKSEINLYYNSTKGGVDTLDQ  H ++V+RKT RWPIA F N++DV G+A+ IIWKN++PDWN  K N+ RK+FL+ +  ELV P+I+RRS K L    ++ +   L N
Sbjct:    1 MAKR-QLAQSEIQRALVESDDENISVRECDGDDENFAVDSCSDSESNVTEPASENDDEQL--WSESDDVPIQEYVSIDTYEGRDGTTWKSELDRQSRTPRHNIIRGGIHKVILPPGQAIIDPIDSFSLFFDDHVLEIIVKYTNTEGLRILQNRWKSTDKIEMQAFLGLLLTISVNKQRGVDFREYWDPIFGNPIFRATMGKNRFASLLRFLRFDDKNTRSLRKSKDKLAPIRELWEYVNQNLKKFYLPGENLTIDEQLVPFRGRVSFKQYLPSKPDKHGMKIWWMCDSKTSYPLFGIPYLGKEGQNRAESLAYNVLNQLCEPNIRSNRNVTFDNYFTSIDVAKSLAQNGLTIVGTLRKNKTCIPPNFQPKKTRDIESNVFGFYKNMTLVSYVPKKNHALILLSTMHHGKDEDVNKNNKSEINLYYNSTKGGVDTLDQMVHEYTVRRKTNRWPIAFFQNIIDVVGIASLIIWKNIHPDWNSRKKNTLRKLFLREIATELVTPHIRRRSTKGLSSYHLSGLMMELPN 522          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4C1ZGA0 (PiggyBac transposable element-derived protein 4 OS=Eumeta variegata OX=151549 GN=PGBD4 PE=4 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 4.089e-163
Identity = 238/400 (59.50%), Postives = 294/400 (73.50%), Query Frame = 2
Query:  785 WKETDQMEILAYIGLLIDA----GLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCP 1972
            W E+D + +  Y+   ID     G+ KQG  D+ E+WDP+FG  I+R  M KNRFA+L R LRFDD  +RS R+ +D+ APIR++ + VN+NL+K+Y+PGENLTIDEQLV FRGRV F+QY+P KPDKYGMKIWWICDSKTSYPLFGIPYLG+E   RA NLA  +V QLCEP+ R+NRN+TFDNYF S ++A SL   GLT VGTLRKNK CIP NF P +TR++ESNVFGF + MTLVSYVPKKN AV++LS MHH  E  N N NKSEINLYYNSTKG VDTLDQ  H ++V+RKT RWPIA F N++DV G+A+ IIWKN++PDWN  K N+ R +FL  +  ELV P+I+RRS K L    +A + +     SN      S P    ++RCY+CP
Sbjct:   59 WSESDDVPLQEYVS--IDTYKGRGVNKQGGVDFREYWDPIFGNPIFRTIMGKNRFASLLRFLRFDDKNTRSLRKSKDKLAPIRELCEYVNQNLKKFYLPGENLTIDEQLVSFRGRVSFKQYLPCKPDKYGMKIWWICDSKTSYPLFGIPYLGKEGQNRAENLAYNVVNQLCEPYFRSNRNVTFDNYFMSIDVAKSLAQNGLTIVGTLRKNKTCIPPNFQPKKTRDIESNVFGFYKNMTLVSYVPKKNCAVILLSMMHHGKEDVNKN-NKSEINLYYNSTKGDVDTLDQMVHEYTVRRKTNRWPIAFFQNIIDV-GIASLIIWKNIHPDWNSRKKNTLRILFLHEIATELVTPHIRRRSTKGLSIYHLAAMQDVA--GSNQEATHSSEPAAKRKKRCYICP 452          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4C1U7C2 (PiggyBac transposable element-derived protein 4 OS=Eumeta variegata OX=151549 GN=PGBD4 PE=4 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 1.020e-157
Identity = 239/424 (56.37%), Postives = 306/424 (72.17%), Query Frame = 2
Query:  344 MAKRIKLTDGEILRALXXXXXXXXXXXXXXXXXXXXXL---SGSETDVLETASETSDEMFIXXXXXXXXXXXQYIS---YIGKDGTEWNSVPYIKGRTAAHNIIRGGINKVVLPPGKHIDCSLDAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLY 1597
            MAKR +LT  EI RAL ES ++ + + +   +     +   S SE++V E   E +DE        +     +Y+S   Y G+DGT W S P  + RT  HNIIRGGI+KV+LPP + I   + +FSLF + +++ IIVK+TN  G  VL   WK TD++E+ A++GLL+  G+ KQG  D+ E+WDP+FG  I+RA M KNRFA+L R LRFDD  + S R+ +D+ APIR++W+ VN+NL+K Y+PGENLTIDEQLVPFRGRV F++++PSKPDKYGMKIWWICDSKTSYPLFG+PYLG+E   RA NLA  +V QLC+P+ R+NRN+TFDNYFTS ++A  L   GLT VGTLRKNK CIP NF P +TR++ESNVFGF + MTLVSYVPKKNRAV++LSTMHH  E D    NKSEINLY
Sbjct:    1 MAKR-QLTQSEIQRALVESDDENIFVRECDSDDENFAVDSCSDSESNVTEPTPENNDEQL--WSESDDVPLQEYVSIDTYKGRDGTTWKSEPDRQSRTPRHNIIRGGIHKVILPPRQAIIDPIVSFSLFIDDHVLEIIVKYTNTEGLRVLQNRWKSTDKIEMQAFLGLLLTIGVNKQGSVDFREYWDPIFGNPIFRATMGKNRFASLLRFLRFDDKNTWSLRKSKDKLAPIRELWEYVNQNLKKLYLPGENLTIDEQLVPFRGRVSFKRFLPSKPDKYGMKIWWICDSKTSYPLFGVPYLGKEGQNRAENLAYNVVNQLCQPYFRSNRNVTFDNYFTSIDVAKYLAQNGLTTVGTLRKNKTCIPPNFQPKKTRDIESNVFGFYKNMTLVSYVPKKNRAVILLSTMHHGKEEDVNKNNKSEINLY 421          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4C1VNV0 (PiggyBac transposable element-derived protein 4 OS=Eumeta variegata OX=151549 GN=PGBD4 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 8.055e-133
Identity = 195/318 (61.32%), Postives = 233/318 (73.27%), Query Frame = 2
Query: 1040 NKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRAS 1993
            N+NL+K+Y+PGENLTIDEQLVPFRGRV F+QY+PSKPDKYGMKIWWICDSKTSY LF IPY G+E   RA NLA  +V QLCEP+ R+NRN+TFDNYFTS ++A SL   GLT VGTLRKNK CIP NF P +TR +ESNVFGF   +TLVSY PKKNR V+ LSTMHH  E D    NKSEINLYYNSTKGGVDTLD   H ++V+RKT RWPIA F N++DV G+A+ IIWKN++PDWN  K N+ RK+FL+ +  ELV P+I+RRS K L    +A + +     SN      S P    ++ CY      G A+
Sbjct:    5 NQNLKKFYLPGENLTIDEQLVPFRGRVSFKQYLPSKPDKYGMKIWWICDSKTSYRLFDIPYRGKEGQNRAENLAYNVVNQLCEPYFRSNRNVTFDNYFTSIDVAKSLAQNGLTIVGTLRKNKTCIPPNFQPKKTRHIESNVFGFYENITLVSYGPKKNRTVIFLSTMHHGKEEDVNKNNKSEINLYYNSTKGGVDTLDHMVHEYTVRRKTNRWPIAFFQNIIDVVGIASLIIWKNIHPDWNSHKKNTLRKLFLREIATELVTPHIRRRSTKGLSSYHLAAMQDVA--GSNQEATQSSEPAAKRKKCCYTPLGYHGGAT 320          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Z2EFI1 (PiggyBac transposable element-derived protein 4 OS=Liparis tanakae OX=230148 GN=PGBD4_1 PE=4 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 4.088e-127
Identity = 221/516 (42.83%), Postives = 301/516 (58.33%), Query Frame = 2
Query:  566 IGKDGTEWNSVPYIKGRTAAHNIIRG------GINKVVLPPGKHIDCSLDAFSLFFNYNIIYIIVKFTNLHGR---TVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAV--NLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVD-NTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRR--SVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVCNEHSQKIVVCKTCL 2071
