Dynein light chain

Overview
NameDynein light chain
Smed IDSMED30014848
Length (bp)660
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein light chain (SMED30014848) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein light chain (SMED30014848) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein light chain (SMED30014848) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein light chain (SMED30014848) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014848

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014848SMESG000043518.1 SmedASXL_005073SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014848 SmedASXL_061461SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014848SMESG000043518.1 dd_Smed_v4_5284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30014848SMESG000043518.1 dd_Smed_v4_5284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014848SMESG000043518.1 dd_Smed_v6_5284_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testis primordiumSMED30014848SMESG000043518.1 Contig176_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL2 (dynein light chain LC8-type 2 [Source:HGNC Symbol;Acc:HGNC:24596])

HSP 1 Score: 179.874 bits (455), Expect = 3.357e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 174.866 bits (442), Expect = 2.958e-56
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQD+VECATQA+EK+NIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 174.866 bits (442), Expect = 2.958e-56
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQD+VECATQA+EK+NIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 174.866 bits (442), Expect = 2.958e-56
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQD+VECATQA+EK+NIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 174.866 bits (442), Expect = 2.958e-56
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQD+VECATQA+EK+NIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 176.792 bits (447), Expect = 2.528e-57
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMS+DMQQDA++CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 176.792 bits (447), Expect = 2.528e-57
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMS+DMQQDA++CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 176.792 bits (447), Expect = 2.528e-57
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMS+DMQQDA++CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-5 (Dynein Light Chain [Source:UniProtKB/TrEMBL;Acc:Q65XS9])

HSP 1 Score: 87.0409 bits (214), Expect = 3.082e-21
Identity = 35/84 (41.67%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  152 AVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            A ++++ M   M+Q+A   A +++  +++E DIA ++K  FD++Y P WHCI G++FGS+VT E   FIYF +G +A +LFK+ 
Sbjct:   58 ADVQHSRMPRHMEQEACSLAAKSIMTYHLEHDIARHLKMAFDREYGPDWHCICGKHFGSFVTFEPDSFIYFRIGTIAFMLFKTS 141          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-2 (Probable dynein light chain 2, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q21557])

HSP 1 Score: 75.8702 bits (185), Expect = 5.191e-18
Identity = 37/86 (43.02%), Postives = 55/86 (63.95%), Query Frame = 2
Query:  149 KAVIKNADMSEDMQQDAV-ECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            K  +K  DM ED Q+D V     +A   +NI+KD+AA++K+E DKK+  TWH I G+ FGS V++E  HFI     +V ++++K G
Sbjct:    5 KIEVKETDM-EDPQRDMVISVVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGKCFGSRVSYEMGHFILLKCNKVNVMIYKCG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070706)

HSP 1 Score: 176.407 bits (446), Expect = 3.992e-57
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQDAV+CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET+HFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070704)

HSP 1 Score: 176.407 bits (446), Expect = 3.992e-57
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQDAV+CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET+HFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0307065)

HSP 1 Score: 176.407 bits (446), Expect = 3.992e-57
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQDAV+CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET+HFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070707)

HSP 1 Score: 176.407 bits (446), Expect = 3.992e-57
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQDAV+CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET+HFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0474174)

HSP 1 Score: 181.415 bits (459), Expect = 9.179e-57
Identity = 83/91 (91.21%), Postives = 89/91 (97.80%), Query Frame = 2
Query:  131 MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            M+D  RKAVIKNADMSE+MQQDAV+CATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET+HFIYFYLGQVAILLFKSG
Sbjct:    1 MSD--RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 179.874 bits (455), Expect = 2.089e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2b (dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:ZDB-GENE-050320-132])

HSP 1 Score: 179.874 bits (455), Expect = 2.089e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 179.874 bits (455), Expect = 2.089e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 178.718 bits (452), Expect = 6.949e-58
Identity = 85/91 (93.41%), Postives = 89/91 (97.80%), Query Frame = 2
Query:  131 MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            M+D  RKAVIKNADMSE+MQQDAVECATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    1 MSD--RKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 178.718 bits (452), Expect = 6.949e-58
Identity = 85/91 (93.41%), Postives = 89/91 (97.80%), Query Frame = 2
Query:  131 MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            M+D  RKAVIKNADMSE+MQQDAVECATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    1 MSD--RKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: dynll2 (dynein light chain LC8-type 2 [Source:NCBI gene;Acc:100038056])

HSP 1 Score: 179.874 bits (455), Expect = 3.043e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: dynll1 (dynein light chain LC8-type 1 [Source:NCBI gene;Acc:448652])

HSP 1 Score: 177.178 bits (448), Expect = 3.922e-57
Identity = 82/86 (95.35%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQDAV+CATQA+EKFNIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: ENSXETT00000015639.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:48978690:48979872:1 gene:ENSXETG00000009974.1 transcript:ENSXETT00000015639.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 2.822e-16
Identity = 42/87 (48.28%), Postives = 53/87 (60.92%), Query Frame = -3
Query:  146 LTRFK**YCNLTQIEINEMLRLMSNIAPEISPYNTMPCWIVFLIKFFLDIRSNVFFNVKFLHCLSCTFYSILLHIF*HVSIFYNSFS 406
            L RFK   CNL QI+++E+L  M  IA ++S  + +P        + LDI SNVF N+  LHCL  T  SILLH+F HVSI  NS S
Sbjct:    3 LARFKEENCNLAQIKVDEVLCFMCYIAAKVSANDAVPI-------YLLDIGSNVFLNIILLHCLCGTVNSILLHVFRHVSILDNSLS 82          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: rnf181 (ring finger protein 181 [Source:Xenbase;Acc:XB-GENE-964051])

HSP 1 Score: 65.855 bits (159), Expect = 1.460e-13
Identity = 32/84 (38.10%), Postives = 52/84 (61.90%), Query Frame = 2
Query:  152 AVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAA-YIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIY-FYLGQVAILLFK 397
             +I++ DM E+M+ + +E    A EKF    + AA  IK+  DKK+  +WH ++G  FG  +THE K+ +Y F+ G +AI ++K
Sbjct:   21 PLIRHTDMPEEMRVETMELCVTACEKFASNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYMFFGGSLAICVWK 104          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 179.874 bits (455), Expect = 2.305e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 179.874 bits (455), Expect = 2.305e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 179.874 bits (455), Expect = 2.305e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll1 (dynein light chain LC8-type 1 [Source:MGI Symbol;Acc:MGI:1861457])

HSP 1 Score: 174.866 bits (442), Expect = 2.031e-56
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQD+VECATQA+EK+NIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll1 (dynein light chain LC8-type 1 [Source:MGI Symbol;Acc:MGI:1861457])