            I + G+ W+  P  +GRT +HNI+R       G++  V P         DA+ LF   +II  ++K TNL GR   T  GK WK   + E +A+IGL + AG +K       E +       +Y+A M+  RF  + R LRFDD  +R+ R + D  A  R +WDL   N R+ +IP + +T+DEQLVPFRGR KF QYMPSKP KYG+KI+W+CD++  Y + GI Y G+ Q G  V  NL   IV+QLC  F  T RNIT DN+FTS  LA  LL K LT VGTLR+NK  IP    P ++REV S  FGF  ++T+VSYV KK +AVV+LSTMHH   VD N+ K K E+  +YN TKGGVDT DQ    ++ KR+T+RWP+  +YN++ +  + A   +   +P++     N+RR +FLK L +ELV P+++ R      L    I  +       +     ++S      R+RC +CPS+K R     CG C   VCN+HSQK VVC  C+
Sbjct:   82 ISRKGSYWSESPPTQGRTQSHNILRSRSGPAQGLSTTVSPK--------DAWQLFITDDIIQEVMKCTNLEGRRVATARGKEWKNVTKDEFIAFIGLTLLAGSEKNWDVSVRELFGSPLHNPMYKATMAIGRFEDIRRTLRFDDKRTRAFRLETDHMAAFRYVWDLFLVNCRQRFIPSDCVTVDEQLVPFRGRCKFLQYMPSKPAKYGLKIFWVCDARIPYAIDGIVYTGR-QPGEEVQKNLGENIVQQLCSRFRNTGRNITMDNFFTSVPLAQHLLEKDLTIVGTLRQNKPDIPPLMKPSKSREVHSTEFGFNDSLTMVSYVRKKGKAVVLLSTMHHDKAVDENSRKKKPEVITFYNKTKGGVDTTDQMVGTYTCKRQTQRWPMVLWYNIIHIATLNAYTFFTAQHPEFKSGITNARR-LFLKELSKELVTPHMRSRLEGCPQLQTPIIEAMERCGVTKATTQPQERSRQGQPKRKRCQICPSSKDRKVNTRCGKCSVPVCNDHSQKQVVCLNCI 587          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000039501.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:21564630:21575712:1 gene:ENSAMXG00000031759.1 transcript:ENSAMXT00000039501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 1.826e-59
Identity = 145/431 (33.64%), Postives = 221/431 (51.28%), Query Frame = 2
Query:  560 SYIGKDGTEWNSVPYIKGRTAAHNIIRGGINKVVLPPGKHID---CSLDAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAG-RAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFR------RTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKN-KSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQEL 1819
            S   +DGT W      +    A N+  G + +   P    +D     L +     +  +  +I K T           +K T   E+ A++ L    G+        D++W    G  I+   +++ RF  + RHLRFDD  +R+AR + D+FA I +++    +N    Y+PGEN+T+ EQL P + R +F QY+ +K DK+G+K W   D+ T Y L   PYLG+++       +  ++V +L EPF    RNIT   +F S  LA+ LL    T VGT+RK+K+  PQ        + +S +F  +       T+T+    PK+N  V VLSTMH T  VDN+ +   + I+ YYN TK  VD LD+  H ++VK  TRRWP+A FYN++D+  + A I++K        TK    R+ F+  LV+EL
Sbjct:  520 SQEARDGTVWVEQSAGEPWVGAWNVEFGVLRETPGPTKYAMDKITSPLSSLMCLIDEEMWEMIQKHTQAEIDRSDTDGFKLT-AAELKAFVALTYMRGITGGKTMKLDDYWSSDLGNPIFLKTLTRQRFRDIMRHLRFDDKNTRAARHETDKFAMISELFYKFVQNSIASYVPGENITVGEQLFPTKARCRFAQYVLNK-DKFGLKFWVAADADTKYVLNIFPYLGKDEGKLSGQRVKDSVVTRLVEPFLDKGRNITTSGFFPSLALASHLLVNKTTVVGTIRKSKQETPQ------CTQTQSEIFNTKVLRTGNTTLTIYQAKPKEN--VCVLSTMHQTVSVDNSEQKLPNSISHYYN-TKFTVDVLDRMAHLYTVKNGTRRWPVAVFYNILDLAAINAHILYKRC------TKAKISRRKFIIELVKEL 933          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: nsd3 (nuclear receptor binding SET domain protein 3 [Source:ZFIN;Acc:ZDB-GENE-050324-2])

HSP 1 Score: 191.045 bits (484), Expect = 6.734e-52
Identity = 104/242 (42.98%), Postives = 143/242 (59.09%), Query Frame = 2
Query:  698 AFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNL--ARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIP 1417
            +F LFF  ++I +I++ TNLHGR  +   W + D+ EI AY+GLLI AG+ +         WD   G  ++RA MS  RF  +S  LRFDD L+R  R  +D+ +   ++WD   + L   + PGEN+ +DEQLVPFRGR KF QYMPSKP KYG+KIW   D  TSY      Y G+  AG A+ +   + ++  + E  +     +T DN+FTSY LA  LL K +  VGT+R NK  +P
Sbjct:  328 SFDLFFTPDMIQLILQMTNLHGRRSVS-GWSDVDETEIRAYMGLLILAGVYRSKGESTRSLWDDQNGRPVFRATMSHKRFQLISASLRFDDRLTRPCRHKEDKLSAFCNMWDKWVQRLPLLFNPGENICVDEQLVPFRGRCKFGQYMPSKPAKYGLKIWVTTDVATSYAWRCQVYTGKP-AGGALEMGQGKRVILDMTEGLKGV--TVTCDNFFTSYSLAQELLRKKVALVGTIRANKPELP 565          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000025849.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20558813:20568326:-1 gene:ENSAMXG00000025123.2 transcript:ENSAMXT00000025849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 1.200e-35
Identity = 128/492 (26.02%), Postives = 216/492 (43.90%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHG--RTVLGKN--WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFW--DPLFGCTIYRACMSKNRFAALS--RHLRFDDLLSRSARR----DQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEP-FERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMH--HTSEVDNTNKNKSEINL------------YYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGK-NVCNEHSQKIVVCK--TCLNK 2077
            L+ F LFF +  +  + + TN        +GK   W + D  +   Y GL++   L K  +    ++W  D LF  ++    MS++R+  +S   HL   D + ++ R+    + D+   ++ + D +    + +Y P +NL +DE++V  + +    QYM +KP K+G K++ + DS+  Y +    Y G+        L+  +V  L +P +  T  +I  DN+++S +L  +L     +  GT R N++  PQ  +   T+  E     + R   +V       R V V ST+H  H+ E+  +   + + +              YN   GGVD  DQ    +S + KT RW    FY+ +D+    + I+ K L     K  +  R   FL+ L  EL    +  +S    P   +      L++++       S   T  RRRC  C S   R  K     C K +    HSQ IV+    T +NK