HSP 1 Score: 174.866 bits (442), Expect = 2.031e-56
Identity = 81/86 (94.19%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQD+VECATQA+EK+NIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q78P75|DYL2_RAT (Dynein light chain 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll2 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.612e-57
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q9D0M5|DYL2_MOUSE (Dynein light chain 2, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll2 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.612e-57
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q96FJ2|DYL2_HUMAN (Dynein light chain 2, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL2 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.612e-57
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q3MHR3|DYL2_BOVIN (Dynein light chain 2, cytoplasmic OS=Bos taurus OX=9913 GN=DYNLL2 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.612e-57
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|O02414|DYL1_HELCR (Dynein light chain LC6, flagellar outer arm OS=Heliocidaris crassispina OX=1043166 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.217e-56
Identity = 82/86 (95.35%), Postives = 85/86 (98.84%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADM EDMQQDAV+CATQA+EKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVA+LLFKSG
Sbjct:    4 RKAVIKNADMPEDMQQDAVDCATQALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG 89          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A2U3WA94 (Dynein light chain OS=Odobenus rosmarus divergens OX=9708 GN=DYNLL2 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 8.332e-57
Identity = 93/119 (78.15%), Postives = 104/119 (87.39%), Query Frame = 2
Query:   50 RWYI*YIHATRIFY*LYYI-FSRFANTEMADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RW +  I  T++F  L+ +   R+++  M+D  RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    6 RWLL--ITVTKLF--LWTLGMRRWSSVTMSD--RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 118          
BLAST of Dynein light chain vs. TrEMBL
Match: V9LE93 (Dynein light chain (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 9.834e-57
Identity = 85/99 (85.86%), Postives = 92/99 (92.93%), Query Frame = 2
Query:  107 FSRFANTEMADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
             +RF+  E+    RKAVIKNADM+E+MQQDAVECATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:   52 LARFSRNEVTMSERKAVIKNADMAEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 150          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A2U3WA81 (Dynein light chain OS=Odobenus rosmarus divergens OX=9708 GN=DYNLL2 PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.380e-56
Identity = 87/97 (89.69%), Postives = 93/97 (95.88%), Query Frame = 2
Query:  113 RFANTEMADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            R+++  M+D  RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    3 RWSSVTMSD--RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 97          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A2U9BTB9 (Dynein light chain OS=Scophthalmus maximus OX=52904 GN=SMAX5B_010507 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.757e-56
Identity = 90/107 (84.11%), Postives = 95/107 (88.79%), Query Frame = 2
Query:  104 IFSRFANTE-------MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            +FSR  N +       M+D  RKAVIKNADMSEDMQQDAVECATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:   43 LFSRITNCKRETRRATMSD--RKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 147          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A091EHP7 (Dynein light chain OS=Fukomys damarensis OX=885580 GN=H920_03708 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.246e-56
Identity = 87/97 (89.69%), Postives = 91/97 (93.81%), Query Frame = 2
Query:  113 RFANTEMADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            R  +  M+D  RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:   43 RLESVTMSD--RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 137          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: ENSAMXT00000047143.1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 179.874 bits (455), Expect = 1.771e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dynll2b (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 179.874 bits (455), Expect = 1.771e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 160.229 bits (404), Expect = 2.765e-50
Identity = 76/82 (92.68%), Postives = 80/82 (97.56%), Query Frame = 2
Query:  131 MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ 376
            M+D  RKAVIKNADMSE+MQQDAVECATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ
Sbjct:    1 MSD--RKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ 80          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: ENSAMXT00000013314.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:23335261:23337700:1 gene:ENSAMXG00000012944.2 transcript:ENSAMXT00000013314.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.379e-20
Identity = 37/88 (42.05%), Postives = 56/88 (63.64%), Query Frame = -3
Query:  140 TRFK**YCNLTQIEINEMLRLMSNIAPEISPYNTMPCWIVFLIKFFLDIRSNVFFNVKFLHCLSCTFYSILLHIF*HVSIFYNSFSTS 403
             RF+  Y +L Q+E++E+LRL+ ++  E+  +N +P W+V L   F D+R +V   V  LHCL CT   +LLH+  HVS+  +SFS S
Sbjct:    4 ARFEQEYGHLAQVEVDEVLRLVGDVTAEVPAHNAVPSWVVLLAYLF-DVRCDVLLYVVLLHCLCCTVDCVLLHVLRHVSVLDHSFSVS 90          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: ENSAMXT00000025088.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:35277932:35282302:-1 gene:ENSAMXG00000024374.2 transcript:ENSAMXT00000025088.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 1.550e-15
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -3
Query:  161 CNLTQIEINEMLRLMSNIAPEISPYNTMPCWIVFLIKFFL---DIRSNVFFNVKFLHCLSCTFYSILLHIF*HVSIF 382
            C+L Q+E++E+L L+ ++A E+  ++ +P  +V L+K      D+ S+V  +V FL  LS TF SILLH+  HV IF
Sbjct:   11 CHLAQVEVDEVLGLVGDVAAEVPAHDAVPGGVVLLVKLLTHLFDVGSDVLLDVVFLQSLSGTFNSILLHLLRHVRIF 87          
BLAST of Dynein light chain vs. Ensembl Yeast
Match: DYN2 (Cytoplasmic light chain dynein, microtubule motor protein; required for intracellular transport and cell division; involved in mitotic spindle positioning; forms complex with dynein intermediate chain Pac11p that promotes Dyn1p homodimerization, potentiates motor processivity; Dyn2p-Pac11p complex important for interaction of dynein motor complex with dynactin complex; acts as molecular glue to dimerize, stabilize Nup82-Nsp1-Nup159 complex module of cytoplasmic pore filaments [Source:SGD;Acc:S000002832])

HSP 1 Score: 100.523 bits (249), Expect = 3.123e-28
Identity = 39/83 (46.99%), Postives = 63/83 (75.90%), Query Frame = 2
Query:  152 AVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 400
             ++K +D+++ +++D +  +  A++K+ +E+DIA  +KK+ D KY  TWH IVG+NFGSYVTHE  HF+YFY+G +A L+FK+
Sbjct:    9 PIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKT 91          
BLAST of Dynein light chain vs. Ensembl Nematostella
Match: EDO44582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI5])