Sbjct:   79 LELFKLFFPFETVQTMCQNTNKQAAKNQSMGKKYKWTDLDVEDFYKYCGLVLYMSLVK--VDSISDYWRQDHLFSLSLPAQIMSRDRYRTISWNLHLSDPDEVVKNNRKKGTAEHDKLFQLKPLMDTIKNACKSFYHPHKNLAVDERMVASKAKNVMTQYMKAKPIKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSYDVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRDNRKGCPQTDVNALTKRSERGSIRWIRDGPIVYVKWMDTREVSVCSTIHPAHSGEIAQSRMKQDDGSWAKVSIPCPTPVKQYNQHMGGVDLSDQLIQYYSAQHKTMRWYRKMFYHFLDIATTNSFILHKELCLAQEKQPLTQR--AFLEKLTSELCGRPLLTKSSAKSPADHVPVAISNLQSAT------PSDKATTGRRRCEHCQSQGRR--KDTPWKCSKFSGPTYHSQNIVIVTGLTVINK 558          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000030524.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:5821371:5823572:-1 gene:ENSAMXG00000031777.1 transcript:ENSAMXT00000030524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 1.790e-32
Identity = 117/464 (25.22%), Postives = 201/464 (43.32%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHGRTVLGKN----WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFW--DPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQ-------DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEP-FERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMH--HTSEV-------DNTNKNKSEIN-----LYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQEL----VIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGR 1987
            LD F LFF    +  + + TN      L +     W + D  E   Y GL++   L K  +    ++W  D LF  ++    MS++R+  +S ++   D        DQ       D+   ++ + + +    + +Y P + L +DE++V  + +    QYM SKP K+G K++ + DS+  Y +    Y G+        L+  +V  L +P +  T  +I  DN+++S +L  +L     +  GT R+N++  PQ  +   T+  E     + R   +V       RAV + ST+H  H+ E        ++ +  K+ +        YN   GGVD  DQ    +S + KT RW    FY+ +D+    + I+ K       +  +    K FL+ L  EL    ++ +  R    H+P          +  +S+    D S   T  RRRC  C  ++GR
Sbjct:  187 LDLFKLFFPVQTVQTLCQNTNKQAAKNLSEGKKYKWTDLDAEEFYKYCGLVLYMALIK--VDSVSDYWRQDHLFSLSLPSQIMSRDRYRTVSWNIHLSDP-DEDVHNDQKKGTAQHDKLFRLKPLMETIKNACKAFYHPHKELAVDERMVASKAKTGMTQYMKSKPTKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSYDVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRENRKGCPQTDVNALTKRSERGSIRWIRDGPIVYVKWMDTRAVSMCSTIHPAHSGETVQRRVKREDGSWTKTSVPCPTPVAEYNKHMGGVDLSDQLIQCYSAQHKTMRWYRKLFYHFLDIATTNSFILHKEHCVAHQQQHLT--HKAFLEKLTSELCGRPLLTSPARSPAGHVP----------VPITSSPQSADPSERATTGRRRCEFC-QSQGR 634          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: si:ch211-130m23.5 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:103027433])

HSP 1 Score: 125.946 bits (315), Expect = 1.302e-29
Identity = 109/412 (26.46%), Postives = 179/412 (43.45%), Query Frame = 2
Query:  689 SLDAFSLFFNYNIIYIIVKFTN---LHGRTVLGK---NWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFW--DPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRD--QDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAG-RAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEV----------DNTNKNKSEIN----------LYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSR---RKIFLKNLVQELV 1822
            +LD F L F  ++   +V+ TN   L+ +   G+   +W  TD  E+ AY+GL I  G+ +  L DY  +W  D   G   ++  M+  RF  L+++L   D LS  ++ +   D    IR + D+V   +   Y+P   LT+DE  +  +GR    QYMPSKP + G+K+W +CDS++ Y      ++G+         L   +V  L    E    ++  D++FTS  L   LL  G+   G     +R  P    P    +++   F   +   LV+ V +  + V  LS+      V          D  + + S ++          L Y     GVD  DQ    + V R  ++W     +  V++C V A II +           N +   ++ F   L Q+L+
Sbjct:  201 TLDYFRLLFPDSLFEHMVEQTNNYALYRQRRSGRSDPHWHPTDVREMRAYVGLNILMGINQ--LPDYGMYWASDIFIGNAGFKKTMTARRFEKLNQNLHLCDRLSEPSKGELGYDGLYKIRPLLDMVGNTMWDSYLPNRCLTVDECAIATKGRFSPTQYMPSKPLRKGLKVWMLCDSRSGYCHRTRLHVGKPSDDVSTAALGHRMVMSLVRGLEGRYHHLFMDSFFTSVPLLQRLLQDGIYSCGPTNPYRRGYPDALKPRNVGKLDPGEFYQCQRGNLVATVTRDAKVVSCLSSNSAPGIVGIGPGSKRDGDVGDGDASSLSALGIPRPLPLLLYQENMRGVDLCDQLRECYQVGRPCKKWWRYFLWFYVNLCIVNAYIILRESRGGVPPAGFNGKEFTQRHFRVRLAQQLI 610          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 7.771e-32
Identity = 93/317 (29.34%), Postives = 151/317 (47.63%), Query Frame = 2
Query:  785 WKETDQMEILAYIGLLIDAGLKKQGLFDYDEFW-----DPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSAR--RDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLART----IVEQLCEPFERTNRNITFDNYFTSYELANSLLSK-GLTCVGTLRKNKRCIPQNFLPHRTREVESNV-----FGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKN--KSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRW 1678
            W  T   E+ A+  + I  G+K     D    W     +P   C      M+  R++ +S++L   + +   AR  R  D    +R++ + V  N  ++Y P   L++DE ++PF+GR+ F+Q+MP+KP K+G+K+W +C+++T Y L    Y G+   G A   A      +V  L   +   N ++ FD YF+S  L   L S+ G    GT+  ++R +P        REV S +     F F +   LV  V +  R V  LST      V   ++   K    ++YN   GGVD  DQ    ++V R +++W
Sbjct:    1 WSPTTSREMKAFFAVAIMMGIK-----DLPRVWCYWSGNPALRCEWVSGTMTHTRYSKVSQYLHARNNVGTPARGQRGYDPIYKVRNVVEEVRANFSRHYSPRRELSVDEGMIPFKGRLFFKQHMPAKPTKWGVKVWELCEAQTGYCLNFDIYTGRSAYGAATTAAAALGYRVVMSLTRSYWHRNHHLYFDRYFSSPALLEDLRSRCGTYACGTVSLSRRGLPPP-----AREVASLLRHRGDFAFFQKGGLVLSVWRDKRVVATLSTNQDPRMVRPVDEGPIKPAPVVHYNRFMGGVDRSDQYRSYYAVGRASKKW 307          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 3.267e-23
Identity = 107/486 (22.02%), Postives = 186/486 (38.27%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHGRTVLG-------KNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDP--LFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNK----------SEINLY-------YNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLC-PSAKGRASKQCCGNCGKNVC-------NEHSQK 2047
            L    LF    ++      TN +    L          W+  + M+I  Y+GL +  G+    L +   +W     +    +R  MS  RF ++ R     +  +   R + DR   +R + +      +  Y P   L++DE  + ++GR+ F+ Y P KP+KYG+K + + +++T Y      Y+G E++       R IV  L  P       +  DNY+ S +L   L   G+   GTLR + R  P++       ++  +   FRR            R V +++ +H+    +   + K          S I L        Y     GV   DQ    +   RKT +W        + +    A +++K    D  K  + +  ++    L+     P     SV   P+ T  T     E++   ++  +        RRC +C  + + R +   C  C   +C         HSQK
Sbjct:   17 LGFIQLFITRELLMFFTNETNSYANCALANKSAEERAGWEGVNLMDIANYLGLTMAMGVA--SLPEIPMYWSTGKPYSMPAFRETMSCKRFKSIGRFFNCHNSCA-VPRDNTDRLLQVRTVMEYFQSKFKALYAPNRELSLDEATLEWKGRLPFKVYNPQKPEKYGIKFYILAEAQTGYVFNFDIYVGIEKS------IRNIVFGLMGPLLDKGYQLYMDNYYNSVKLTEELYEHGVHTCGTLRLS-RGAPKDLQALAKMKIPRDSIHFRRKGNTFVICWMNTRLVTLITNIHNADTHNFVRQQKTRKRDGTALLSRIELQRPNAIADYMDHMRGVVHFDQMIQYYHFTRKTHKWTKKIVLYFLQMALHNAYVLYKKYSTDEKKLTLLAFHEVLFNALIH--FDPQEWAVSVDVTPQLTQVT-----EHAMTSIMPSQ--------RRCRVCYRNGRRRDTTWECNVCKIPLCLRGDCFVQYHSQK 477          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001816.1 (pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-1 gene:ENSPMAG00000001650.1 transcript:ENSPMAT00000001816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 2.469e-17
Identity = 95/436 (21.79%), Postives = 170/436 (38.99%), Query Frame = 2
Query:  659 VLPPGKHIDCSLDAFSLFFNYNIIYIIVKFTNLH-------------GRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRF--DDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQ---AG-------RAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPK---KNRAVVV---------LSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWK--NLYPDWNKTKMNSRRKIFLKNLVQELVI---PNIKR 1840
             LP G      LD F LF    ++  IV  TN H             G   +    +   +  +  ++G+++  G+       Y    D   G    R  +S  RF+ L R+L    D+      R   D    IR + D +     ++++P  ++ +DE L  F+ R      +P+ P + G+K++    + T Y    + + G      AG       ++  L      +L E     + ++ F   F S  L +  L +G    G +R N R  P+     R   ++     FR++  LV+ + K   +N A++          +    H  +V+ + K    +N  YN   G VD   Q    F + R+ R+W    F+ L++   V + I+++  N+    N       R +  K LV  + +   P ++R
Sbjct:   14 ALPAGSQ---PLDYFKLFLTDEMLDRIVTETNRHAARCGANMHLTGPGPGSVSGEGRPVTRSSLSTFLGVVLIMGINMLPALPYHWADDDSLGNQFIRRSISHKRFSFLQRYLHISDDEKAPSRGRIGYDPLHKIRPLLDHLLGAFSRHFVPFRDMRLDEVLSKFKDRHDALPCVPANPIRCGVKVFICSCASTGYVHSLLVHAGGHDIVVAGGLWRRRNKSFPLGYRAAMRLTERLHGVHHHVYFGKLFGSARLLSDFLQRGTYGCGLVRPNSRGFPKEL---RDSRLQPGDTKFRQSGQLVACIHKANTENMAIIASNSRPESERMQRRFHNYDVEGSQKPHPLLN--YNMCMGKVDIASQLQTWFELGREGRKWWKYMFFFLLNTAVVNSYILYRLSNMPQPRNAMSQLEFRLLLAKQLVGRVDVRKGPGLRR 441          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Nematostella
Match: EDO38800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBW9])

HSP 1 Score: 53.1434 bits (126), Expect = 4.280e-8
Identity = 39/141 (27.66%), Postives = 65/141 (46.10%), Query Frame = 2
Query: 1286 EPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINL----------YYNSTKGGVDTLDQKCHAFSVKRKTRRW 1678
            + F  T  N+ FDN+F+S  L  SLL + +  + T R+N++   +     + +  ES V    +   + + V +  R    LST       D  N+   + +L           YN   GGVD  DQKC+ + ++ ++RRW
Sbjct:   27 KSFGGTLGNLYFDNFFSSVGLMASLLERRIYAMATTRQNRKEFLKEMNTFKLKRGESKVM---QKSGVNACVWQDKRKDFFLSTNAQPIGQDTVNQKNKDGSLCEVRAPLCVVVYNKYTGGVDYADQKCNDYRIRIESRRW 164          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 346.28 bits (887), Expect = 1.303e-109
Identity = 195/512 (38.09%), Postives = 289/512 (56.45%), Query Frame = 2
Query:  560 SYIGKDGT-EWNSVPY-IKGRTAAHNIIRGGINKVVLPPG------KHIDCSLDAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAV-NLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVCNEHSQKIVVCKTC 2068
            ++  KDG  +W++ P+  +GR ++ NII+       + PG        +D    AF LF +  I  II+  TNL GR V  + WK  DQ ++ AYIG+LI AG+ +         W+   G  I+RA MS   F  +SR +RFD+  +R  RR+ D+ A IRD+WD   + L   Y PG ++T+DE+LVPFRGR  FRQYMP+KP KYG+KIW  CD+K+SY      Y G+   G    N    +V ++ E  +    NIT DN+FTSY L   L  + LT +GT+R+NK  +P   L  + R + S++F F    T+VSY PK+N+ V+V+STMH  + +   +  K ++ L YNSTKGGVD LD+    +S +RKT RWP+A F+N+VDV    A ++W  +  +WN  K+  RR++FL+ L + L+ P I+RR+      +  A I +    +SN   +D    +   R+RC +CPS     +   C  C   +C +H+  +  C +C