HSP 1 Score: 176.022 bits (445), Expect = 2.203e-57
Identity = 81/86 (94.19%), Postives = 85/86 (98.84%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADM+EDMQ DA+ECATQA+EKFNIEKDIAA+IKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Nematostella
Match: EDO38557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCP2])

HSP 1 Score: 67.3958 bits (163), Expect = 9.776e-15
Identity = 32/83 (38.55%), Postives = 54/83 (65.06%), Query Frame = 2
Query:  155 VIKNADMSEDMQQDAVECATQAMEKFNIEKDIAA-YIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIY-FYLGQVAILLFK 397
            +I+ +DM+++M+ +A+E    A EKF+   + AA  IK+  DKK+  +WH +VG  FG  +THE ++ +Y F+ G  AI ++K
Sbjct:   26 LIRYSDMNDEMRTEAMELCVTACEKFSNNNETAAKMIKESMDKKFGASWHAVVGEGFGFEITHEVRNLLYMFFGGTTAICIWK 108          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: dynll1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101171417])

HSP 1 Score: 180.259 bits (456), Expect = 1.296e-58
Identity = 84/86 (97.67%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSEDMQQDAVECATQA+EK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: ENSORLT00000005747.2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101162462])

HSP 1 Score: 178.333 bits (451), Expect = 8.865e-58
Identity = 83/86 (96.51%), Postives = 86/86 (100.00%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMSE+MQQDAV+CATQAMEK+NIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNADMSEEMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: DYNLL2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101174042])

HSP 1 Score: 172.555 bits (436), Expect = 1.222e-55
Identity = 79/86 (91.86%), Postives = 85/86 (98.84%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            +KAVIKNADMS++MQQDAV+CA QAMEK+NIEKDIAAY+KKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 KKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: ENSORLT00000006686.2 (pep primary_assembly:ASM223467v1:14:12601680:12602092:1 gene:ENSORLG00000005302.2 transcript:ENSORLT00000006686.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 2.502e-17
Identity = 38/78 (48.72%), Postives = 53/78 (67.95%), Query Frame = -3
Query:  161 NLTQIEINEMLRLMSNIAPEISPYNTMPCWIVFLIKF-----FLDIRSNVFFNVKFLHCLSCTFYSILLHIF*HVSIF 379
            +LTQ+E++EMLRL+ +IA ++ P N +PC +VFL+KF      LDI SN+F ++  LH L  T + ILLH   HV IF
Sbjct:   27 HLTQVEVDEMLRLVGHIATKVPPNNAVPCRVVFLVKFLDPTYLLDICSNIFLDIVLLHGLHGTVHCILLHFIRHVCIF 104          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: ENSORLT00000028916.1 (pep primary_assembly:ASM223467v1:9:6243543:6247014:-1 gene:ENSORLG00000022487.1 transcript:ENSORLT00000028916.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 8.718e-15
Identity = 34/87 (39.08%), Postives = 53/87 (60.92%), Query Frame = -3
Query:  146 LTRFK**YCNLTQIEINEMLRLMSNIAPEISPYNTMPCWIVFLIKFFLDIRSNVFFNVKFLHCLSCTFYSILLHIF*HVSIFYNSFS 406
            L+R +    +LTQ+E+NEML L+S++A E+ P N +P  +VFL++       +VF +V  L  L  T + +LLH+  HV IF +  S
Sbjct:    3 LSRLEQQNGHLTQVEVNEMLGLVSHVAAEVPPNNAVPSRVVFLVELL-----DVFLDVVLLQGLCGTLHGVLLHVLRHVGIFDHCLS 84          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000043518.1 (SMESG000043518.1)

HSP 1 Score: 192.586 bits (488), Expect = 1.286e-63
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 2
Query:  131 MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    1 MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 91          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000003543.1 (SMESG000003543.1)

HSP 1 Score: 183.341 bits (464), Expect = 6.345e-60
Identity = 84/91 (92.31%), Postives = 89/91 (97.80%), Query Frame = 2
Query:  131 MADGGRKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            M+D  RKAVIKNADM++DMQQ+A+ECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    1 MSDSSRKAVIKNADMADDMQQEAIECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 91          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000024590.1 (SMESG000024590.1)