Sbjct:   77 TWASKDGNIKWSTSPHQSRGRLSSSNIIK-------MTPGPTRFAVTRVDDIQSAFQLFISQPIERIILDMTNLEGRRVFQEKWKSLDQTDLNAYIGILILAGVYRSKGEATSSLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDVWDKWVEILPLLYNPGPHVTVDERLVPFRGRCPFRQYMPNKPAKYGIKIWAACDAKSSYAWKMQVYTGKSPGGAPEKNQGMRVVLEMSEGLQ--GHNITCDNFFTSYRLGEELQKRKLTMLGTVRRNKPELPSEILKIQGRPMHSSIFAFTEKATVVSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQEWNAGKL-YRRRLFLEELGKALITPKIQRRARPARSPAAAAVIEKIKFRTSNQFAMDPVDTDVKKRKRCQVCPSRDDSKTSTSCVKCKNFICRKHT--VTFCPSC 576          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000029842.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101157644])

HSP 1 Score: 318.931 bits (816), Expect = 1.815e-96
Identity = 177/451 (39.25%), Postives = 264/451 (58.54%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHG--RTVLGKNWKETDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAG-RAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKN-KSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIA-TINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVC 2029
            L +F LFF  N+  +I+  TN H   +    K  K  D++E+ AY+GLLI AG+ +         W+P  G  I+ A MS   F   S  LRFDD  +R++R   DR A +R++W+     L + Y  G  +T+DE++VPF+GR  FRQY+PSKP KYG+K+W  CD++TSY     PY+G+  +G R  NLA  +V  L    E  +RN+T DN+FTSY LA  LL + +T +GT++ NK  +P      R RE  S+ F F      +SYVPKKN+ V++LST H   E+ +  ++ K E+ L YN TKGGVD LD+    +S +R T+RWP+A F+N++D+    A +IW+ ++PDW     N RR+IFL+ L ++LV P + RR  K +P++  A  +  +++ +        S      R+RC +CP +K   +   C +CGK++C
Sbjct:  371 LSSFLLFFTPNVERLILIATNRHSADKAHALKTPKPMDEIELRAYVGLLILAGVYRSRGEALVSLWEPECGRPIFGATMSLRSFYQRSATLRFDDRSTRASRSASDRLAAVREVWEEWCDRLPRLYDIGPEVTVDERMVPFKGRCSFRQYIPSKPTKYGLKLWVACDARTSYAWRVQPYMGKLASGARETNLASRVVSDLTRGLE--HRNVTCDNFFTSYALATELLKRNITLLGTIKSNKPELPPELASARGREALSSRFAFTDCAAALSYVPKKNKNVLLLSTKHSRVEICHERRDKKPEMILDYNKTKGGVDNLDKLLATYSCRRMTKRWPLAMFHNMIDMSAYNAYVIWREMHPDWMPWNRN-RRRIFLEQLGKDLVRPLVLRR--KRVPRARPAYDLMVSMQEAGGT-----SARSEGKRKRCQICPRSKDTKTLISCKSCGKSIC 811          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000027888.1 (pep primary_assembly:ASM223467v1:17:9217998:9219211:-1 gene:ENSORLG00000025878.1 transcript:ENSORLT00000027888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.092 bits (697), Expect = 3.557e-84
Identity = 146/375 (38.93%), Postives = 217/375 (57.87%), Query Frame = 2
Query:  920 MSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAV-NLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVCNEHS 2041
            MS   F  +SR +RFD+  +R  RR+ D+ A IRD+WD   + L   Y PG ++T+DE+LVPFRGR  F+QYMP+KP KYG+KIW  CD+K++Y      Y G+   G    N    +V ++ E  +    NIT DN+FTSY L   L  + L  +GT+R+NK  +P   L  + R + S++F F    T+VSY PK+N+ V+V+STMH  + +   +  K ++ L YNSTKGGVD LD+    +S +RKT RWP+A F+N+VDV    A ++W  +  +WN  K+  RR++FL+ L + L+ P I+RR+      +  A +       SN   +D    +   R+RC +CPS     +   C  C   +C +H+
Sbjct:    1 MSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDLWDKWVEILPLLYNPGPHVTVDERLVPFRGRCPFQQYMPNKPAKYGIKIWAACDAKSNYAWKMQVYTGKLPGGAPEKNQGMRVVLEMSEGLQ--GHNITCDNFFTSYRLGEELQKRKLIMLGTVRRNKPELPSEILNIQGRPMHSSIFAFTEKATVVSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQEWNAGKL-YRRQLFLEELSKALITPKIQRRARPARSPAAAAVVKNIKFRPSNQSAMDPVDTDVKKRKRCQVCPSRDDSKTSTSCAKCKNYICRKHT 372          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000036570.1 (pep primary_assembly:ASM223467v1:15:4424179:4426102:1 gene:ENSORLG00000027498.1 transcript:ENSORLT00000036570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 1.146e-30
Identity = 130/491 (26.48%), Postives = 215/491 (43.79%), Query Frame = 2
Query:  662 LPPGKHIDCSLDAFSLFFNYNIIYIIVKFTNLHG-----RTVLGKNWKETDQ-MEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYY-IP-GENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVN--------LARTIVEQLCEPFERTNRN-ITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTM----TLVSYVPKKNRAVVVLST---MHHTSEVDN-TNKNKSEINL-------YYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFL---KNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVC 2029
            LP    I    + F +FF+ +I+ ++V+ +NL+         L    KE +Q M    Y+ L         GL     FW+     +     M+ NR+  + R L F++    +  R  +   P+  I  LV     K   IP GE L +DEQ+V F+GR + +QY+P+KP K+G KI  +  S       G+P+  +   GR V          +  +V  L +P  +  ++ + FDN+FTS  L  +L  +G+ C GT+R N+            +      F  +  M    TL +     NR+V +LS     H  ++VD    K K  I +        YN   GGVD LD     +  K ++++W     ++ +D+  V A +++K    D + T M+   +I L   K+ + E +    +RR     P + I   +  L+ +++ +V+DK       + RC + P  KG   K  C  C   +C
Sbjct:   93 LPKSDDIKSPYEYFKMFFSEDILEVVVEQSNLYAIQCNTNKPLNLTTKELEQFMGTAVYMSLF--------GLPGTRMFWNKATLVSQVADTMALNRWEFIKRCLHFNN----NKVRQGENVDPLHKIRPLVTHLTSKLQTIPMGEKLAVDEQMVTFKGRNRLKQYLPAKPKKWGYKILVLAGSD------GVPHNFEIYTGRVVQPPELPDVGASGNVVLHLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNRLPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRSVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIAPYRTKIRSKKWYHRLMFHFIDMTTVTAWLLYKR---DCSSTGMSKEEQIRLCTFKSYIGESLCKKKRRRG----PATPIPVPDVRLDATAHWMVMDKK------KGRCKV-PGCKG-TPKAKCQKCDVRLC 550          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000038522.1 (pep primary_assembly:ASM223467v1:10:9345195:9347118:-1 gene:ENSORLG00000027882.1 transcript:ENSORLT00000038522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 3.133e-30