HSP 1 Score: 168.318 bits (425), Expect = 4.697e-54
Identity = 76/86 (88.37%), Postives = 83/86 (96.51%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKN+DMSE+MQQDA+ECA  AMEK+N+EKDIAAY+KKEFD+KYNPTWH IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RKAVIKNSDMSEEMQQDAIECAVVAMEKYNVEKDIAAYLKKEFDRKYNPTWHAIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000017229.1 (SMESG000017229.1)

HSP 1 Score: 167.933 bits (424), Expect = 7.269e-54
Identity = 76/86 (88.37%), Postives = 83/86 (96.51%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            RKAVIKNADMS+DMQQ+A++ A QAMEK+N+EKDIAAYIKKEFDKKYNPTWH IVGRNFGSYVTHETKHFIYFYLGQVA+LLFKSG
Sbjct:    4 RKAVIKNADMSDDMQQEAIDVALQAMEKYNVEKDIAAYIKKEFDKKYNPTWHAIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG 89          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000073811.1 (SMESG000073811.1)

HSP 1 Score: 166.007 bits (419), Expect = 4.167e-53
Identity = 77/86 (89.53%), Postives = 81/86 (94.19%), Query Frame = 2
Query:  146 RKAVIKNADMSEDMQQDAVECATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 403
            R+AVIKNADM EDMQ+ AV CAT AMEK+NIEKDIAA+IKKEFDK YNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sbjct:    4 RQAVIKNADMQEDMQEAAVNCATTAMEKYNIEKDIAAFIKKEFDKLYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
The following BLAST results are available for this feature:
BLAST of Dynein light chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNLL23.357e-5897.67dynein light chain LC8-type 2 [Source:HGNC Symbol;... [more]
DYNLL12.958e-5694.19dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL12.958e-5694.19dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL12.958e-5694.19dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL12.958e-5694.19dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlc-12.528e-5794.19Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-12.528e-5794.19Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-12.528e-5794.19Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-53.082e-2141.67Dynein Light Chain [Source:UniProtKB/TrEMBL;Acc:Q... [more]
dlc-25.191e-1843.02Probable dynein light chain 2, cytoplasmic [Sourc... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctp3.992e-5794.19gene:FBgn0011760 transcript:FBtr0070706[more]
ctp3.992e-5794.19gene:FBgn0011760 transcript:FBtr0070704[more]
ctp3.992e-5794.19gene:FBgn0011760 transcript:FBtr0307065[more]
ctp3.992e-5794.19gene:FBgn0011760 transcript:FBtr0070707[more]
ctp9.179e-5791.21gene:FBgn0011760 transcript:FBtr0474174[more]
back to top
BLAST of Dynein light chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dynll2a2.089e-5897.67dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
dynll2b2.089e-5897.67dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:... [more]
dynll2a2.089e-5897.67dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
dynll16.949e-5893.41dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
dynll16.949e-5893.41dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dynll23.043e-5897.67dynein light chain LC8-type 2 [Source:NCBI gene;Ac... [more]
dynll13.922e-5795.35dynein light chain LC8-type 1 [Source:NCBI gene;Ac... [more]
ENSXETT00000015639.12.822e-1648.28pep primary_assembly:Xenopus_tropicalis_v9.1:2:489... [more]
rnf1811.460e-1338.10ring finger protein 181 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dynll22.305e-5897.67dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll22.305e-5897.67dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll22.305e-5897.67dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll12.031e-5694.19dynein light chain LC8-type 1 [Source:MGI Symbol;A... [more]
Dynll12.031e-5694.19dynein light chain LC8-type 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Dynein light chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q78P75|DYL2_RAT1.612e-5797.67Dynein light chain 2, cytoplasmic OS=Rattus norveg... [more]
sp|Q9D0M5|DYL2_MOUSE1.612e-5797.67Dynein light chain 2, cytoplasmic OS=Mus musculus ... [more]
sp|Q96FJ2|DYL2_HUMAN1.612e-5797.67Dynein light chain 2, cytoplasmic OS=Homo sapiens ... [more]
sp|Q3MHR3|DYL2_BOVIN1.612e-5797.67Dynein light chain 2, cytoplasmic OS=Bos taurus OX... [more]
sp|O02414|DYL1_HELCR1.217e-5695.35Dynein light chain LC6, flagellar outer arm OS=Hel... [more]
back to top
BLAST of Dynein light chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2U3WA948.332e-5778.15Dynein light chain OS=Odobenus rosmarus divergens ... [more]
V9LE939.834e-5785.86Dynein light chain (Fragment) OS=Callorhinchus mil... [more]
A0A2U3WA811.380e-5689.69Dynein light chain OS=Odobenus rosmarus divergens ... [more]
A0A2U9BTB91.757e-5684.11Dynein light chain OS=Scophthalmus maximus OX=5290... [more]
A0A091EHP72.246e-5689.69Dynein light chain OS=Fukomys damarensis OX=885580... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047143.11.771e-5897.67dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll2b1.771e-5897.67dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll12.765e-5092.68dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000013314.21.379e-2042.05pep primary_assembly:Astyanax_mexicanus-2.0:1:2333... [more]
ENSAMXT00000025088.21.550e-1541.56pep primary_assembly:Astyanax_mexicanus-2.0:6:3527... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN23.123e-2846.99Cytoplasmic light chain dynein, microtubule motor ... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO445822.203e-5794.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385579.776e-1538.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dynll11.296e-5897.67dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
ENSORLT00000005747.28.865e-5896.51dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
DYNLL21.222e-5591.86dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
ENSORLT00000006686.22.502e-1748.72pep primary_assembly:ASM223467v1:14:12601680:12602... [more]
ENSORLT00000028916.18.718e-1539.08pep primary_assembly:ASM223467v1:9:6243543:6247014... [more]
back to top
BLAST of Dynein light chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043518.11.286e-63100.00SMESG000043518.1[more]
SMESG000003543.16.345e-6092.31SMESG000003543.1[more]
SMESG000024590.14.697e-5488.37SMESG000024590.1[more]
SMESG000017229.17.269e-5488.37SMESG000017229.1[more]
SMESG000073811.14.167e-5389.53SMESG000073811.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014848 ID=SMED30014848|Name=Dynein light chain|organism=Schmidtea mediterranea sexual|type=transcript|length=660bp
AACAAATAAGCAATAGTTTCAAAACTATTCTACTAAAATCAGCCAATAAA
GATGGTATATTTGATATATCCATGCAACGAGAATATTCTACTAATTATAT
TATATATTTTCGCGGTTTGCAAACACTGAAATGGCAGACGGAGGTAGAAA
AGCTGTTATAAAAAATGCTGACATGTCAGAAGATATGCAGCAAGATGCTG
TAGAATGTGCAACTCAAGCAATGGAGAAATTTAACATTGAAAAAGACATT
GCTGCGTATATCAAGAAAGAATTTGATAAGAAATACAATCCAACATGGCA
TTGTATTGTAGGGAGAAATTTCGGGAGCTATGTTACTCATGAGACGAAGC
ATTTCATTTATTTCTATTTGGGTCAAGTTGCAATATTACTATTTAAATCT
GGTTAATTGTTGTCGGTAAATGTTGTGAAATAATAGTTAAATATCTAATG
AGGCCTGTTTCTTTTTTCAAGTTGATGTTTCAATAAATGTCGTTTGCCGA
TGTCAGTTAAGTTAAATCTTACAATATTTTTAAAAAACATTCATATGGAC
ATCCTTATTAATTGGTGTAGGTTAAAAATTTTCGTTTTTACATTTTTAAT
GTAAAGTGACAGTGTTGGAAATATAATTACATTAATAAAAAAAAAAAAAA
AAAAATGCGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR001372Dynein_light_chain_typ-1/2
IPR019763Dynein_light_1/2_CS
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0005875microtubule associated complex
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0005868cytoplasmic dynein complex
GO:0005874microtubule
GO:0016020membrane
GO:0016459myosin complex
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0006810transport
GO:0008039synaptic target recognition
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0005515protein binding
GO:0008092cytoskeletal protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 3..90
e-value: 4.8E-61
score: 218.8
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 7..90
e-value: 7.3E-44
score: 148.0
IPR001372Dynein light chain, type 1/2PANTHERPTHR11886DYNEIN LIGHT CHAINcoord: 5..91
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 4..91
e-value: 3.9E-49
score: 166.7
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 6..91
NoneNo IPR availablePANTHERPTHR11886:SF62DYNEIN LIGHT CHAINcoord: 5..91
IPR019763Dynein light chain, type 1/2, conserved sitePROSITEPS01239DYNEIN_LIGHT_1coord: 57..71