Identity = 129/490 (26.33%), Postives = 214/490 (43.67%), Query Frame = 2
Query:  662 LPPGKHIDCSLDAFSLFFNYNIIYIIVKFTNLHG-----RTVLGKNWKETDQ-MEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIP-GENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVN--------LARTIVEQLCEPFERTNRN-ITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTM----TLVSYVPKKNRAVVVLST---MHHTSEVDN-TNKNKSEINL-------YYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFL---KNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRASKQCCGNCGKNVC 2029
            LP    I    + F +FF+ +I+ ++V+ +NL+         L    KE +Q M    Y+ L         GL     FW+     +     MS NR+  + + L F++   R    + D    IR +   +   L+   IP GE L +DEQ+VPF+GR + +QY+P+KP K+G KI  +  S       G+P+  +   GR V          +  +V +L +P  +  ++ + FDN+FTS  L  +L  +G+ C GT+R N+            +      F  +  M    TL +     NR V +LS     H  ++VD    K K  I +        YN   GGVD LD     +  K ++ +W     ++ +D+  V A +++K    D + T M+   +I L   K+ + E +    +RR     P + I      L+ +++ +V+D+       + RC + P  KG   K  C  C   +C
Sbjct:   93 LPKSDDIKSPYEYFKMFFSEDILEVVVEQSNLYAIQCNTNKPLNLTTKELEQFMGTAVYMSLF--------GLPGTRMFWNKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGE-NVDHLHKIRPLVTHLTSKLQT--IPMGEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAGSD------GVPHNFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNRLPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIALYRTKIRSNKWYHRLMFHFIDMTTVTAWLLYKR---DCSSTGMSKEEQIRLYTFKSYIGESLCKKKRRRG----PATPIPVPEVRLDATAHWMVMDEK------KGRCKV-PGCKG-TPKAKCQKCDVRLC 550          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000081807.1 (SMESG000081807.1)

HSP 1 Score: 249.595 bits (636), Expect = 1.879e-74
Identity = 158/457 (34.57%), Postives = 236/457 (51.64%), Query Frame = 2
Query:  761 GRTVLGKNWKETDQ---MEILAYIGLLIDAGL---KKQGLFDYDEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEV-DNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSR---RKIFL----KNLVQELVIPNIKRRSVKHLPKSTIATINETLENSSNIVVIDKSVPET------NIRRRCYLCPSAKGRASKQCCGNCGKNVCNEHSQKIVVCKTCL 2071
            G++   K+ K  D    +E+ A +G++I  G+   KK+ L   ++ W  ++G  + R  +  NRF       RFDD  +R+ R+  D+FA IR+++D    N ++ Y P   L +DE  V FRG   FR Y+PSKPD+YG+K+W +CD+ T Y      YLG++           +V+QL  P   + RN+T DN+FTSY+L   LLS+ +T +GT+RK++  IP  FL     E ES  F F +   LVSY P KNR VV+LSTMH+   V D+    K  + L YN TKG VD  DQ+   +S   KTR+WP+  FY ++D   + A ++     P W   + + R   R++FL     +L++ ++I     +S+ H P    A           + V  K  P T        R RC  C   + +  K  C  C + VC +H +K +   TCL
Sbjct:   18 GQSTAEKDPKYLDDFTIVEMKAAVGIMILVGVMCSKKESL---NQLWFEVYGRPLLRTTIPLNRFRIFLSSARFDDKTTRNDRQKTDKFAAIRELFDHFVDNRQELYTPSPYLCVDETQVEFRGGCPFRVYIPSKPDRYGIKVWSLCDNGTHYVTNLQVYLGKKGQSPKHQQGTRVVKQLMLPLYNSGRNVTTDNFFTSYDLGQFLLSQNITLLGTMRKSRTEIPPEFLSKSREEFESK-FAFTKDTALVSYAPPKNRTVVLLSTMHNRPVVFDDGRGRKPYMVLDYNMTKGAVDAFDQEVSFYSFAHKTRQWPMRLFYFIIDASCLNAFVLLNMNNPTWKDHEGSRRLDKRRLFLTKAAHSLMKPMIIARADNKSISHKPSVARAI----------LAVGVKPTPSTLPGQVAKKRGRCQSCSRKQEQKVKHRCTKCSQFVCGKHGRKELT-YTCL 459          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000070813.1 (SMESG000070813.1)

HSP 1 Score: 197.593 bits (501), Expect = 2.178e-56
Identity = 115/301 (38.21%), Postives = 159/301 (52.82%), Query Frame = 2
Query:  971 LLSRSARRDQ--DRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRRSVKHLPKS 1867
            +++R  R+ +  D+   IR  +D   +N +  YIP   +TIDE L  +RGR  FR YM SKP +YG+KIW   D +TSY                          +C     T  ++T DN+FTS  LA  LL+  +   GTLR NKR IP  F   R  E+ SN FG+   +TLVSY+PKK +AV +L T  H +E+     NK  I LYYN TKG VD+ D     +S+ R TRRW    F  L+D+    A ++WK ++PDW +   + RRK+FL+ L + L   N++ R      KS
Sbjct:   64 MVTRDERKQKNGDKLEAIRSTFDQFVENCQNAYIPKSVITIDECLATYRGRCPFRVYMKSKPGRYGIKIWIDADVETSY--------------------------ICNLQVYTGFSVTTDNFFTSVPLALKLLNNKIYLTGTLRTNKREIPVQFQVSRRSELSSN-FGYNINLTLVSYIPKKGKAVNLLITKFHNNEICKEENNKPRIILYYNKTKGAVDSGDMMTFEYSIVRVTRRWAFRLFMELIDIAAFNAYVVWKAVHPDW-RNNDSGRRKVFLRELAKALATKNVQDRKYDMFHKS 336          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000080622.1 (SMESG000080622.1)

HSP 1 Score: 139.813 bits (351), Expect = 8.129e-36
Identity = 74/172 (43.02%), Postives = 102/172 (59.30%), Query Frame = 2
Query:  872 DEFWDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQA-GRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCV 1384
            DE W    G  I+R  MS NRF  + R LRFD+  +R  R  +D+FA +R + D   +N +K Y+PGE++TIDEQL P+RGR KF QYMPSKP KYG+K W +CDS+  Y      Y+G+E      V+    I   + +    + RN+T DN+FTS  L+  L   G+T +
Sbjct:  118 DELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKFAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSKPSKYGLKFWAVCDSQNYYCWNLRFYMGKEDDRDMQVSCGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITML 289          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000047155.1 (SMESG000047155.1)

HSP 1 Score: 141.739 bits (356), Expect = 3.126e-35
Identity = 132/469 (28.14%), Postives = 207/469 (44.14%), Query Frame = 2
Query:  692 LDAFSLFFNYNIIYIIVKFTNLHG-----------RTVLGKNWKETDQMEILAYIGL-LIDAGLKKQG---LFDYDEF-WDPLFGCTIYRACMSKNRFAALSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEIN-----LYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQFYNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKR--RSVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRR----RCYLCPSAKGR-ASKQCCGNC 2014
            +  F   ++  ++ +I+K TN +G           R     N+K TD +E+  ++GL L+ + LK      LF  D   + P F      + MS  RF  + R    ++          D    I+   DL+ +     Y P E L++DE L+ FRGR+ FR YM  K  KYG+K + +C S   Y L    Y G  +    +    ++V +L + +     ++  DNY+ S  L+N LLSK     GTLR N++ +PQ     + R+ E      R+  T VS   K  R V+ L+T +H S ++  N+ + E       + YN    GVD  DQ    +S  RKT RW     ++L+DV       +W + Y    KT    +   + + +++ L   + KR  R++    ++ I T NE   N +       S PE   R+    RC  C     R  +  CC NC
Sbjct:   94 IQVFEKIWDDQVMEMIIKSTNDYGIKLCNQARPHTRHSRKANFKNTDMIEMRKFLGLCLLQSQLKFSSIRKLFSIDALHYHPAFP-----SQMSGRRFEQILRCFCVEE------ENSNDPLRKIKIFLDLLIQKFANAYAPNEALSLDESLLLFRGRLYFRTYMKGKKAKYGIKFYELC-SAQGYVLNIEVYKGHRENDENMTTIESLVMRLMQSYLNKGHHLFMDNYYNSLPLSNKLLSKKTHVTGTLRVNRKGLPQEITRRKLRKGEH--VWRRQNQTYVSKW-KDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVA------VWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQT-NEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNC 540          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000076680.1 (SMESG000076680.1)

HSP 1 Score: 140.969 bits (354), Expect = 6.417e-34
Identity = 83/220 (37.73%), Postives = 124/220 (56.36%), Query Frame = 2
Query: 1007 FAPIRDIWDLVNKNLRKYYIPGENLTIDEQLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAGRAV-----NLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTLRKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMHHTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAF 1651
             +PIR I+D++N+ L ++Y PG +L I E LV    RV+F QY+PSKP K+G+KI+W+ +++ + PL  + Y+ Q      V     +    +  +L   +   + NIT +NYFT++ LA+ LL K  T VGTLR N+R IP        R    N   +    T+ S+  + N+ VV+LSTM H  +VD  +  K ++  YYNSTK  VD LD+    F
Sbjct: 1913 LSPIRKIFDIINRKLYEFYRPGPHLCIGEMLVECYRRVRFHQYIPSKPGKFGIKIFWLMNAENAMPLQCLVYIVQGTFAHGVIEKYTSFCEAVTMELTYSYLEKSHNITMNNYFTTFALADRLLEKNTTMVGTLRHNEREIPPVAKCVTNRNRGDNKHYYNGNRTICSFWDESNKPVVLLSTM-HGCQVDRGD-GKPDVVPYYNSTKSVVDKLDKLVRMF 2130          
The following BLAST results are available for this feature:
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGBD45.644e-2823.88piggyBac transposable element derived 4 [Source:HG... [more]
PGBD21.824e-1222.83piggyBac transposable element derived 2 [Source:HG... [more]
ERCC62.284e-1126.40ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC69.044e-1126.94ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC69.044e-1126.94ERCC excision repair 6, chromatin remodeling facto... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG131512.614e-921.34gene:FBgn0033750 transcript:FBtr0087939[more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01072083.22.148e-8934.49dual specificity phosphatase 26 [Source:NCBI gene;... [more]
CABZ01069162.16.530e-3125.74pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
si:ch211-130m23.59.092e-3126.83si:ch211-130m23.5 [Source:ZFIN;Acc:ZDB-GENE-131121... [more]
si:dkey-19f4.22.336e-2925.23si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
pgbd44.642e-2525.05piggyBac transposable element derived 4 [Source:ZF... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr21.518e-6335.43neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000026678.16.322e-3928.07pep primary_assembly:Xenopus_tropicalis_v9.1:4:886... [more]
wdtc11.873e-3828.07WD and tetratricopeptide repeats 1 [Source:Xenbase... [more]
ENSXETT00000039775.12.005e-3828.07pep primary_assembly:Xenopus_tropicalis_v9.1:1:120... [more]
ENSXETT00000042747.12.180e-3828.07pep primary_assembly:Xenopus_tropicalis_v9.1:7:947... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96DM1|PGBD4_HUMAN2.711e-2723.88PiggyBac transposable element-derived protein 4 OS... [more]
sp|Q6P3X8|PGBD2_HUMAN8.760e-1222.83PiggyBac transposable element-derived protein 2 OS... [more]
sp|Q8N328|PGBD3_HUMAN1.097e-1026.40PiggyBac transposable element-derived protein 3 OS... [more]
sp|P0DP91|ERPG3_HUMAN4.343e-1026.94Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=96... [more]
sp|Q96JS3|PGBD1_HUMAN2.431e-823.06PiggyBac transposable element-derived protein 1 OS... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1UEE40.000e+056.00PiggyBac transposable element-derived protein 4 OS... [more]
A0A4C1ZGA04.089e-16359.50PiggyBac transposable element-derived protein 4 OS... [more]
A0A4C1U7C21.020e-15756.37PiggyBac transposable element-derived protein 4 OS... [more]
A0A4C1VNV08.055e-13361.32PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Z2EFI14.088e-12742.83PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039501.11.826e-5933.64pep primary_assembly:Astyanax_mexicanus-2.0:19:215... [more]
nsd36.734e-5242.98nuclear receptor binding SET domain protein 3 [Sou... [more]
ENSAMXT00000025849.21.200e-3526.02pep primary_assembly:Astyanax_mexicanus-2.0:6:2055... [more]
ENSAMXT00000030524.11.790e-3225.22pep primary_assembly:Astyanax_mexicanus-2.0:8:5821... [more]
si:ch211-130m23.51.302e-2926.46piggyBac transposable element-derived protein 4-li... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007705.17.771e-3229.34pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000002004.13.267e-2322.02pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
ENSPMAT00000001816.12.469e-1721.79pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO388004.280e-827.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037833.11.303e-10938.09piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000029842.11.815e-9639.25piggyBac transposable element-derived protein 4 [S... [more]
ENSORLT00000027888.13.557e-8438.93pep primary_assembly:ASM223467v1:17:9217998:921921... [more]
ENSORLT00000036570.11.146e-3026.48pep primary_assembly:ASM223467v1:15:4424179:442610... [more]
ENSORLT00000038522.13.133e-3026.33pep primary_assembly:ASM223467v1:10:9345195:934711... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081807.11.879e-7434.57SMESG000081807.1[more]
SMESG000070813.12.178e-5638.21SMESG000070813.1[more]
SMESG000080622.18.129e-3643.02SMESG000080622.1[more]
SMESG000047155.13.126e-3528.14SMESG000047155.1[more]
SMESG000076680.16.417e-3437.73SMESG000076680.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014863 ID=SMED30014863|Name=PiggyBac transposable element-derived protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2272bp
TAGAAACTTCATATCATATAATTCCGACGTAAAATACCAAATTGTGACTC
TAAGACACATATTAATTTACTTAGATAAAGTAATGGTTTTACTATACTTT
ACTTGGTAATGGTTTTCAAATATTCAAAAGTGAATACTAAGTAGGTATAG
TGTTGTTATAGAAACTTAAAATCTTGTGACAAAGTACAATAGTAAATTTT
ATTATTTATTTTTGTTTCTGGTTGGTGGTATATTAGTGCCCATACTTTTA
TATTTGGTTCAAGATAAGCATTTTTTCTAAAAGCAGGTAAGAGGCTATAA
TATAATATTGTCCAGATAACAAATTGTATATTTTGTTTCAAGGATGGCTA
AAAGAATTAAATTAACTGACGGAGAAATACTCAGAGCTTTAGAAGAAAGT
AGTGAAGACGAAGTAGAAATTGAAGATAATTCAGAAGAAATGATTGAAAA
TGATCTCTCAGGTAGTGAAACTGACGTATTAGAAACTGCTTCCGAAACTA
GTGATGAAATGTTTATAAGTGAAGATAGTGAAGAAAGTGATAACGAAAAT
CAATATATTTCGTACATAGGTAAAGATGGTACAGAGTGGAACTCTGTACC
ATATATCAAGGGCCGAACTGCTGCTCATAATATTATTAGAGGAGGAATAA
ATAAAGTTGTCTTACCGCCAGGCAAGCATATCGATTGTTCTCTAGATGCG
TTTTCGTTATTTTTCAATTATAATATTATTTATATTATCGTTAAATTCAC
AAATTTACATGGCAGAACTGTTCTTGGCAAAAATTGGAAGGAAACCGACC
AAATGGAAATACTTGCATATATTGGATTATTGATAGATGCTGGATTAAAA
AAGCAAGGATTATTTGATTATGATGAATTTTGGGATCCATTATTTGGCTG
CACAATCTATCGTGCGTGCATGTCAAAAAACAGATTTGCAGCATTATCTC
GTCATTTACGTTTTGATGACCTGTTATCAAGATCGGCGCGTAGAGATCAA
GATAGATTTGCACCAATTAGAGATATCTGGGATCTCGTCAACAAAAATTT
GAGAAAGTATTATATCCCAGGAGAAAATTTAACAATTGATGAGCAACTGG
TGCCATTTAGAGGTAGAGTTAAATTCCGACAGTATATGCCCTCCAAACCA
GATAAATACGGAATGAAGATTTGGTGGATATGTGATAGCAAGACTAGTTA
TCCTTTATTTGGAATACCGTACCTTGGACAAGAGCAAGCTGGTAGAGCAG
TAAATTTGGCCAGAACTATTGTTGAACAATTATGCGAACCATTTGAGAGA
ACAAATAGAAATATCACATTCGACAATTATTTTACAAGTTACGAACTTGC
AAATAGCTTATTGTCCAAGGGCCTTACATGTGTAGGTACCTTACGAAAGA
ACAAACGATGTATACCACAAAACTTTCTTCCTCATAGAACTAGAGAAGTT
GAAAGTAACGTTTTTGGTTTCCGAAGGACAATGACGCTAGTCAGTTACGT
ACCAAAAAAAAATCGAGCTGTTGTCGTACTATCAACCATGCACCACACTT
CTGAAGTGGACAACACAAATAAAAATAAATCAGAAATAAACTTGTATTAT
AATAGTACAAAAGGTGGGGTTGATACGTTGGACCAAAAGTGTCATGCTTT
TTCGGTAAAACGGAAAACCCGTAGATGGCCGATTGCACAATTTTATAATC
TCGTGGACGTATGTGGTGTAGCTGCAGAAATTATTTGGAAAAATTTATAT
CCGGATTGGAACAAAACTAAAATGAATTCGCGACGCAAGATATTTTTGAA
GAATTTAGTGCAAGAATTAGTAATACCAAATATAAAACGTAGAAGTGTAA
AACATTTGCCTAAAAGTACCATTGCTACAATCAACGAAACTTTGGAAAAT
TCTTCAAATATTGTGGTGATTGATAAATCAGTTCCTGAAACAAATATTCG
CAGACGATGTTACCTTTGTCCATCAGCAAAAGGTCGAGCCTCCAAACAAT
GTTGTGGTAATTGTGGGAAAAATGTATGTAATGAACATTCCCAAAAAATC
GTGGTTTGCAAAACATGTTTAAATAAGTAAATGATATTTTATTTTATTTT
TCTTATGAATAAATGACATTACAGATATAACTATATGCATTTTTAATATG
TGTCTTAAAGTCACATCGTGATGTTTTACGTAAGTATATTAACCTAGTAA
TAATAGGGTTAAGAACTTCCCGTTAATAATAATTGTTTTCGTTTGAACCA
GCTTTGTAGTTAATTAAATCTT
back to top

protein sequence of SMED30014863-orf-1

>SMED30014863-orf-1 ID=SMED30014863-orf-1|Name=SMED30014863-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MAKRIKLTDGEILRALEESSEDEVEIEDNSEEMIENDLSGSETDVLETAS
ETSDEMFISEDSEESDNENQYISYIGKDGTEWNSVPYIKGRTAAHNIIRG
GINKVVLPPGKHIDCSLDAFSLFFNYNIIYIIVKFTNLHGRTVLGKNWKE
TDQMEILAYIGLLIDAGLKKQGLFDYDEFWDPLFGCTIYRACMSKNRFAA
LSRHLRFDDLLSRSARRDQDRFAPIRDIWDLVNKNLRKYYIPGENLTIDE
QLVPFRGRVKFRQYMPSKPDKYGMKIWWICDSKTSYPLFGIPYLGQEQAG
RAVNLARTIVEQLCEPFERTNRNITFDNYFTSYELANSLLSKGLTCVGTL
RKNKRCIPQNFLPHRTREVESNVFGFRRTMTLVSYVPKKNRAVVVLSTMH
HTSEVDNTNKNKSEINLYYNSTKGGVDTLDQKCHAFSVKRKTRRWPIAQF
YNLVDVCGVAAEIIWKNLYPDWNKTKMNSRRKIFLKNLVQELVIPNIKRR
SVKHLPKSTIATINETLENSSNIVVIDKSVPETNIRRRCYLCPSAKGRAS
KQCCGNCGKNVCNEHSQKIVVCKTCLNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane